Patent Grant
12070495
Human Immunodeficiency Virus (HIV) is a lentivirus that primarily infects hosts and cells through communication of bodily fluids or through pregnancy. HIV infects cells essential to the immune system, such as CD4+ T cells, macrophages, and dendritic cells, ultimately causing cell death. When the rate and magnitude of cell death causes essential cell levels to fall below critical levels, it become increasingly more difficult for the host to mount an effective immune response, leading to acquired immunodeficiency syndrome (AIDS). Without treatment, the average survival time after infection with HIV is estimated to be 9 to 11 years.
Provided herein are mRNA-based immunogenic compositions (e.g., vaccines) and therapies that elicit neutralizing antibodies against a broad range of human immunodeficiency virus (HIV) (e.g., HIV-1) strains circulating worldwide. Use of mRNA as a vehicle for eliciting broadly neutralizing antibodies against multiple strains of HIV has the advantage of persistent in vivo expression of endogenous proteins (e.g., identical to those found in nature). Further, the co-formulation used herein, with mRNA encoding HIV Env and mRNA encoding lentivirus Gag, enables in vivo production of extracellular virus-like particles (VLPs), mimicking natural infection. Further still, the use in some embodiments of mRNA encoding full-length or partially truncated membrane-bound HIV Env gp160 or gp150 provides a bona fide “native” confirmation of expressed Env, unlike truncated soluble Env SOSIP trimers. Other embodiments provided herein provide mRNA-based immunogenic compositions that further include mRNA encoding the viral protease that is used for Gag processing, and/or mRNA encoding furin, which is used for Env processing. The intensive immunization protocols provided herein mimic continuous, high-level antigenic load in HIV-infected patients who develop broad neutralizing antibodies against HIV, and the multiple-strain heterologous boost dosing focuses the antibody response on “common” broad neutralizing antibody epitopes to the exclusion of strain-specific epitopes. In some embodiments, complete filling of Env glycan holes provides the additional advantage of an exclusion of dominant antibody responses against vaccine-irrelevant epitopes.
Induction of neutralizing antibodies with a broad spectrum of action against heterologous tier-2 isolates is a key requirement for a bona fide protective HIV-1 vaccine. Yet, none of the vaccine strategies hitherto devised has achieved this objective. In the studies presented herein, an intensive HIV-1 envelope (Env)-based immunization scheme was tested in rhesus macaques. Four groups of animals were immunized with coformulated HIV-1 Env (WITO gp150, Clade B) and SIV Gag (from SIVmac239) in order to promote the in vivo formation and release of virus-like particles. Two groups of animals received wild-type Env and two received interdomain-stabilized Env bearing the amino acid 113-432 disulfide bridge (Zhang et al., Cell Host & Microbe 2018; 23: 832); two groups received mRNA only, while two received mRNA followed by protein boost with the autologous SOSIP trimer. All groups were subsequently boosted with mRNA expressing Env from two heterologous HIV-1 isolates (BG505, Clade A, and DU422, Clade C); again, two groups received autologous protein boosts. High titers of neutralizing antibodies against the autologous Env (WITO.27) or against tier-1a viruses were readily induced after the second autologous immunization, becoming increasingly more persistent after each booster injection. Following the third heterologous boost, low titers of neutralizing antibodies against heterologous tier-2 viruses of different Clades were detected, including JR-FL and 12 Envs of different Clades derived from the reference small global panel. Further boosting with either mRNA or protein increased both the magnitude and durability of cross-Clade tier-2 heterologous NAb titers. Live virus challenges have been performed using repeated low-dose mucosal inoculation of a heterologous tier-2 SHIV (AD8) resulting in complete protection or delayed infection. These results provide evidence for the elicitation of cross-Clade tier-2 heterologous broadly neutralizing antibodies by mRNA immunization in a preclinical vaccine model.
In some aspects, the present disclosure provides methods of inducing in a human subject an immune response to HIV (e.g., HIV-1), the methods comprising (a) during a first period of time, administering to a subject an initial dose and multiple autologous boost doses of an HIV mRNA vaccine comprising mRNA encoding an HIV envelope (Env) protein and a mRNA encoding a lentivirus group-specific antigen (Gag) protein formulated in a lipid nanoparticle, (b) during a second period of time, administering to the subject multiple heterologous boost doses of an HIV mRNA vaccine comprising mRNA encoding an HIV Env protein and a mRNA encoding a lentivirus Gag protein formulated in a lipid nanoparticle, and (c) producing in the subject a broad and potent neutralizing antibody response against multiple strains of HIV.
In other aspects, the methods comprise, in addition to mRNA encoding Env and Gag, mRNA encoding one or both of two enzymes that are used for the full proteolytic processing of Gag and Env, respectively, and thereby promote a more efficient production and release of properly formed virus-like particles. The two enzymes are: i) the viral protease of HIV-1 or SIV, for Gag processing, and furin, a host enzyme for Env processing.
In some embodiments, the broad and potent neutralizing antibody response comprises the production of neutralizing antibodies that bind to shared epitopes on Env proteins from the multiple strains of HIV, including multiple tier-2 strains from different Clades. In some embodiments, the broadly neutralizing antibody response has an ID50 titer of greater than 20 or greater than 50.
In some embodiments, the first period of time is 1-30 weeks following administration of the initial dose of the HIV mRNA vaccine. In some embodiments, the second period of time is 30-60 weeks following administration of the initial dose of the HIV mRNA vaccine.
In some embodiments, the time between any two doses of the HIV mRNA vaccine of (a) and/or (b) is at least 1 week. In some embodiments, the time between any two doses of the HIV mRNA vaccine of (a) and/or (b) is at least 4 weeks. In some embodiments, the time between any two doses of the HIV mRNA vaccine of (a) and/or the HIV mRNA vaccine of (b) is 4-10 weeks.
In some embodiments, the ratio of mRNA encoding an HIV Env protein to the mRNA encoding a lentivirus Gag protein in the HIV mRNA vaccine of (a) and/or (b) is 1:1 to 10:1 (e.g., 1:1, 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, or 10:1). In some embodiments, the ratio of mRNA encoding an HIV Env protein to the mRNA encoding a lentivirus Gag protein in the HIV mRNA vaccine of (a) and/or (b) is 3:2 to 9:2 (e.g., 3:2, 2:1, 5:2, 3:1, 7:2, 4:1, or 9:2). In some embodiments, the ratio of mRNA encoding an HIV Env protein to the mRNA encoding a lentivirus Gag protein in the HIV mRNA vaccine of (a) and/or (b) is 3:2 or at least 3:2.
In some embodiments, the ratio of mRNA encoding an HIV Env protein to the mRNA encoding furin is 10:1 to 30:1. In some embodiments, the ratio of mRNA encoding an HIV Env protein to the mRNA encoding furin is 10:1, 15:1, 20:1, 25:1, or 30:1. In some embodiments, the ratio of mRNA encoding an HIV Env protein to the mRNA encoding furin is 20:1 or at least 20:1. In some embodiments, the ratio of mRNA encoding a lentivirus Gag protein to the mRNA encoding the viral protease is 30:1 to 50:1. In some embodiments, the ratio of mRNA encoding a lentivirus Gag protein to the mRNA encoding the viral protease is 30:1, 35:1, 40:1, 45:1, or 50:1. In some embodiments, the ratio of mRNA encoding a lentivirus Gag protein to the mRNA encoding the viral protease is 40:1 or at least 40:1.
In some embodiments, an mRNA encoding a lentivirus Gag protein is replaced by an mRNA encoding the full Gag-Pol open reading frame of HIV-1 or SIV, which comprises the viral protease gene that is transcribed after a ribosomal frame-shift, thus providing an alternative to using an mRNA encoding a viral protease. In some embodiments, the Gag-Pol precursor is partially truncated to reduce its length while maintaining the full protease gene.
In some embodiments, the HIV Env protein of the mRNA HIV vaccine of (a) is selected from an HIV Env protein of Group M Clade A-K (e.g., selected from Clade A, Clade AC, Clade AE, Clade AG, Clade B, Clade C, Clade D, and Clade G), wherein the HIV Env protein of the mRNA HIV vaccine of (b) is selected from an HIV Env protein of Group M Clade A-K (e.g., selected from Clade A, Clade AC, Clade AE, Clade AG, Clade B, Clade C, Clade D, and Clade G), and wherein the Clade(s) of the HIV Env protein of (a) is different from the Clade(s) of the HIV Env protein of (b).
In some embodiments, the HIV Env protein of (a) and/or (b) comprises HIV Env SOSIP.664 mutations. In some embodiments, the HIV Env protein of (a) and/or (b) is a membrane-bound HIV Env protein. In some embodiments, the cytosolic portion of the HIV Env protein of (a) and/or (b) is truncated or partially truncated. In some embodiments, the membrane-bound HIV Env protein is gp150, with a truncation of the gp41 cytoplasmic domain at position 745, or full-length gp160. In some embodiments, the HIV Env protein of (a) and/or (b) comprises a sequence of an Env protein of an HIV strain obtained from an infected subject who has broad and potent neutralizing antibodies to HIV Env protein. In some embodiments, the HIV Env protein of (a) and/or (b) comprises a consensus sequence of variants an Env protein of an HIV strain obtained from an infected subject who has broad and potent neutralizing antibodies to HIV Env protein.
In some embodiments, the HIV Env protein of (a) and/or (b) is an uncommon Env capable of directly engaging unmutated common ancestor (UCA) antibodies from the lineages that originated some broad and potent neutralizing antibodies, such as VRC01, CH103, PG9, CH01, and others. In some embodiments, to facilitate binding to UCA antibodies, the Env protein comprises a mutation selected from 153E, 190G and N276D, relative to strain WITO4160.27 HIV Env protein, or other mutations suitable to remove the glycans at positions 188 and 276, optionally wherein the HIV Env protein of (a) and/or (b) further comprises a disulfide bridge at 113C-432GCG. In some embodiments, the HIV Env protein of (a) and/or (b) further comprises a mutation selected from N460D and N463D relative to strain BG505 HIV Env protein, or other suitable mutations to remove the glycans at positions 460 and 463. In some embodiments, the HIV Env protein of (a) and/or (b) comprises a mutation selected from K295N, D386N, and 375Y, relative to strain DU422.1 HIV Env protein, optionally wherein the HIV Env protein of (a) and/or (b) further comprises a disulfide bridge at 133C-432GCG. In some embodiments, the HIV Env protein of (a) and/or (b) comprises a mutation selected from T322N and S375Y, relative to strain WITO4160.27 HIV Env protein, optionally wherein the HIV Env protein of (a) and/or (b) further comprises a disulfide bridge at 113C-429GCG.
In some embodiments, the HIV Env protein of (a) and/or (b) is a tier-2 Env with all the major glycan holes filled in by insertion of the missing glycans.
In some embodiments, the lentivirus is selected from human immunodeficiency virus (HIV), simian immunodeficiency virus (SIV), and murine leukemia virus (muLV).
In some embodiments, the HIV mRNA vaccine further comprises a Vesicular stomatitis virus (VSV) or VSV-ΔG core protein, or the lentivirus-derived Gag is replaced by a VSV-ΔG or VSV core protein. Viral proteins include proteins that are capable of self-assembling into the VLP (Freed, E. O., J. Virol., 76, 4679-87, (2002)). In some embodiments, the viral core proteins can include, but are not limited to, a viral Gag protein, for example, a retrovirus gag protein [e.g. a HIV Gag viral protein (e.g., HIV-1 NL43 Gag (GenBank serial number AAA44987)), a simian immunodeficiency virus (SW) Gag viral protein (e.g., SIVmac239 Gag (GenBank serial number CAA68379)), or a murine leukemia virus (MuLV) Gag viral protein (e.g., MuLV Gag (GenBank serial number S70394))], a retrovirus matrix protein, a rhabdovirus matrix protein M protein [e.g., a vesicular stomatis virus (VSV) M protein (e.g., VSV Matrix protein (GenBank serial number NP041714))], a filovirus viral core protein (e.g., an Ebola VP40 viral protein (e.g., Ebola virus VP40 (GenBank serial number AAN37506))), a Rift Valley Fever virus N protein (e.g., RVFV N Protein (GenBank serial number NP049344)), a coronavirus M, E and NP protein (e.g., GenBank serial number NP040838 for NP protein, NP040835 for M protein, CAC39303 for E protein of Avian Infections Bronchitis Virus and NP828854 for E protein of the SARS virus)), a bunyavirus N protein (GenBank serial number AAA47114)), an influenza M1 protein, a paramyxovirus M protein, an arenavirus Z protein (e.g., a Lassa Fever Virus Z protein), and combinations thereof.
In some aspects, the present disclosure provides methods of inducing in a human subject an immune response to HIV, the methods comprising administering to the subject a first lipid nanoparticle comprising a mRNA encoding an HIV envelope (Env) protein from a first Clade, preferentially a UCA-engaging Env, and a mRNA encoding a lentivirus group-specific antigen (Gag) protein, and administering to the subject a second lipid nanoparticle comprising a mRNA encoding an HIV Env protein from a second Clade and a mRNA encoding a lentivirus Gag protein, wherein the first lipid nanoparticle and the second lipid nanoparticle are administered more than once and in an amount effective at inducing in the subject a population of neutralizing antibodies that bind to shared epitopes on proteins from the first Clade and neutralizing antibodies that bind to shared epitopes on proteins from the second Clade. In some embodiments, the HIV is HIV Type 1 (HIV-1).
In some embodiments, the population comprises neutralizing antibodies that bind to shared epitopes on proteins from multiple strains of the first Clade and neutralizing antibodies that bind to shared epitopes on proteins from multiple strains of the second Clade.
In some embodiments, the methods further comprise administering to the subject at least one additional lipid nanoparticle comprising a mRNA encoding an HIV Env protein from at least one additional Clade and a mRNA encoding an HIV Gag protein. Thus, in some embodiments, the population comprises neutralizing antibodies that bind to shared epitopes on proteins from multiple strains of the at least one additional Clade.
In some embodiments, the first nanoparticle comprises a ratio of mRNA encoding an HIV Env protein to mRNA encoding an HIV Gag protein of at least 1:1, and/or wherein the second nanoparticle comprises a ratio of mRNA encoding an HIV Env protein to mRNA encoding an HIV Gag protein of at least 1:1. For example, the first nanoparticle may comprise a ratio of the mRNA encoding an HIV Env protein to the mRNA encoding an HIV Gag protein of at least 3:2, and/or the second nanoparticle may comprise a ratio the mRNA encoding an HIV Env protein to the mRNA encoding an HIV Gag protein of at least 3:2.
In some embodiments, the first nanoparticle comprises a ratio of mRNA encoding an HIV Env protein to mRNA encoding furin of at least 5:1. In some embodiments, the ratio of mRNA encoding an HIV Gag protein to mRNA encoding a viral protease is at least 5:1. In some embodiments, the first nanoparticle comprises mRNA encoding the full or partially truncated Gag-Pol gene from HIV-1 or SIV, which comprises the viral protease gene, thus providing an alternative to an mRNA encoding a viral protease.
In some embodiments, the HIV Env protein comprises mutations, relative to wild-type HIV Env protein, that favor a closed conformation. In some embodiments, the HIV Env protein comprises mutations, relative to wild-type HIV Env protein, that comprises glycan knock-in or knock-out modifications. In some embodiments, the HIV Env protein is a stabilized soluble Env protein. For example, HIV Env protein may be an HIV Env SOSIP.664 protein (e.g., SEQ ID NO: 9). In some embodiments, the HIV Env protein is a membrane-bound HIV Env protein. In some embodiments, the cytosolic portion of the HIV Env protein is partially truncated. For example, the membrane-bound HIV Env protein may be gp150 with a truncation at position 745, or gp160.
In some embodiments, the lentivirus is selected from HIV, simian immunodeficiency virus (SIV), and murine leukemia virus (muLV). In some embodiments, the lentivirus-derived Gag is replaced by VSV-ΔG or VSV core protein.
In some embodiments, the first Clade, the second Clade, and the at least one additional Clade are selected from the group consisting of HIV Group M Clades A-K and related circulating recombinant forms (CRFs).
In some embodiments, the first lipid nanoparticle and the second nanoparticle are administered sequentially. In other embodiments, the first lipid nanoparticle and the second nanoparticle are administered simultaneously.
In some embodiments, the first lipid nanoparticle is administered as multiple doses separated by at least 1 week per administration, prior to administration of the second lipid nanoparticle. In some embodiments, the second lipid nanoparticle is administered as multiple doses separated by at least 1 week per administration, after administration of the first lipid nanoparticle. In some embodiments, the second lipid nanoparticle and the at least one additional lipid nanoparticle are administered simultaneously.
In some embodiments, a first Clade is Clade A (e.g., Clade A, Clade AC, Clade AE, or Clade AG). For example, an HIV Env protein may be an HIV Clade A BG505, Q23, Q842, MI369, KER2008, 0330, RW020 or BI369 strain Env protein, an HIV Clade AC 3301 strain Env protein, an HIV Clade AE C2101, CM244 or BJOXO28000 strain Env protein, or an HIV Clade AG DJ263 or T280 strain Env protein.
In some embodiments, a first Clade is Clade B. For example, an HIV Env protein may be an HIV Clade B WITO strain Env protein with or without removal of glycans at positions 188, 276, 460 and 463 to better engage UCA antibodies. In some embodiments, the HIV Env protein is selected from HIV Clade B WITO, X2278, JRCSF, JR-FL, B41, 3988, 45_01dG5, BX08, RHPA, TRJO, YU2 or REJO strain Env Proteins.
In some embodiments, a first Clade is Clade C. For example, an HIV Env protein may be an HIV Clade C 426c strain Env protein with or without removal of glycans at positions 188, 276, 460 and 463 to better engage UCA antibodies. In some embodiments, the HIV Env protein is selected from HIV Clade C DU422, 426C, CH505, ZM176, ZM249, ZA012, DU156, CH848, CH1012, MM24, MM45, 001428, BR025, or MW965 strain Env proteins.
In some embodiments, a first Clade is Clade D. For example, an HIV Env protein may be an HIV Clade D A07412M1 strain Env protein.
In some embodiments, a first Clade is Clade G. For example, an HIV Env protein may be an HIV Clade G X1193 or P1981 strain Env protein.
In some embodiments, a second Clade is Clade A (e.g., Clade A, Clade AC, Clade AE, or Clade AG). For example, an HIV Env protein may be an HIV Clade A BG505, Q23, Q842, MI369, KER2008, 0330, RW020 or BI369 strain Env protein, an HIV Clade AC 3301 strain Env protein, an HIV Clade AE C2101, CM244 or BJOXO28000 strain Env protein, or an HIV Clade AG DJ263 or T280 strain Env protein.
In some embodiments, a second Clade is Clade B. For example, an HIV Env protein may be an HIV Clade B WITO strain Env protein with or without removal of glycans at positions 188, 276, 460 and 463 to better engage UCA antibodies. In some embodiments, the HIV Env protein is selected from HIV Clade B WITO, X2278, JRCSF, JR-FL, B41, 3988, 45_01dG5, BX08, RHPA, TRJO, YU2 or REJO strain Env Proteins.
In some embodiments, a second Clade is Clade C. For example, an HIV Env protein may be an HIV Clade C 426c strain Env protein with or without removal of glycans at positions 188, 276, 460 and 463 to better engage UCA antibodies. In some embodiments, the HIV Env protein is selected from HIV Clade C DU422, 426C, CH505, ZM176, ZM249, ZA012, DU156, CH848, CH1012, MM24, MM45, 001428, BR025, or MW965 strain Env proteins.
In some embodiments, a second Clade is Clade D. For example, an HIV Env protein may be an HIV Clade D A07412M1 strain Env protein.
In some embodiments, a second Clade is Clade G. For example, an HIV Env protein may be an HIV Clade G X1193 or P1981 strain Env protein.
In some embodiments, the HIV Env protein comprises a sequence of an Env protein of an HIV strain obtained from an infected subject who has broad and potent neutralizing antibodies to HIV Env protein. In some embodiments, the HIV Env protein comprises a consensus sequence of variants an Env protein of an HIV strain obtained from an infected subject who has broad and potent neutralizing antibodies to HIV Env protein.
In some embodiments, the methods comprise administering to the subject a first lipid nanoparticle comprising a mRNA encoding a first HIV Env protein and a mRNA encoding an HIV Gag polyprotein, administering to the subject a second lipid nanoparticle comprising a mRNA encoding a second HIV Env protein and a mRNA encoding an HIV Gag polyprotein, and administering to the subject a third lipid nanoparticle comprising a mRNA encoding a third HIV Env protein and a mRNA encoding an HIV Gag polyprotein, wherein the population of neutralizing antibodies comprises neutralizing antibodies that bind to shared epitopes on proteins from multiple different HIV strains. In some embodiments, at least one of the first, second, and third HIV Env proteins comprises a sequence of an Env protein of an HIV strain obtained from an infected subject who has broad and potent neutralizing antibodies to HIV Env protein. In some embodiments, at least one of the first, second, and third HIV Env proteins comprises a consensus sequence of variants an Env protein of an HIV strain obtained from an infected subject who has broad and potent neutralizing antibodies to HIV Env protein.
In some embodiments, the methods comprise administering to the subject a first lipid nanoparticle comprising a mRNA encoding an HIV Clade B Env protein and a mRNA encoding an HIV Gag polyprotein, administering to the subject a second lipid nanoparticle comprising a mRNA encoding an HIV Clade A Env protein and a mRNA encoding an HIV Gag polyprotein, and administering to the subject a third lipid nanoparticle comprising a mRNA encoding an HIV Clade C Env protein and a mRNA encoding an HIV Gag polyprotein, wherein the population of neutralizing antibodies comprises neutralizing antibodies that bind to shared epitopes on HIV Clade B proteins, HIV Clade A proteins, and HIV Clade C proteins. In some embodiments, the population of neutralizing antibodies comprises neutralizing antibodies that bind to shared epitopes on at least 3 Clades comprised in the group-M (Clades A-K) HIV viruses.
In some embodiments, the population comprises neutralizing antibodies that bind to shared epitopes on proteins from multiple Clade B HIV strains, neutralizing antibodies that bind to shared epitopes on proteins from multiple Clade A HIV strains, and neutralizing antibodies that bind to shared epitopes on proteins from multiple Clade C HIV strains. In some embodiments, the population comprises neutralizing antibodies that bind to shared epitopes on proteins from at least five (5) different HIV strains. For example, the population may comprise neutralizing antibodies that bind to shared epitopes on proteins from at least 10 different HIV strains. In some embodiments, the population comprises neutralizing antibodies that bind to shared epitopes on proteins from any two or more (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20) of the following HIV strains: JRFL, WITO.33, BG505, AD8, 398F1, CNE8, CNE55, 25710, CE1176, X1632, TRO11, X2278, BJOXO2000, X2632, 246F3, CH119, CE0217, A3, 02, and A3/02.
In some embodiments, none of the first, second, or at least one additional lipid nanoparticles comprise mRNA encoding a soluble HIV Env protein.
Also provided herein are immunogenic compositions comprising a lipid nanoparticle comprising mRNA encoding a membrane-bound HIV Env protein and a mRNA encoding an HIV Gag protein, wherein the lipid nanoparticle comprises an ionizable cationic lipid, a non-cationic lipid, sterol, and a PEG-modified lipid. In some embodiments, the immunogenic compositions comprise a lipid nanoparticle comprising mRNA encoding an HIV Env SOSIP.664 protein and a mRNA encoding an HIV Gag protein. In some embodiments, the immunogenic compositions comprise a lipid nanoparticle comprising mRNA encoding a membrane-bound HIV Env protein and a mRNA encoding an HIV Gag protein, wherein the ratio of the mRNA encoding a membrane-bound HIV Env protein to the mRNA encoding an HIV Gag protein is at least 3:2.
In some aspects, the present disclosure provides methods of inducing in a human subject an immune response to HIV, the methods comprising administering to the subject a first lipid nanoparticle comprising a mRNA encoding an HIV envelope (Env) protein from a first Clade and a mRNA encoding a lentivirus group-specific antigen (Gag) protein, and administering to the subject a second lipid nanoparticle comprising a mRNA encoding an HIV Env protein from a second Clade and a mRNA encoding a lentivirus Gag protein.
Human Immunodeficiency Virus (HIV)
Some aspects of the disclosure provide methods of inducing in a subject an immune response to human immunodeficiency virus (HIV). HIV (Retroviridae, Orthoretrovirinae) is a lentivirus capable of long-term latent infection of cells and short-term cytopathic effects, which can produce the progressive and fatal acquired immunodeficiency syndrome (AIDS). HIV causes depletion of host T-cells, primarily CD4+ T-cells, thereby leaving the host unable to fight off serious as well as otherwise innocuous infections. An infectious HIV virion includes two identical strands of RNA that are packaged within a core of viral proteins. The virion core is surrounded by a phospholipid bilayer envelope largely derived from the host cell membrane and includes proteins encoded in the viral RNA.
Two major and closely related strains of HIV have been identified, HIV type 1 (HIV-1) and HIV type 2 (HIV-2), of which HIV-1 is the predominate strain and recognized as the more virulent and aggressive form of HIV accounting for approximately 95% of all HIV infections world-wide, with HIV-2 being relatively uncommon and less infectious. In some embodiments, the methods of the disclosure induce an immune response to HIV-1. The present disclosure contemplates HIV vaccines that can equally target and/or be effective in treating or preventing any strain of HIV.
The integrated form of HIV-1, also known as the provirus, is approximately 9.8 kilobases in length. Both ends of the provirus are flanked by a repeated sequence Referred to as the long terminal repeats (LTRs). The genes of HIV are located in the central region of the proviral DNA and encode at least nine proteins, divided into three classes: the major structural proteins, Gag, Pol, and Env; the regulatory proteins, Tat and Rev; and the accessory proteins, Vpu, Vpr, Vif, and Nef. The mRNA vaccines of the present disclosure, in some embodiments, comprise mRNA encoding HIV Env protein and/or lentivirus (e.g., HIV) Gag protein.
HIV Env
The Env protein forms part of the HIV viral envelope. The env gene encodes glycoprotein 160 (gp160), which is cleaved by the host cell protease yielding glycoprotein 120 (gp120) and glycoprotein 41 (gp41) subunits, with the external gp120 subunit non-covalently bonded to the transmembrane gp41 subunit. This resulting Env complex, which includes three gp120/gp41 pairs, mediates a multistep process that results in the fusion of the viral membrane with the host cell membrane. In the first step of the process, gp120 facilitates initial binding with host cells, most commonly through CD4 receptors, which in turn fosters binding of a chemokine co-receptor. The most common chemokine receptors to act as co-receptors are CXCR4 and CCR5, however additional chemokine receptors, as well as various other proteins of the G protein-coupled receptor superfamily, have been shown to serve as co-receptors for HIV entry. Co-receptor binding causes gp41 to undergo a conformational change exposing a hydrophobic region to the host cell membrane. Gp41 then inserts itself into the host cell causing gp41 to again change conformation and fold back on itself forcing fusion of the host cell membrane with the viral membrane, in turn enabling the viral capsid to enter the cell. Env can genetically vary by as much as 35% across Clades causing variation in the precise genetic sequence of the protein, which causes distinct tropisms. These tropisms are often related to the specificity of the gp120 variants to different chemokine receptors, thus influencing virion binding, altering membrane fusion triggers, and ultimately the mechanism of host cell infection. Env protein is also assembled post viral DNA integration into the host genome. Once transcribed, the viral RNA is transported to the cytoplasm, where Env protein is generated. Post translation, the protein is integrated into the host cell membrane, a process facilitated by Gag polyprotein.
The HIV Env proteins of the present disclosure may be one of several different HIV Clades. HIV-1, for example, is divided into four known groups (M, N, O, and P), which are believed to represent an independent transmission of simian immunodeficiency virus (SIV) into humans. Of the four groups, M is considered the major group (accounting for more than 90% of HIV and AIDS cases by some estimates), with N, O, and P representing the minor groups. Within the M group of HIV-1, eleven sub-types, referred to as Clades A-K, have been established, which unlike the groups do not indicate distinct transmissions of SIV, but rather often refer to the geographic area the Clade is predominate. Similar to the four groups, Clades have been assigned letter designations A-K, but more may be established. Further variations of the known Clades can result from genetic combinations of the Clades, resulting in hybrids known as circulating recombinant forms (CRF) (e.g., A/B, C/K, or any combination of A-K).
The HIV Env proteins encoded by the mRNA administered herein may be, and in preferred embodiments are, from different Clades, for example, one from a “first Clade” (e.g., A-K) and one from a second Clade (e.g., any one of A-K that is not the first Clade) (and optionally at least one additional Clade, e.g., any one of A-K that is not the first or second Clade. In some embodiments, the first Clade, the second Clade, and the at least one additional Clade are selected from the group consisting of HIV Group M Clades A-K and related circulating recombinant forms (CRFs). The first, the second Clade, and the at least one additional Clade may be selected, in some embodiments, from Clade A of Group M, Clade AC of Group M, Clade AE of Group M, Clade AG of Group M, Clade B of Group M, Clade C of Group M, Clade D of Group M, Clade E of Group M, Clade F of Group M, Clade G of Group M, Clade H of Group M, Clade I of Group M, Clade J of Group M, or Clade K of Group M. In some embodiments, the first Clade is Clade A of Group M. In some embodiments, the first Clade is Clade AC of Group M. In some embodiments, the first Clade is Clade AE of Group M. In some embodiments, the first Clade is Clade AG of Group M. In some embodiments, the first Clade is Clade B of Group M. In some embodiments, the first Clade is Clade C of Group M. In some embodiments, the first Clade is Clade B of Group M, and the second Clade is Clade A of Group M. In some embodiments, the first Clade is Clade B of Group M, and the second Clade is Clade C of Group M.
In some embodiments, the first Clade is Clade B. For example, the HIV Env protein may be an HIV Clade B WITO, X2278, JRCSF, JR-FL, B41, 3988, 45_01dG5, BX08, RHPA, TRJO, YU2, or REJO strain Env protein. In some embodiments, the second Clade is Clade A, for example, an HIV Clade A BG505, Q23, Q842, MI369, KER2008, 0330, RW020, or BI369 strain Env protein. In some embodiments, the second Clade is Clade C, for example, an HIV Clade C DU422, 426C, CH505, ZM176, ZM249, ZA012, DU156, CH848, CH1012, MM24, MM45, 001428, BR025, or MW965 strain Env protein.
The Env proteins encoded by the HIV mRNA vaccines of the present disclosure induce protective titers of broadly neutralizing antibodies against multiple strains of HIV (e.g., multiple strains of HIV-1). These neutralizing antibodies bind to the Env complex on the virion surface to neutralize HIV infectivity. Unlike more common strategies for broad neutralizing antibody induction that involve the design of soluble, recombinant protein mimics of the native Env complex, the HIV mRNA vaccines provided herein, in some embodiments, encode membrane-bound Env protein, such as gp160, or a truncated form, gp150 (cytosolic portion truncated at residue 775, relative to the reference HIV Env protein). Herein, the “reference HIV Env protein” is a soluble, stabilized trimeric HIV Env SOSOP.644 complex; Sanders R W et al. PLoS Pathog 9:e1003618, incorporated herein by reference). This soluble reference HIV Env protein includes an engineered disulfide bond that covalently links subunits gp120 and gp41ECTO (produced by introducing a stop codon to truncate the gp41 ectodomain) and also includes an Ile-to-Pro change at residue 559 (I559P) that helps maintain the gp41ECTO moieties in the prefusion form (Binley J M et al. J Virol 2000; 74: 627-643; and Sanders R W et al. J Virol 2002; 76: 8875-8889, each of which is incorporated herein by reference) as well as a Ala-to-Cys change at residue 501 (A501C) and a Thr-to-Cys at residue 605 (T605C). In addition, the truncation of gp41ECTO at residue 664 eliminates a hydrophobic region that tends to cause trimer aggregation (Khayat R et al. J Virol 2013; 87:9873-9885; Wu X et al. J Virol 2006; 80: 835-844, each of which is incorporated herein by reference).
Stabilized Trimeric HIV Env SOSOP.644 Complex
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGAR
AENLWVTVYYGVPVW
Several variant forms of HIV Env protein may be encoded by the mRNA of the vaccines provided herein.
The HIV Env proteins, for example, may include one or more CD4 primate binding modifications. These modifications include any of the mutations selected from 153E and 375Y, relative to a reference HIV Env protein comprising the sequence of SEQ ID NO:1. In some embodiments, a mRNA encodes an HIV Env protein comprising a 153E mutation, relative to a reference HIV Env protein comprising the sequence of SEQ ID NO:1. In some embodiments, a mRNA encodes an HIV Env protein comprising a 375Y mutation, relative to a reference HIV Env protein comprising the sequence of SEQ ID NO:1. Thus, in some embodiments, the membrane-bound form of HIV Env protein comprises mutations, relative to the reference HIV Env protein, that favor a closed conformation, and thus, cannot bind CD4.1
HIV Env proteins having glycan post-translational modifications are also contemplated herein. These modifications may be made at a residue selected from, for example, residue 276 (276N), 295 (295N), 322 (322N), and 386 (386), relative to a reference HIV Env protein comprising the sequence of SEQ ID NO:1. In some embodiments, a mRNA encodes an HIV Env protein comprising a glycan modification at residue 276 (276N), relative to a reference HIV Env protein comprising the sequence of SEQ ID NO:1. In some embodiments, a mRNA encodes an HIV Env protein comprising a glycan modification at residue 295 (295N), relative to a reference HIV Env protein comprising the sequence of SEQ ID NO:1. In some embodiments, a mRNA encodes an HIV Env protein comprising a glycan modification at residue 322 (322N), relative to a reference HIV Env protein comprising the sequence of SEQ ID NO:1. In some embodiments, a mRNA encodes an HIV Env protein comprising a glycan modification at residue 386 (386N), relative to a reference HIV Env protein comprising the sequence of SEQ ID NO:1.
In some embodiments, the HIV Env protein comprises mutations, relative to wild-type HIV Env protein, that comprises glycan knock-in or knock-out modifications. In some embodiments, the HIV Env protein comprises glycan knock-in mutations at residues selected from N332, N241, and N289, relative to an HIV BG550 strain Env protein. In some embodiments, the HIV Env protein comprises glycan knock-in mutations at residues selected from N295 and N386, relative to an HIV DU422, DU172.17, ZM176.66, CNE58, or 426c strain Env protein. In some embodiments, the HIV Env protein comprises glycan knock-in mutations at residue N188, relative to an HIV WITO strain Env protein. In some embodiments, the HIV Env protein comprises glycan knock-out mutations at residue N276, relative to an HIV BG550 strain Env protein.
In some embodiments, the HIV isolate/strain is WITO4160.27. In some embodiments, an HIV mRNA encode membrane-bound Env gp150 (truncated at residue 775) that includes a 153E mutation and a 276D, relative to a reference HIV Env protein, wherein the reference HIV Env protein comprises the sequence of SEQ ID NO: 2. In some embodiments, an HIV mRNA encode membrane-bound Env gp150 (truncated at residue 775) that includes a 153E mutation, a 276D mutation, and a 113C-432GCG disulfide bridge, relative to a reference HIV Env protein, wherein the reference HIV Env protein comprises the sequence of SEQ ID NO: 2.
In some embodiments, the HIV isolate/strain is DU422, DU172.17, ZM176.66, CNE58, or 426c. In some embodiments, an HIV mRNA encode membrane-bound Env gp150 (truncated at residue 775) that includes a 295N mutation, a 386N mutation, and a 375Y mutation, relative to a reference HIV Env protein, wherein the reference HIV Env protein comprises the sequence of SEQ ID NO: 3. In some embodiments, an HIV mRNA encode membrane-bound Env gp150 (truncated at residue 775) that includes a 295N mutation, a 386N mutation, a 375Y mutation, and a 133C-432GCG disulfide bridge, relative to a reference HIV Env protein, wherein the reference HIV Env protein comprises the sequence of SEQ ID NO: 3.
In some embodiments, the HIV isolate/strain is BG505. In some embodiments, an HIV mRNA encode membrane-bound Env gp160 that includes a 322N mutation and a 375Y mutation, relative to a reference HIV Env protein, wherein the reference HIV Env protein comprises the sequence of SEQ ID NO: 4. In some embodiments, the HIV isolate/strain is BG505. In some embodiments, an HIV mRNA encode membrane-bound Env gp160 that includes a 322N mutation, a 375Y mutation, and a 113C-429GCG disulfide bridge, relative to a reference HIV Env protein, wherein the reference HIV Env protein comprises the sequence of SEQ ID NO: 4.
The HIV Env protein, in some embodiments, comprises a sequence of an Env protein of an HIV strain obtained from an infected subject who has broad and potent neutralizing antibodies to HIV Env protein. A subject is considered to have been infected with HIV if, for example, the subject test positive following an HIV viral load test (also referred to as an HIV nucleic acid amplification test (NAAT or NAT); HIV by PCR; or HIV RNA test). Methods for diagnosing an HIV positive subject are known, any of which may be used herein.
In some embodiments, the HIV Env protein comprises a consensus sequence of variants an Env protein of an HIV strain obtained from an infected subject who has broad and potent neutralizing antibodies to HIV Env protein. The consensus sequence may be determined, for example, by aligning the amino acid sequences (or nucleic acid sequences) of various HIV Env proteins obtained from an infected subject who has broad and potent neutralizing antibodies to HIV Env protein, then determining the most commonly expressed amino acid (or nucleic acid) at each position.
HIV Gag
The lentivirus group-specific antigen (gag) gene encodes a 55-kilodalton (kD) Gag precursor protein, also called p55, which is expressed from the unspliced viral mRNA. During translation, the N terminus of p55 is myristoylated, triggering its association with the cytoplasmic aspect of cell membranes. The membrane-associated Gag polyprotein recruits two copies of the viral genomic RNA along with other viral and cellular proteins that triggers the budding of the viral particle from the surface of an infected cell. After budding, p55 is cleaved by the virally encoded protease (a product of the pol gene) during the process of viral maturation into four smaller proteins designated MA (matrix [p17]), CA (capsid [p24]), NC (nucleocapsid [p9]), and p6 (Göttlinger H G et al. Proc Natl Acad Sci USA 1989; 86(15): 5781-5).
The lentiviral Gag protein encoded herein may be an HIV Gag protein, a simian immunodeficiency virus (SIV) Gag protein, or a murine leukemia virus (muLV) Gag protein. In some embodiments, the Gag protein is an HIV Gag protein. In some embodiments, the Gag protein is a SIV Gag protein. In some embodiments, the Gag protein is an muLV Gag protein. In some embodiments, the SIV Gag protein is a SIVmac239 Gag protein.
HIV Protease
HIV-1 protease is a retroviral aspartyl protease essential for the life-cycle of HIV-1 because it cleaves newly synthesized polyproteins at nine cleavage sites to create the mature protein components of an HIV virion. Without effective HIV protease, HIV virions remain uninfectious.
Furin
Furin is a host cell enzyme that belongs to the subtilisin-like proprotein convertase family and is responsible for the proteolytic cleavage of the HIV envelope polyprotein precursor gp160 to gp120 and gp41.
HIV Immunogenic Compositions/Vaccine Formulations
Provided herein, in some embodiments, are immunogenic compositions comprising a lipid nanoparticle comprising mRNA encoding a membrane-bound HIV Env protein and a mRNA encoding an HIV Gag protein, wherein the lipid nanoparticle comprises an ionizable cationic lipid, a non-cationic lipid, sterol, and a PEG-modified lipid. In some embodiments, the immunogenic compositions comprise a lipid nanoparticle comprising mRNA encoding an HIV Env SOSIP.664 protein (e.g., any of the HIV Env variants described herein) and a mRNA encoding a lentivirus Gag protein.
It should be understood that the HIV mRNA vaccine therapies provided herein include the administration of multiple doses of an HIV mRNA vaccine formulation, each dose separated by at least 1 week, and each dose comprising a combination of mRNA encoding HIV Env protein and mRNA encoding lentivirus Gag protein formulated, for example, in a cationic lipid nanoparticle. It should also be understood that each dose may be different (heterologous) in that the particular HIV strain/isolate from which the mRNA sequence encoding Env protein is obtained/derived may differ and/or the particular dose amount may differ and/or the ratio of mRNA encoding Env v. Gag may differ. Thus, the present disclosure contemplates multiple heterologous boosts of co-formulated mRNA encoding HIV Env and mRNA encoding lentivirus Gag.
In some embodiments, the immunogenic compositions comprise a lipid nanoparticle comprising mRNA encoding a membrane-bound HIV Env protein and a mRNA encoding a lentivirus Gag protein, wherein the ratio of the mRNA encoding a membrane-bound HIV Env protein to the mRNA encoding a lentivirus Gag protein is at least 1:1. For example, the ratio of the mRNA encoding a membrane-bound HIV Env protein to the mRNA encoding a lentivirus Gag protein may be 1:1, 2:1, 3:1, 4:1, or 5:1. In some embodiments, the ratio of the mRNA encoding a membrane-bound HIV Env protein to the mRNA encoding a lentivirus Gag protein is at least 3:2. For example, the ratio of the mRNA encoding a membrane-bound HIV Env protein to the mRNA encoding a lentivirus Gag protein may be 3:2, 4:2, 5:5, 6:2, or 7:2.
Other proportions of mRNA encoding HIV Env protein and mRNA encoding lentivirus Gag protein are contemplated herein. In some embodiments, the immunogenic compositions comprise a lipid nanoparticle comprising mRNA encoding a membrane-bound HIV Env protein and a mRNA encoding a lentivirus Gag protein, wherein the ratio of the mRNA encoding a lentivirus Gag protein to the mRNA encoding a membrane-bound HIV Env protein is at least 1:1. For example, the ratio of the mRNA encoding a lentivirus Gag protein to the mRNA encoding a membrane-bound HIV Env protein may be 1:1, 2:1, 3:1, 4:1, or 5:1. In some embodiments, the ratio of the ratio of the mRNA encoding a lentivirus Gag protein to the mRNA encoding a membrane-bound HIV Env protein is at least 3:2. For example, the ratio of the mRNA encoding a lentivirus Gag protein to the mRNA encoding a membrane-bound HIV Env protein may be 3:2, 4:2, 5:5, 6:2, or 7:2.
In some embodiments, a single dose of an HIV mRNA vaccine of the present disclosure comprises 100 μg to 1000 μg of mRNA. For example, a single dose (e.g., comprising mRNA encoding HIV Env and mRNA encoding Gag formulated in a lipid nanoparticle at a ratio of Env:Gag of 3:2) may be 100 μg to 900 μg, 100 μg to 800 μg, 100 μg to 700 μg, 100 μg to 600 μg, 100 μg to 500 μg, 200 μg to 900 μg, 200 μg to 800 μg, 200 μg to 700 μg, 200 μg to 600 μg, 200 μg to 500 μg, 300 μg to 900 μg, 300 μg to 800 μg, 300 μg to 700 μg, 300 μg to 600 μg, or 300 μg to 600 μg. In some embodiments, a single dose (e.g., comprising mRNA encoding HIV Env and mRNA encoding Gag formulated in a lipid nanoparticle at a ratio of mRNA Env:mRNA Gag of 3:2) is 200 μg, 205 μg, 210 μg, 215 μg, 220 μg, 225 μg, 230 μg, 235 μg, 240 μg, 245 μg, 250 μg, 255 μg, 260 μg, 265 μg, 270 μg, 275 μg, 280 μg, 285 μg, 290 μg, 300 μg, 300 μg, 305 μg, 310 μg, 315 μg, 320 μg, 325 μg, 330 μg, 335 μg, 340 μg, 345 μg, 350 μg, 355 μg, 360 μg, 365 μg, 370 μg, 375 μg, 380 μg, 385 μg, 390 μg, or 400 μg.
The HIV mRNA vaccines of the present disclosure are administered as multiple doses according to particular dosing schedule described herein. In some embodiments, a single initial dose is administered, followed by multiple booster doses. The amount of mRNA in an initial dose, in some embodiments, is less than the amount of mRNA in a subsequent booster dose.
A single dose (e.g., an initial dose) of an HIV mRNA vaccine, as provided herein, in some embodiments comprises 300 μg to 500 μg, or 350 to 450 μg, of mRNA encoding an HIV Env protein of one Clade (e.g., HIV Clade B Env protein, e.g., strain WITO, X2278, JRCSF, JR-FL, B41, 3988, 45_01 dG5, BX08, RHPA, TRJO, YU2, or REJO) and mRNA encoding lentivirus Gag protein (e.g., formulated in a lipid nanoparticle at a ratio of mRNA Env:mRNA Gag of 3:2). In some embodiments, a single dose of an HIV mRNA vaccine comprises 400 μg of mRNA encoding an HIV Env protein of one Clade (e.g., HIV Clade B Env protein, e.g., strain WITO, X2278, JRCSF, JR-FL, B41, 3988, 45_01 dG5, BX08, RHPA, TRJO, YU2, or REJO) and mRNA encoding lentivirus Gag protein (e.g., formulated in a lipid nanoparticle at a ratio of mRNA Env:mRNA Gag of 3:2). It should be understood that the initial dose may include an HIV Clade A Env protein, HIV Clade AC Env protein, HIV Clade AE Env protein, HIV Clade AG Env protein, an HIV Clade B Env protein, an HIV Clade C Env protein, HIV Clade D Env protein, HIV Clade G Env protein, or any other HIV Group M Env protein.
In some embodiments, a single dose (e.g., a booster dose) of an HIV mRNA vaccine comprises 150 μg to 350 μg, or 200 μg to 300 μg, of mRNA encoding an HIV Env protein of a first Clade (e.g., HIV Clade B Env protein, e.g., strain WITO) and mRNA encoding lentivirus Gag protein (e.g., formulated in a lipid nanoparticle at a ratio of mRNA Env:mRNA Gag of 3:2). In some embodiments, a single dose of an HIV mRNA vaccine comprises 240 μg, of mRNA encoding an HIV Env protein of a first Clade (e.g., HIV Clade B Env protein, e.g., strain WITO) and mRNA encoding lentivirus Gag protein (e.g., formulated in a lipid nanoparticle at a ratio of mRNA Env:mRNA Gag of 3:2). It should be understood that any booster dose may include an HIV Clade A Env protein, an HIV Clade AC Env protein, an HIV Clade AE Env protein, an HIV Clade AG Env protein, an HIV Clade B Env protein, an HIV Clade C Env protein, an HIV Clade D Env protein, an HIV Clade G Env protein, or any other HIV Group M Env protein. In some embodiments, a booster dose includes an Env protein of an HIV Clade that is the same as the initial dose. In some embodiments, a booster dose includes an Env protein of an HIV Clade that is different from the initial dose.
In some embodiments, a single dose (e.g., a booster dose) of an HIV mRNA vaccine comprises 150 μg to 350 μg, or 200 μg to 300 μg, of mRNA encoding an HIV Env protein of another Clade (e.g., HIV Clade A Env protein, e.g., strain BG505, Q23, Q842, MI369, KER2008, 0330, RW020, or B1369) and mRNA encoding lentivirus Gag protein (e.g., formulated in a lipid nanoparticle at a ratio of mRNA Env:mRNA Gag of 3:2). In some embodiments, a single dose of an HIV mRNA vaccine comprises 240 μg, of mRNA encoding an HIV Env protein of another Clade (e.g., HIV Clade A Env protein, e.g., strain BG505, Q23, Q842, MI369, KER2008, 0330, RW020, or B1369) and mRNA encoding lentivirus Gag protein (e.g., formulated in a lipid nanoparticle at a ratio of mRNA Env:mRNA Gag of 3:2).
In some embodiments, a single dose (e.g., a booster dose) of an HIV mRNA vaccine comprises 150 μg to 350 μg, or 200 μg to 300 μg, of mRNA encoding an HIV Env protein of yet another Clade (e.g., HIV Clade C Env protein, e.g., strain DU422, 426C, CH505, ZM176, ZM249, ZA012, DU156, CH848, CH1012, MM24, MM45, 001428, BR025, or MW965) and mRNA encoding lentivirus Gag protein (e.g., formulated in a lipid nanoparticle at a ratio of mRNA Env:mRNA Gag of 3:2). In some embodiments, a single dose of an HIV mRNA vaccine comprises 240 μg, of mRNA encoding an HIV Env protein of yet another Clade (e.g., HIV Clade C Env protein, e.g., strain DU422, 426C, CH505, ZM176, ZM249, ZA012, DU156, CH848, CH1012, MM24, MM45, 001428, BR025, or MW965) and mRNA encoding lentivirus Gag protein (e.g., formulated in a lipid nanoparticle at a ratio of mRNA Env:mRNA Gag of 3:2).
In some embodiments, two booster doses are administered simultaneously, e.g., intramuscularly, one in each arm. For example, following an initial 350 μg to 450 μg dose of a vaccine comprising mRNA encoding HIV Clade B Env protein and mRNA encoding lentivirus Gag protein, two booster doses of vaccine may be administered at the same time (e.g., on the same day, e.g., within hours or minutes of each other). One of the two booster doses may include, for example, mRNA encoding HIV Clade A Env protein and mRNA encoding lentivirus Gag protein, and the other of the two booster doses may include, for example, mRNA encoding HIV Clade C Env protein and mRNA encoding lentivirus Gag protein.
As discussed in the Examples, the present disclosure contemplates, in some embodiments, administration of a final low-dose booster. Thus, in some embodiments, a single booster dose of an HIV mRNA vaccine comprises 20 μg to 50 μg of mRNA encoding HIV Env protein and mRNA encoding lentivirus Gag protein. In some embodiments, a single booster dose of an HIV mRNA vaccine comprises 20 μg, 25 μg, 30 μg, 35 μg, 40 μg, 45 μg, or 50 μg of mRNA encoding HIV Env protein and mRNA encoding lentivirus Gag protein.
In some embodiments, the HIV vaccine therapies provided herein also include one or more boost dose of an HIV protein formulation. For example, an HIV protein boost dose may include 25 μg to 500 μg, or 50 μg to 200 μg (e.g., 50 μg, 100 μg, or 200 μg), of soluble HIV Env protein (e.g., SOSIP Env) and/or lentivirus Gag protein, without or without adjuvant (e.g., Adjuplex, or other adjuvant). In some embodiments, a protein boost dose is administered at least one month following an initial mRNA dose. For example, a protein boost dose may be administered at Week 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60 of a vaccine dosing schedule.
Lipid Nanoparticle (LNPs)
HIV RNA (e.g., mRNA) vaccines of the disclosure are formulated in a lipid nanoparticle (LNP). Lipid nanoparticles typically comprise ionizable cationic lipid, non-cationic lipid, sterol and PEG lipid components along with the nucleic acid cargo of interest. The lipid nanoparticles of the disclosure can be generated using components, compositions, and methods as are generally known in the art, see for example PCT/US2016/052352; PCT/US2016/068300; PCT/US2017/037551; PCT/US2015/027400; PCT/US2016/047406; PCT/US2016000129; PCT/US2016/014280; PCT/US2016/014280; PCT/US2017/038426; PCT/US2014/027077; PCT/US2014/055394; PCT/US2016/52117; PCT/US2012/069610; PCT/US2017/027492; PCT/US2016/059575 and PCT/US2016/069491 all of which are incorporated by reference herein in their entirety.
Vaccines of the present disclosure are typically formulated in lipid nanoparticle. In some embodiments, the lipid nanoparticle comprises at least one ionizable cationic lipid, at least one non-cationic lipid, at least one sterol, and/or at least one polyethylene glycol (PEG)-modified lipid.
In some embodiments, the lipid nanoparticle comprises a molar ratio of 20-60% ionizable cationic lipid. For example, the lipid nanoparticle may comprise a molar ratio of 20-50%, 20-40%, 20-30%, 30-60%, 30-50%, 30-40%, 40-60%, 40-50%, or 50-60% ionizable cationic lipid. In some embodiments, the lipid nanoparticle comprises a molar ratio of 20%, 30%, 40%, 50, or 60% ionizable cationic lipid.
In some embodiments, the lipid nanoparticle comprises a molar ratio of 5-25% non-cationic lipid. For example, the lipid nanoparticle may comprise a molar ratio of 5-20%, 5-15%, 5-10%, 10-25%, 10-20%, 10-25%, 15-25%, 15-20%, or 20-25% non-cationic lipid. In some embodiments, the lipid nanoparticle comprises a molar ratio of 5%, 10%, 15%, 20%, or 25% non-cationic lipid.
In some embodiments, the lipid nanoparticle comprises a molar ratio of 25-55% sterol. For example, the lipid nanoparticle may comprise a molar ratio of 25-50%, 25-45%, 25-40%, 25-35%, 25-30%, 30-55%, 30-50%, 30-45%, 30-40%, 30-35%, 35-55%, 35-50%, 35-45%, 35-40%, 40-55%, 40-50%, 40-45%, 45-55%, 45-50%, or 50-55% sterol. In some embodiments, the lipid nanoparticle comprises a molar ratio of 25%, 30%, 35%, 40%, 45%, 50%, or 55% sterol.
In some embodiments, the lipid nanoparticle comprises a molar ratio of 0.5-15% PEG-modified lipid. For example, the lipid nanoparticle may comprise a molar ratio of 0.5-10%, 0.5-5%, 1-15%, 1-10%, 1-5%, 2-15%, 2-10%, 2-5%, 5-15%, 5-10%, or 10-15%. In some embodiments, the lipid nanoparticle comprises a molar ratio of 0.5%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, or 15% PEG-modified lipid.
In some embodiments, the lipid nanoparticle comprises a molar ratio of 20-60% ionizable cationic lipid, 5-25% non-cationic lipid, 25-55% sterol, and 0.5-15% PEG-modified lipid.
In some embodiments, an ionizable cationic lipid of the disclosure comprises a compound having structure:
In some embodiments, an ionizable cationic lipid of the disclosure comprises a compound having structure:
In some embodiments, a non-cationic lipid of the disclosure comprises 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC), 1,2-dimyristoyl-sn-gly cero-phosphocholine (DMPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC), 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC), 1,2-di-O-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC), 1-oleoyl-2 cholesterylhemisuccinoyl-sn-glycero-3-phosphocholine (OChemsPC), 1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC), 1,2-dilinolenoyl-sn-glycero-3-phosphocholine, 1,2-diarachidonoyl-sn-glycero-3-phosphocholine, 1,2-didocosahexaenoyl-sn-glycero-3-phosphocholine, 1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (ME 16.0 PE), 1,2-distearoyl-sn-glycero-3-phosphoethanolamine, 1,2-dilinoleoyl-sn-glycero-3-phosphoethanolamine, 1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine, 1,2-diarachidonoyl-sn-glycero-3-phosphoethanolamine, 1,2-didocosahexaenoyl-sn-glycero-3-phosphoethanolamine, 1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium salt (DOPG), sphingomyelin, and mixtures thereof.
In some embodiments, a PEG modified lipid of the disclosure comprises a PEG-modified phosphatidylethanolamine, a PEG-modified phosphatidic acid, a PEG-modified ceramide, a PEG-modified dialkylamine, a PEG-modified diacylglycerol, a PEG-modified dialkylglycerol, and mixtures thereof. In some embodiments, the PEG-modified lipid is PEG-DMG, PEG-c-DOMG (also referred to as PEG-DOMG), PEG-DSG and/or PEG-DPG.
In some embodiments, a sterol of the disclosure comprises cholesterol, fecosterol, sitosterol, ergosterol, campesterol, stigmasterol, brassicasterol, tomatidine, ursolic acid, alpha-tocopherol, and mixtures thereof.
In some embodiments, a LNP of the disclosure comprises an ionizable cationic lipid of Compound 1, wherein the non-cationic lipid is DSPC, the structural lipid that is cholesterol, and the PEG lipid is PEG-DMG.
In some embodiments, a LNP of the disclosure comprises an N:P ratio of from about 2:1 to about 30:1.
In some embodiments, a LNP of the disclosure comprises an N:P ratio of about 6:1.
In some embodiments, a LNP of the disclosure comprises an N:P ratio of about 3:1.
In some embodiments, a LNP of the disclosure comprises a wt/wt ratio of the ionizable cationic lipid component to the RNA of from about 10:1 to about 100:1.
In some embodiments, a LNP of the disclosure comprises a wt/wt ratio of the ionizable cationic lipid component to the RNA of about 20:1.
In some embodiments, a LNP of the disclosure comprises a wt/wt ratio of the ionizable cationic lipid component to the RNA of about 10:1.
In some embodiments, a LNP of the disclosure has a mean diameter from about 50 nm to about 150 nm.
In some embodiments, a LNP of the disclosure has a mean diameter from about 70 nm to about 120 nm.
Dosing Schedules/Immunization Protocols
The HIV mRNA vaccination methods of the present disclosure, in some embodiments, include administration of an initial dose of the vaccine followed by multiple (e.g., heterologous) booster doses, typically separated by at least one week. Herein, an initial dose formulated with an HIV Env of a particular Clade (e.g., Clade B) may be referred to as an “autologous dose,” whereas a subsequent booster dose formulated with an HIV Env of a different Clade (e.g., Clade A or C) may be referred to as a “heterologous dose.”
In some embodiments, an autologous dose of an HIV mRNA vaccine formulation is administered one or more time(s) within a particular time interval (the first time interval), and then multiple heterologous doses of an HIV mRNA vaccine formulation is administered one or more time(s) within a subsequent time interval (the second time interval). For example, an autologous dose of an HIV mRNA vaccine comprising mRNA encoding HIV Clade B Env (e.g., WITO) and mRNA encoding lentivirus Gag may be administered every 8-12 (e.g., 8, 9, 10, 11, or 12) weeks for 5-7 (e.g., 5, 6, or 7) months, and a heterologous dose of an HIV mRNA vaccine comprising mRNA encoding HIV Clade A Env (e.g., BG505, Q23, Q842, MI369, KER2008, 0330, RW020, or B1369) and mRNA encoding lentivirus Gag, and/or a heterologous dose of an HIV mRNA vaccine comprising mRNA encoding HIV Clade C Env (e.g., DU422, 426C, CH505, ZM176, ZM249, ZA012, DU156, CH848, CH1012, MM24, MM45, 001428, BR025, or MW965) and mRNA encoding lentivirus Gag, may be administered every 8-12 weeks for an additional 5-7 months. Thus, the present disclosure encompasses sequential immunizations initially with mRNA from a first Clade (e.g., Clade B) transmitter/founder envelope (e.g., WITO, X2278, JRCSF, JR-FL, B41, 3988, 45_01dG5, BX08, RHPA, TRJO, YU2, or REJO) followed by mixed heterologous envelopes from 2 different Clades (e.g., Clade A and Clade C), each co-formulated with mRNA encoding lentivirus Gag.
In some embodiments, the interval of time separating an initial dose from a booster dose, and/or separating one booster dose from another booster dose, is 2 to 10 weeks, or 2 to 15 weeks. For example, the interval of time separating an initial dose from a booster dose, and/or separating one booster dose from another booster dose, may be 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 weeks.
In some embodiments, a first lipid nanoparticle vaccine formulation is administered as multiple doses separated by at least 1 week per administration, prior to administration of a second lipid nanoparticle vaccine formulation. In some embodiments, a second lipid nanoparticle vaccine formulation is administered as multiple doses separated by at least 1 week per administration, after administration of a first lipid nanoparticle vaccine formulation. In some embodiments, a second lipid nanoparticle vaccine formulation and the at least one additional lipid nanoparticle vaccine formulation are administered simultaneously.
In some embodiments, an initial dose is administered (Week 0), and one or more booster dose is administered 10 to 60 weeks later. For example, as shown in the Examples, an initial dose may be administered at Week 0, and then subsequent heterologous booster doses administered at Weeks 11, 19, 27, 35, 43, 47, 51, and/or 56. In some embodiments, an initial dose may be administered at Week 0, and then subsequent heterologous booster doses administered at any one of Weeks 10-12 (e.g., 10, 11, or 12), 18-20 (e.g., 18, 19, or 20), 26-28 (e.g., 26, 27, or 28), 34-36 (e.g., 34, 35, or 36), 42-44 (e.g., 42, 43, or 44), 46-48 (e.g., 46, 47, or 48), 50-52 (e.g., 50, 51, or 52), and/or 55-57 (e.g., 55, 56, or 57). In some embodiments, an initial dose may be administered at Week 0, and then subsequent heterologous booster doses administered at any one of Weeks 5-10, 15-20, 25-30, 35-40, 45-50, and/or 55-60.
In some embodiments, a heterologous booster dose of an HIV mRNA vaccine is administered every 5 weeks, every 6 weeks, every 7 weeks, every 8 weeks, every 9 weeks, or every 10 weeks, for example, for at least 20, at least 22, at least 24, at least 26, at least 28, at least 30, at least 32, at least 34, at least 36, at least 38, at least 40, at least 42, at least 44, at least 46, at least 48, or at least 50 weeks. For example, a heterologous booster dose of an HIV mRNA vaccine may be administered every 5 weeks for at least 20, at least 22, at least 24, at least 26, at least 28, at least 30, at least 32, at least 34, at least 36, at least 38, at least 40, at least 42, at least 44, at least 46, at least 48, or at least 50 weeks. In some embodiments, a heterologous booster dose of an HIV mRNA vaccine may be administered every 6 weeks for at least 20, at least 22, at least 24, at least 26, at least 28, at least 30, at least 32, at least 34, at least 36, at least 38, at least 40, at least 42, at least 44, at least 46, at least 48, or at least 50 weeks. In some embodiments, a heterologous booster dose of an HIV mRNA vaccine may be administered every 7 weeks for at least 20, at least 22, at least 24, at least 26, at least 28, at least 30, at least 32, at least 34, at least 36, at least 38, at least 40, at least 42, at least 44, at least 46, at least 48, or at least 50 weeks. In some embodiments, a heterologous booster dose of an HIV mRNA vaccine may be administered every 8 weeks for at least 20, at least 22, at least 24, at least 26, at least 28, at least 30, at least 32, at least 34, at least 36, at least 38, at least 40, at least 42, at least 44, at least 46, at least 48, or at least 50 weeks. In some embodiments, a heterologous booster dose of an HIV mRNA vaccine may be administered every 9 weeks for at least 20, at least 22, at least 24, at least 26, at least 28, at least 30, at least 32, at least 34, at least 36, at least 38, at least 40, at least 42, at least 44, at least 46, at least 48, or at least 50 weeks. In some embodiments, a heterologous booster dose of an HIV mRNA vaccine may be administered every 10 weeks for at least 20, at least 22, at least 24, at least 26, at least 28, at least 30, at least 32, at least 34, at least 36, at least 38, at least 40, at least 42, at least 44, at least 46, at least 48, or at least 50 weeks.
Alternating intervals of time may also be used, for example, a booster at 10 weeks, a booster at 5 weeks, a booster at 10 weeks, a booster at 5 weeks, and so on.
In some embodiments, a 300-500 μg dose of an HIV mRNA vaccine is administered at Week 0, a 200-300 μg heterologous booster dose of an HIV mRNA vaccine is administered at any one of Weeks 10-12, a 200-300 μg heterologous booster dose of an HIV mRNA vaccine is administered at Weeks 18-20, a 200-250 μg heterologous booster dose of HIV mRNA vaccine is administered at Weeks 28-28, a 200-250 μg heterologous booster dose of an HIV mRNA vaccine is administered at Weeks 34-36, a 200-250 μg heterologous booster dose of an HIV mRNA vaccine is administered at Weeks 42-44, a 200-250 μg heterologous booster dose of an HIV mRNA vaccine is administered at Weeks 46-48, and a 30-50 μg heterologous booster dose of an HIV mRNA vaccine is administered at Weeks 55-57. In some embodiments, a 200-300 μg dose of an HIV protein vaccine is administered at Weeks 50-52.
In some embodiments, a 400 μg dose of HIV mRNA vaccine is administered at Week 0, a 240 μg heterologous booster dose of HIV mRNA vaccine is administered at Week 11, a 240 μg heterologous booster dose of HIV mRNA vaccine is administered at Week 19, a 225 μg heterologous booster dose of HIV mRNA vaccine is administered at Week 27, a 225 μg heterologous booster dose of HIV mRNA vaccine is administered at Week 35, a 225 μg heterologous booster dose of HIV mRNA vaccine is administered at Week 43, a 225 μg heterologous booster dose of HIV mRNA vaccine is administered at Week 47, and a 35 μg heterologous booster dose of HIV mRNA vaccine is administered at Week 56. In some embodiments, an HIV a 100 μg dose of protein vaccine is administered at Week 51.
In some embodiments, an initial dose of an HIV mRNA vaccine comprising mRNA encoding HIV Env (from a first Clade) and mRNA encoding lentivirus Gag is administered at Week 0, a booster dose of an HIV mRNA vaccine comprising mRNA encoding HIV Env (from the first Clade) and mRNA encoding lentivirus Gag is administered at any one of Weeks 10-12, a booster dose of an HIV mRNA vaccine comprising mRNA encoding HIV Env (from the first Clade) and mRNA encoding lentivirus Gag is administered at any one of Weeks 18-20, at least one heterologous booster dose of an HIV mRNA vaccine comprising mRNA encoding HIV Env (from a second Clade, and optionally from a third Clade) and mRNA encoding lentivirus Gag is administered at any one of Weeks 26-28, a heterologous booster dose of an HIV mRNA vaccine comprising mRNA encoding HIV Env (from the second Clade, and optionally from the third Clade) and mRNA encoding lentivirus Gag is administered at any one of Weeks 34-36, at least one heterologous booster dose of an HIV mRNA vaccine comprising mRNA encoding HIV Env (from the second Clade, and optionally from the third Clade) and mRNA encoding lentivirus Gag is administered at any one of Weeks 42-44, at least one heterologous booster dose of an HIV mRNA vaccine comprising mRNA encoding HIV Env (from the second Clade, and optionally from the third Clade) and mRNA encoding lentivirus Gag is administered at any one of Weeks 46-48, and optionally at least one heterologous booster dose of an HIV mRNA vaccine comprising mRNA encoding HIV Env (from the second Clade, and optionally from the third Clade) and mRNA encoding lentivirus Gag is administered at any one of Weeks 55-57.
In some embodiments, the methods comprise administering to the subject a first lipid nanoparticle comprising a mRNA encoding a first HIV Env protein and a mRNA encoding an HIV Gag polyprotein, administering to the subject a second lipid nanoparticle comprising a mRNA encoding a second HIV Env protein and a mRNA encoding an HIV Gag polyprotein, and administering to the subject a third lipid nanoparticle comprising a mRNA encoding a third HIV Env protein and a mRNA encoding an HIV Gag polyprotein, wherein the population of neutralizing antibodies comprises neutralizing antibodies that bind to shared epitopes on proteins from multiple different HIV strains. In some embodiments, at least one of the first, second, and third HIV Env proteins comprises a sequence of an Env protein of an HIV strain obtained from an infected subject who has broad and potent neutralizing antibodies to HIV Env protein. In some embodiments, at least one of the first, second, and third HIV Env proteins comprises a consensus sequence of variants an Env protein of an HIV strain obtained from an infected subject who has broad and potent neutralizing antibodies to HIV Env protein.
In some embodiments, the methods comprise administering to the subject a first lipid nanoparticle comprising a mRNA encoding an HIV Clade B Env protein and a mRNA encoding an HIV Gag polyprotein, administering to the subject a second lipid nanoparticle comprising a mRNA encoding an HIV Clade A Env protein and a mRNA encoding an HIV Gag polyprotein, and administering to the subject a third lipid nanoparticle comprising a mRNA encoding an HIV Clade C Env protein and a mRNA encoding an HIV Gag polyprotein, wherein the population of neutralizing antibodies comprises neutralizing antibodies that bind to shared epitopes on HIV Clade B proteins, HIV Clade A proteins, and HIV Clade C proteins.
In some embodiments, the population comprises neutralizing antibodies that bind to shared epitopes on proteins from multiple Clade B HIV strains, neutralizing antibodies that bind to shared epitopes on proteins from multiple Clade A HIV strains, and neutralizing antibodies that bind to shared epitopes on proteins from multiple Clade C HIV strains. In some embodiments, the population comprises neutralizing antibodies that bind to shared epitopes on proteins from at least five (5) different HIV strains. For example, the population may comprise neutralizing antibodies that bind to shared epitopes on proteins from at least 10 different HIV strains. In some embodiments, the population comprises neutralizing antibodies that bind to shared epitopes on proteins from any of the following HIV strains: JRFL, WITO.33, BG505, AD8, 398F1, CNE8, CNE55, 25710, CE1176, X1632, TRO11, X2278, BJOXO2000, X2632, 246F3, CH119, CE0217, A3, 02, and A3/02.
In some embodiments, none of the first, second, or at least one additional lipid nanoparticles comprise mRNA encoding a soluble HIV Env protein.
Broadly Neutralizing Antibodies and Vaccine Efficacy
Antibody-mediated neutralization of viruses is the direct inhibition of viral infectivity resulting from antibody docking to virus particles (Burton D R et al. Curr Top Microbiol Immunol 2001; 260: 109-143). The elicitation of a neutralizing-antibody response is a correlate of protection for many vaccines and contributes to long-lived protection against many viral infections (Plotkin S A et al. Clin Vaccine Immunol 2010; 17: 1055-1065). A potent antiviral response may select for variants that allow escape from antibody neutralization and/or effector functions. Neutralization escape mechanisms are diverse and include the selection of amino acid variation in antibody epitopes directly as well as the modulation of structural features to prevent antibody binding.
As is known in the art, the number of antibodies required to neutralize a virus, such as HIV-1, can vary. While in many cases, the neutralization threshold for structurally distinct groups of viruses correlates positively with virion size, in agreement with the “coating theory” (Burton D R et al. 2001), factors that determine the number of antibodies required for neutralization may vary among viruses with different structures, compositions, and entry mechanisms. For example, the small number of functional trimers on the HIV-1 surface allows neutralization with a stoichiometry much lower than that predicted for a virion of this size (Yang X et al. J Virol 2005; 79: 3500-3508; and Klasse P J et al. Virology 2007; 369: 245-262). See also VanBlargan L A et al. Microbiology and Molecular Biology Reviews 2016; 80(4): 989-1010, incorporated herein by reference.
A broad and potent neutralizing antibody response to HIV (e.g., HIV-1) is one that can inhibit infectivity of multiple strains of HIV (e.g., heterologous tier-2 isolates). In some embodiments, a broad and potent neutralizing antibody response can inhibit infectivity of at least 2, at least 3, at least 4, at least 5 strains, at least 10 strains, or at least 15 strains of HIV (e.g., HIV-1). In some embodiments, a broad and potent neutralizing antibody response can inhibit infectivity of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15, or more of the following HIV strains: JRFL, WITO.33, BG505, AD8, 398F1, CNE8, CNE55, 25710, CE1176, X1632, TRO11, X2278, BJOXO2000, X2632, 246F3, CH119, CE0217, A3, 02, and A3/02. In some embodiments, neutralizing antibodies titers are calculated as the inhibitor concentrations (IC50) or reciprocal plasma/serum dilutions (ID50) causing a 50% reduction of relative light units. In some embodiments, a broad and neutralizing antibody response is characterized as having an ID50 titer of greater than 20. For example, the ID50 titer may be greater than 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100. In some embodiments, the ID50 titer is greater than 50. In some embodiments, the ID50 titer is greater than 100. “Shared epitopes” of HIV antigens, such as HIV Env protein, comprise a common sequence motif to which broadly neutralizing antibodies can bind. Herein, in some embodiments, as discussed throughout the disclosure, the HIV vaccination methods elicit broadly neutralizing antibodies that bind to shared epitopes across multiple strains (e.g., at least 2, at least 3, at least 5, at least 10, or at least 15 strains) of HIV (e.g., HIV-1). In some embodiments, a first lipid nanoparticle vaccine formulation and a second lipid nanoparticle vaccine formulation are administered more than once (e.g., 2 to 10 times, e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10 times, or more) and in an amount effective at inducing in the subject a population of neutralizing antibodies that bind to shared epitopes on proteins from a first HIV Clade and neutralizing antibodies that bind to shared epitopes on proteins from a (at least a) second HIV Clade. In some embodiments, the population comprises neutralizing antibodies that bind to shared epitopes on proteins from multiple strains (e.g., at least 2, at least 3, at least 5, at least 10, or at least 15 strains) of the first Clade and neutralizing antibodies that bind to shared epitopes on proteins from multiple strains (e.g., at least 2, at least 3, at least 5, at least 10, or at least 15 strains) of the second Clade.
In some embodiments, the methods further comprise administering to the subject at least one additional lipid nanoparticle comprising a mRNA encoding an HIV Env protein from at least one additional Clade (e.g., any one of Group M Clades A-K) and a mRNA encoding an HIV Gag protein. Thus, in some embodiments, the population comprises neutralizing antibodies that bind to shared epitopes on proteins from multiple strains of the at least one additional Clade (e.g., any one of Group M Clades A-K).
Some aspects of the present disclosure provide formulations of the HIV mRNA vaccine, wherein the HIV mRNA vaccine is formulated in an effective amount to produce an antigen specific immune response in a subject (e.g., production of antibodies specific to an HIV antigen). “An effective amount” is a dose of an HIV mRNA vaccine effective to produce an antigen-specific immune response. Also provided herein are methods of inducing an antigen-specific immune response in a subject.
In some embodiments, the antigen-specific immune response is characterized by measuring an anti-HIV antigen (e.g., anti-HIV Env and/or anti-HIV Gag) antibody titer produced in a subject administered an HIV mRNA vaccine as provided herein. An antibody titer is a measurement of the amount of antibodies within a subject, for example, antibodies that are specific to a particular antigen or epitope of an antigen. Antibody titer is typically expressed as the inverse of the greatest dilution that provides a positive result. Enzyme-linked immunosorbent assay (ELISA) is a common assay for determining antibody titers, for example.
In some embodiments, an antibody titer is used to assess whether a subject has had an infection or to determine whether immunizations are required. In some embodiments, an antibody titer is used to determine the strength of an autoimmune response, to determine whether a booster immunization is needed, to determine whether a previous vaccine was effective, and to identify any recent or prior infections. In accordance with the present disclosure, an antibody titer may be used to determine the strength of an immune response induced in a subject by the HIV mRNA vaccine.
The HIV therapies (e.g., combination of vaccine formulations and dosing schedule) provided herein produce in a subject broadly neutralizing antibodies against multiple HIV strains. In some embodiments, a broadly neutralizing antibody titer produced in a subject is increased by at least 1 log relative to a control. For example, a broadly neutralizing antibody titer produced in a subject may be increased by at least 1.5, at least 2, at least 2.5, or at least 3 log relative to a control. In some embodiments, a broadly neutralizing antibody titer produced in the subject is increased by 1, 1.5, 2, 2.5 or 3 log relative to a control. In some embodiments, a broadly neutralizing antibody titer produced in the subject is increased by 1-3 log relative to a control. For example, the a broadly neutralizing antibody titer produced in a subject may be increased by 1-1.5, 1-2, 1-2.5, 1-3, 1.5-2, 1.5-2.5, 1.5-3, 2-2.5, 2-3, or 2.5-3 log relative to a control.
In some embodiments, a broadly neutralizing antibody titer produced in a subject is increased at least 2 times relative to a control. For example, a broadly neutralizing antibody titer produced in a subject may be increased at least 3 times, at least 4 times, at least 5 times, at least 6 times, at least 7 times, at least 8 times, at least 9 times, or at least 10 times relative to a control. In some embodiments, a broadly neutralizing antibody titer produced in the subject is increased 2, 3, 4, 5, 6, 7, 8, 9, or 10 times relative to a control. In some embodiments, a broadly neutralizing antibody titer produced in a subject is increased 2-10 times relative to a control. For example, a broadly neutralizing antibody titer produced in a subject may be increased 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8, 8-10, 8-9, or 9-10 times relative to a control.
A control may be, for example, an unvaccinated subject, or a subject administered a live attenuated HIV vaccine, an inactivated HIV vaccine, or a protein subunit HIV vaccine. A control, in some embodiments, is a broadly neutralizing antibody titer produced in a subject who has not been administered an HIV mRNA vaccine. In some embodiments, a control is a broadly neutralizing antibody titer produced in a subject administered a recombinant or purified HIV protein vaccine. Recombinant protein vaccines typically include protein antigens that either have been produced in a heterologous expression system (e.g., bacteria or yeast) or purified from large amounts of the pathogenic organism.
In some embodiments, an effective amount of an HIV mRNA vaccine is a dose that is reduced compared to the standard of care dose of a recombinant HIV protein vaccine. A “standard of care,” as provided herein, refers to a medical or psychological treatment guideline and can be general or specific. “Standard of care” specifies appropriate treatment based on scientific evidence and collaboration between medical professionals involved in the treatment of a given condition. It is the diagnostic and treatment process that a physician/clinician should follow for a certain type of patient, illness or clinical circumstance. A “standard of care dose,” as provided herein, refers to the dose of a recombinant or purified HIV protein vaccine, or a live attenuated or inactivated HIV vaccine, or an HIV VLP vaccine, that a physician/clinician or other medical professional would administer to a subject to treat or prevent HIV, or an HIV-related condition, while following the standard of care guideline for treating or preventing HIV, or an HIV-related condition.
In some embodiments, a broadly neutralizing antibody titer produced in a subject administered an effective amount of an HIV mRNA vaccine is equivalent to a broadly neutralizing antibody titer produced in a control subject administered a standard of care dose of a recombinant or purified HIV protein vaccine, or a live attenuated or inactivated HIV vaccine, or an HIV VLP vaccine.
In some embodiments, an effective amount of an HIV mRNA vaccine is a dose equivalent to an at least 2-fold reduction in a standard of care dose of a recombinant or purified HIV protein vaccine. For example, an effective amount of an HIV mRNA vaccine may be a dose equivalent to an at least 3-fold, at least 4-fold, at least 5-fold, at least 6-fold, at least 7-fold, at least 8-fold, at least 9-fold, or at least 10-fold reduction in a standard of care dose of a recombinant or purified HIV protein vaccine. In some embodiments, an effective amount of an HIV mRNA vaccine is a dose equivalent to an at least at least 100-fold, at least 500-fold, or at least 1000-fold reduction in a standard of care dose of a recombinant or purified HIV protein vaccine. In some embodiments, an effective amount of an HIV mRNA vaccine is a dose equivalent to a 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 20-, 50-, 100-, 250-, 500-, or 1000-fold reduction in a standard of care dose of a recombinant or purified HIV protein vaccine. In some embodiments, a broadly neutralizing antibody titer produced in a subject administered an effective amount of an HIV mRNA vaccine is equivalent to a broadly neutralizing antibody titer produced in a control subject administered the standard of care dose of a recombinant or protein HIV protein vaccine, or a live attenuated or inactivated HIV vaccine, or an HIV VLP vaccine. In some embodiments, an effective amount of an HIV mRNA vaccine is a dose equivalent to a 2-fold to 1000-fold (e.g., 2-fold to 100-fold, 10-fold to 1000-fold) reduction in the standard of care dose of a recombinant or purified HIV protein vaccine, wherein a broadly neutralizing antibody titer produced in the subject is equivalent to a broadly neutralizing antibody titer produced in a control subject administered the standard of care dose of a recombinant or purified HIV protein vaccine, or a live attenuated or inactivated HIV vaccine, or an HIV VLP vaccine.
Vaccine efficacy may be assessed using standard analyses (see, e.g., Weinberg et al., J Infect Dis. 2010 Jun. 1; 201(11):1607-10). For example, vaccine efficacy may be measured by double-blind, randomized, clinical controlled trials. Vaccine efficacy may be expressed as a proportionate reduction in disease attack rate (AR) between the unvaccinated (ARU) and vaccinated (ARV) study cohorts and can be calculated from the relative risk (RR) of disease among the vaccinated group with use of the following formulas:
Efficacy=(ARU−ARV)/ARU×100; and
Efficacy=(1−RR)×100.
Likewise, vaccine effectiveness may be assessed using standard analyses (see, e.g., Weinberg et al., J Infect Dis. 2010 Jun. 1; 201(11):1607-10). Vaccine effectiveness is an assessment of how a vaccine (which may have already proven to have high vaccine efficacy) reduces disease in a population. This measure can assess the net balance of benefits and adverse effects of a vaccination program, not just the vaccine itself, under natural field conditions rather than in a controlled clinical trial. Vaccine effectiveness is proportional to vaccine efficacy (potency) but is also affected by how well target groups in the population are immunized, as well as by other non-vaccine-related factors that influence the ‘real-world’ outcomes of hospitalizations, ambulatory visits, or costs. For example, a retrospective case control analysis may be used, in which the rates of vaccination among a set of infected cases and appropriate controls are compared. Vaccine effectiveness may be expressed as a rate difference, with use of the odds ratio (OR) for developing infection despite vaccination:
Effectiveness=(1−OR)×100.
In some embodiments, efficacy of the HIV vaccine is at least 60% relative to unvaccinated control subjects. For example, efficacy of the HIV vaccine may be at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 95%, at least 98%, or 100% relative to unvaccinated control subjects.
Sterilizing Immunity. Sterilizing immunity refers to a unique immune status that prevents effective viral infection into the host. In some embodiments, the effective amount of an HIV vaccine of the present disclosure is sufficient to provide sterilizing immunity in the subject for at least 1 year. For example, the effective amount of an HIV vaccine of the present disclosure is sufficient to provide sterilizing immunity in the subject for at least 2 years, at least 3 years, at least 4 years, or at least 5 years. In some embodiments, the effective amount of an HIV vaccine of the present disclosure is sufficient to provide sterilizing immunity in the subject at an at least 5-fold lower dose relative to control. For example, the effective amount may be sufficient to provide sterilizing immunity in the subject at an at least 10-fold lower, 15-fold, or 20-fold lower dose relative to a control.
Detectable Antigen. In some embodiments, the effective amount of an HIV vaccine of the present disclosure is sufficient to produce detectable levels of HIV antigen as measured in serum of the subject at 1-72 hours post administration.
Titer. An antibody titer is a measurement of the amount of antibodies within a subject, for example, antibodies that are specific to a particular antigen (e.g., an anti-HIV antigen). Antibody titer is typically expressed as the inverse of the greatest dilution that provides a positive result. Enzyme-linked immunosorbent assay (ELISA) is a common assay for determining antibody titers, for example.
In some embodiments, the effective amount of an HIV vaccine of the present disclosure is sufficient to produce a 1,000-10,000 neutralizing antibody titer produced by neutralizing antibody against the HIV antigen as measured in serum of the subject at 1-72 hours post administration. In some embodiments, the effective amount is sufficient to produce a 1,000-5,000 neutralizing antibody titer produced by neutralizing antibody against the HIV antigen as measured in serum of the subject at 1-72 hours post administration. In some embodiments, the effective amount is sufficient to produce a 5,000-10,000 neutralizing antibody titer produced by neutralizing antibody against the HIV antigen as measured in serum of the subject at 1-72 hours post administration.
In some embodiments, the neutralizing antibody titer is at least 100 neutralizing units per milliliter (NU/mL). For example, the neutralizing antibody titer may be at least 200, 300, 400, 500, 600, 700, 800, 900 or 1000 NU/mL. In some embodiments, the neutralizing antibody titer is at least 10,000 NU/mL.
In some embodiments, a geometric mean, which is the nth root of the product of n numbers, is generally used to describe proportional growth. Geometric mean, in some embodiments, is used to characterize antibody titer produced in a subject.
mRNA Design, Elements, and Manufacturing
Messenger RNA (mRNA) is any ribonucleic acid that encodes a (at least one) protein (a naturally-occurring, non-naturally-occurring, or modified polymer of amino acids) and can be translated to produce the encoded protein in vitro, in vivo, in situ, or ex vivo. The skilled artisan will appreciate that, except where otherwise noted, nucleic acid sequences set forth in the instant application may recite “T”s in a representative DNA sequence but where the sequence represents RNA (e.g., mRNA), the “T”s would be substituted for “U”s. Thus, any of the DNAs disclosed and identified by a particular sequence identification number herein also disclose the corresponding RNA (e.g., mRNA) sequence complementary to the DNA, where each “T” of the DNA sequence is substituted with “U.”
An open reading frame (ORF) is a continuous stretch of DNA or RNA beginning with a start codon (e.g., methionine (ATG or AUG)) and ending with a stop codon (e.g., TAA, TAG or TGA, or UAA, UAG or UGA). An ORF typically encodes a protein. It will be understood that the sequences disclosed herein may further comprise additional elements, e.g., 5′ and 3′ UTRs, but that those elements, unlike the ORF, need not necessarily be present in a vaccine of the present disclosure. It is contemplated that the HIV vaccines of the present disclosure comprise at least one (one or more) ribonucleic acid (RNA) having an open reading frame encoding at least one HIV antigen.
In some embodiments, the RNA is a messenger RNA (mRNA) having an open reading frame encoding at least one HIV antigen. In some embodiments, the RNA (e.g., mRNA) further comprises a (at least one) 5′ UTR, 3′ UTR, a polyA tail and/or a 5′ cap.
mRNA of the present disclosure, in some embodiments, is not naturally-occurring. That is, the mRNA in some embodiments, is engineered, for example, chemically synthesized or produced using recombinant nucleic acid technology. In some embodiments, at least one mRNA of the compositions provided herein is naturally-occurring.
A “5′ untranslated region” (UTR) refers to a region of an mRNA that is directly upstream (i.e., 5′) from the start codon (i.e., the first codon of an mRNA transcript translated by a ribosome) that does not encode a polypeptide. When RNA transcripts are being generated, the 5′ UTR may comprise a promoter sequence. Such promoter sequences are known in the art. It should be understood that such promoter sequences will not be present in a vaccine of the disclosure. Non-limiting examples of 5′ UTR sequences include
A “3′ untranslated region” (UTR) refers to a region of an mRNA that is directly downstream (i.e., 3′) from the stop codon (i.e., the codon of an mRNA transcript that signals a termination of translation) that does not encode a polypeptide. 3′ UTR: Non-limiting examples of 3′ UTR sequences include
An “open reading frame” is a continuous stretch of DNA beginning with a start codon (e.g., methionine (ATG)), and ending with a stop codon (e.g., TAA, TAG or TGA) and encodes a polypeptide.
A “polyA tail” is a region of mRNA that is downstream, e.g., directly downstream (i.e., 3′), from the 3′ UTR that contains multiple, consecutive adenosine monophosphates. A polyA tail may contain 10 to 300 adenosine monophosphates. For example, a polyA tail may contain 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290 or 300 adenosine monophosphates. In some embodiments, a polyA tail contains 50 to 250 adenosine monophosphates. In a relevant biological setting (e.g., in cells, in vivo) the poly(A) tail functions to protect mRNA from enzymatic degradation, e.g., in the cytoplasm, and aids in transcription termination, and/or export of the mRNA from the nucleus and translation.
In some embodiments, the length of a mRNA is 200 to 3,000 nucleotides. For example, the length of a mRNA may include 200 to 500, 200 to 1000, 200 to 1500, 200 to 3000, 500 to 1000, 500 to 1500, 500 to 2000, 500 to 3000, 1000 to 1500, 1000 to 2000, 1000 to 3000, 1500 to 3000, or 2000 to 3000 nucleotides).
Sequence Optimization
In some embodiments, an ORF encoding an Env and/or Gag protein of the disclosure is codon optimized. Codon optimization methods are known in the art. For example, an ORF of any one or more of the sequences provided herein may be codon optimized. Codon optimization, in some embodiments, may be used to match codon frequencies in target and host organisms to ensure proper folding; bias GC content to increase mRNA stability or reduce secondary structures; minimize tandem repeat codons or base runs that may impair gene construction or expression; customize transcriptional and translational control regions; insert or remove protein trafficking sequences; remove/add post translation modification sites in encoded protein (e.g., glycosylation sites); add, remove or shuffle protein domains; insert or delete restriction sites; modify ribosome binding sites and mRNA degradation sites; adjust translational rates to allow the various domains of the protein to fold properly; or reduce or eliminate problem secondary structures within the polynucleotide. Codon optimization tools, algorithms and services are known in the art—non-limiting examples include services from GeneArt (Life Technologies), DNA2.0 (Menlo Park CA) and/or proprietary methods. In some embodiments, the open reading frame (ORF) sequence is optimized using optimization algorithms.
In some embodiments, a codon optimized sequence shares less than 95% (e.g., less than 90%, less than 85%, less than 80%, or less than 75%) sequence identity to a naturally-occurring or wild-type sequence ORF (e.g., a naturally-occurring or wild-type mRNA sequence encoding an ENV or Gag protein). In some embodiments, a codon optimized sequence shares between 65% and 85% (e.g., between about 67% and about 85% or between about 67% and about 80%) sequence identity to a naturally-occurring or wild-type sequence (e.g., a naturally-occurring or wild-type mRNA sequence encoding an ENV or Gag protein).
In some embodiments, a codon optimized mRNA may be one in which the levels of G/C are enhanced. The G/C-content of nucleic acid molecules (e.g., mRNA) may influence the stability of the mRNA. mRNA having an increased amount of guanine (G) and/or cytosine (C) residues may be functionally more stable than mRNA containing a large amount of adenine (A) and thymine (T) or uracil (U) nucleotides. As an example, WO2002098443 (published Dec. 12, 2002) discloses a pharmaceutical composition containing an mRNA stabilized by sequence modifications in the translated region. Due to the degeneracy of the genetic code, the modifications work by substituting existing codons for those that promote greater RNA stability without changing the resulting amino acid. The approach is limited to coding regions of the RNA.
Chemically Unmodified Nucleotides
In some embodiments, at least one RNA (e.g., mRNA) of HIV vaccines of the present disclosure is not chemically modified and comprises the standard ribonucleotides consisting of adenosine, guanosine, cytosine and uridine. In some embodiments, nucleotides and nucleosides of the present disclosure comprise standard nucleoside residues such as those present in transcribed RNA (e.g. A, G, C, or U). In some embodiments, nucleotides and nucleosides of the present disclosure comprise standard deoxyribonucleosides such as those present in DNA (e.g. dA, dG, dC, or dT).
Chemical Modifications
HIV mRNA vaccines of the present disclosure comprise, in some embodiments, at least one mRNA having an open reading frame encoding at least one Env and/or Gag protein, wherein the mRNA comprises nucleotides and/or nucleosides that can be standard (unmodified) or modified as is known in the art. In some embodiments, nucleotides and nucleosides of the present disclosure comprise modified nucleotides or nucleosides. Such modified nucleotides and nucleosides can be naturally-occurring modified nucleotides and nucleosides or non-naturally occurring modified nucleotides and nucleosides. Such modifications can include those at the sugar, backbone, or nucleobase portion of the nucleotide and/or nucleoside as are recognized in the art.
In some embodiments, a naturally-occurring modified nucleotide or nucleotide of the disclosure is one as is generally known or recognized in the art. Non-limiting examples of such naturally occurring modified nucleotides and nucleotides can be found, inter alia, in the widely recognized MODOMICS database.
In some embodiments, a non-naturally occurring modified nucleotide or nucleoside of the disclosure is one as is generally known or recognized in the art. Non-limiting examples of such non-naturally occurring modified nucleotides and nucleosides can be found, inter alia, in published US application Nos. PCT/US2012/058519; PCT/US2013/075177; PCT/US2014/058897; PCT/US2014/058891; PCT/US2014/070413; PCT/US2015/36773; PCT/US2015/36759; PCT/US2015/36771; or PCT/IB2017/051367 all of which are incorporated by reference herein.
Thus, mRNA of the disclosure can comprise standard nucleotides and nucleosides, naturally-occurring nucleotides and nucleosides, non-naturally-occurring nucleotides and nucleosides, or any combination thereof.
The mRNA in some embodiments, comprises non-natural modified nucleotides that are introduced during synthesis or post-synthesis of the mRNA to achieve desired functions or properties. The modifications may be present on internucleotide linkages, purine or pyrimidine bases, or sugars. The modification may be introduced with chemical synthesis or with a polymerase enzyme at the terminal of a chain or anywhere else in the chain. Any of the regions of a mRNA may be chemically modified.
The present disclosure provides for modified nucleosides and nucleotides of a mRNA. A “nucleoside” refers to a compound containing a sugar molecule (e.g., a pentose or ribose) or a derivative thereof in combination with an organic base (e.g., a purine or pyrimidine) or a derivative thereof (also referred to herein as “nucleobase”). A “nucleotide” refers to a nucleoside, including a phosphate group. Modified nucleotides may by synthesized by any useful method, such as, for example, chemically, enzymatically, or recombinantly, to include one or more modified or non-natural nucleosides. mRNA can comprise a region or regions of linked nucleosides. Such regions may have variable backbone linkages. The linkages can be standard phosphodiester linkages, in which case the mRNA would comprise regions of nucleotides.
Modified nucleotide base pairing encompasses not only the standard adenosine-thymine, adenosine-uracil, or guanosine-cytosine base pairs, but also base pairs formed between nucleotides and/or modified nucleotides comprising non-standard or modified bases, wherein the arrangement of hydrogen bond donors and hydrogen bond acceptors permits hydrogen bonding between a non-standard base and a standard base or between two complementary non-standard base structures, such as, for example, in the mRNA having at least one chemical modification. One example of such non-standard base pairing is the base pairing between the modified nucleotide inosine and adenine, cytosine or uracil. Any combination of base/sugar or linker may be incorporated into mRNA of the present disclosure.
In some embodiments, modified nucleobases in mRNA comprise 1-methyl-pseudouridine (m1ψ), 1-ethyl-pseudouridine (e1ψ), 5-methoxy-uridine (mo5U), 5-methyl-cytidine (m5C), and/or pseudouridine (ψ). In some embodiments, modified nucleobases in mRNA comprise 5-methoxymethyl uridine, 5-methylthio uridine, 1-methoxymethyl pseudouridine, 5-methyl cytidine, and/or 5-methoxy cytidine. In some embodiments, the polyribonucleotide includes a combination of at least two (e.g., 2, 3, 4 or more) of any of the aforementioned modified nucleobases, including but not limited to chemical modifications.
In some embodiments, a MRNA of the disclosure comprises 1-methyl-pseudouridine (m1ψ) substitutions at one or more or all uridine positions of the mRNA. In some embodiments, a MRNA of the disclosure comprises 1-methyl-pseudouridine (m1ψ) substitutions at one or more or all uridine positions of the mRNA and 5-methyl cytidine substitutions at one or more or all cytidine positions of the mRNA. In some embodiments, a MRNA of the disclosure comprises pseudouridine (ψ) substitutions at one or more or all uridine positions of the mRNA. In some embodiments, a MRNA of the disclosure comprises pseudouridine (ψ) substitutions at one or more or all uridine positions of the mRNA and 5-methyl cytidine substitutions at one or more or all cytidine positions of the mRNA. In some embodiments, a mRNA of the disclosure comprises uridine at one or more or all uridine positions of the mRNA.
In some embodiments, mRNA is uniformly modified (e.g., fully modified, modified throughout the entire sequence) for a particular modification. For example, mRNA can be uniformly modified with 1-methyl-pseudouridine, meaning that all uridine residues in the mRNA sequence are replaced with 1-methyl-pseudouridine. Similarly, mRNA can be uniformly modified for any type of nucleoside residue present in the sequence by replacement with a modified residue such as those set forth above.
The mRNA may contain from about 1% to about 100% modified nucleotides (either in relation to overall nucleotide content, or in relation to one or more types of nucleotide, i.e., any one or more of A, G, U or C) or any intervening percentage. It will be understood that any remaining percentage is accounted for by the presence of unmodified A, G, U, or C. The mRNA may contain at a minimum 1% and at maximum 100% modified nucleotides, or any intervening percentage. In some embodiments, at least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90% or 100% of the uracil in the mRNA is replaced with a modified uracil (e.g., a 5-substituted uracil).
In Vitro Transcription of RNA
cDNA encoding the polynucleotides described herein may be transcribed using an in vitro transcription (IVT) system. In vitro transcription of RNA is known in the art and is described in WO2014/152027, which is incorporated by reference herein in its entirety.
In some embodiments, the mRNA transcript is generated using a non-amplified, linearized DNA template in an in vitro transcription reaction to generate the RNA transcript. In some embodiments, the template DNA is isolated DNA. In some embodiments, the template DNA is cDNA. In some embodiments, the cDNA is formed by reverse transcription of HIV mRNA. In some embodiments, cells, e.g., bacterial cells, e.g., E. coli, e.g., DH-1 cells are transfected with the plasmid DNA template. In some embodiments, the transfected cells are cultured to replicate the plasmid DNA which is then isolated and purified. In some embodiments, the DNA template includes a RNA polymerase promoter, e.g., a T7 promoter located 5 ‘ to and operably linked to the gene of interest.
In some embodiments, an in vitro transcription template encodes a 5’ untranslated (UTR) region, contains an open reading frame, and encodes a 3′ UTR and a polyA tail. The particular nucleic acid sequence composition and length of an in vitro transcription template will depend on the mRNA encoded by the template.
An in vitro transcription system typically comprises a transcription buffer, nucleotide triphosphates (NTPs), an RNase inhibitor and a polymerase.
The NTPs may be manufactured in house, may be selected from a supplier, or may be synthesized as described herein. The NTPs may be selected from, but are not limited to, those described herein including natural and unnatural (modified) NTPs.
Any number of RNA polymerases or variants may be used in the method of the present disclosure. The polymerase may be selected from, but is not limited to, a phage RNA polymerase, e.g., a T7 RNA polymerase, a T3 RNA polymerase, a SP6 RNA polymerase, and/or mutant polymerases such as, but not limited to, polymerases able to incorporate modified nucleic acids and/or modified nucleotides, including chemically modified nucleic acids and/or nucleotides. Some embodiments exclude the use of DNase.
In some embodiments, the RNA transcript is capped via enzymatic capping. In some embodiments, the RNA comprises 5′ terminal cap, for example, 7mG(5′)ppp(5′)NlmpNp.
Chemical Synthesis
Solid-phase chemical synthesis. Nucleic acids the present disclosure may be manufactured in whole or in part using solid phase techniques. Solid-phase chemical synthesis of nucleic acids is an automated method wherein molecules are immobilized on a solid support and synthesized step by step in a reactant solution. Solid-phase synthesis is useful in site-specific introduction of chemical modifications in the nucleic acid sequences.
Liquid Phase Chemical Synthesis. The synthesis of nucleic acids of the present disclosure by the sequential addition of monomer building blocks may be carried out in a liquid phase.
Combination of Synthetic Methods. The synthetic methods discussed above each has its own advantages and limitations. Attempts have been conducted to combine these methods to overcome the limitations. Such combinations of methods are within the scope of the present disclosure. The use of solid-phase or liquid-phase chemical synthesis in combination with enzymatic ligation provides an efficient way to generate long chain nucleic acids that cannot be obtained by chemical synthesis alone.
Ligation of Nucleic Acid Regions or Subregions
Assembling nucleic acids by a ligase may also be used. DNA or RNA ligases promote intermolecular ligation of the 5′ and 3′ ends of polynucleotide chains through the formation of a phosphodiester bond. Nucleic acids such as chimeric polynucleotides and/or circular nucleic acids may be prepared by ligation of one or more regions or subregions. DNA fragments can be joined by a ligase catalyzed reaction to create recombinant DNA with different functions. Two oligodeoxynucleotides, one with a 5′ phosphoryl group and another with a free 3′ hydroxyl group, serve as substrates for a DNA ligase.
Purification
Purification of the nucleic acids described herein may include, but is not limited to, nucleic acid clean-up, quality assurance and quality control. Clean-up may be performed by methods known in the arts such as, but not limited to, AGENCOURT® beads (Beckman Coulter Genomics, Danvers, MA), poly-T beads, LNATM oligo-T capture probes (EXIQON® Inc, Vedbaek, Denmark) or HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC). The term “purified” when used in relation to a nucleic acid such as a “purified nucleic acid” refers to one that is separated from at least one contaminant. A “contaminant” is any substance that makes another unfit, impure or inferior. Thus, a purified nucleic acid (e.g., DNA and RNA) is present in a form or setting different from that in which it is found in nature, or a form or setting different from that which existed prior to subjecting it to a treatment or purification method.
A quality assurance and/or quality control check may be conducted using methods such as, but not limited to, gel electrophoresis, UV absorbance, or analytical HPLC.
In some embodiments, the nucleic acids may be sequenced by methods including, but not limited to reverse-transcriptase-PCR.
Quantification
In some embodiments, the nucleic acids of the present invention may be quantified in exosomes or when derived from one or more bodily fluid. Bodily fluids include peripheral blood, serum, plasma, ascites, urine, cerebrospinal fluid (CSF), sputum, saliva, bone marrow, synovial fluid, aqueous humor, amniotic fluid, cerumen, breast milk, broncheoalveolar lavage fluid, semen, prostatic fluid, cowper's fluid or pre-ejaculatory fluid, sweat, fecal matter, hair, tears, cyst fluid, pleural and peritoneal fluid, pericardial fluid, lymph, chyme, chyle, bile, interstitial fluid, menses, pus, sebum, vomit, vaginal secretions, mucosal secretion, stool water, pancreatic juice, lavage fluids from sinus cavities, bronchopulmonary aspirates, blastocyl cavity fluid, and umbilical cord blood. Alternatively, exosomes may be retrieved from an organ selected from the group consisting of lung, heart, pancreas, stomach, intestine, bladder, kidney, ovary, testis, skin, colon, breast, prostate, brain, esophagus, liver, and placenta.
Assays may be performed using construct specific probes, cytometry, qRT-PCR, real-time PCR, PCR, flow cytometry, electrophoresis, mass spectrometry, or combinations thereof while the exosomes may be isolated using immunohistochemical methods such as enzyme linked immunosorbent assay (ELISA) methods. Exosomes may also be isolated by size exclusion chromatography, density gradient centrifugation, differential centrifugation, nanomembrane ultrafiltration, immunoabsorbent capture, affinity purification, microfluidic separation, or combinations thereof.
These methods afford the investigator the ability to monitor, in real time, the level of nucleic acids remaining or delivered. This is possible because the nucleic acids of the present disclosure, in some embodiments, differ from the endogenous forms due to the structural or chemical modifications.
In some embodiments, the nucleic acid may be quantified using methods such as, but not limited to, ultraviolet visible spectroscopy (UV/Vis). A non-limiting example of a UV/Vis spectrometer is a NANODROP® spectrometer (ThermoFisher, Waltham, MA). The quantified nucleic acid may be analyzed in order to determine if the nucleic acid may be of proper size, check that no degradation of the nucleic acid has occurred. Degradation of the nucleic acid may be checked by methods such as, but not limited to, agarose gel electrophoresis, HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC), liquid chromatography-mass spectrometry (LCMS), capillary electrophoresis (CE) and capillary gel electrophoresis (CGE).
Fifteen Rhesus macaques were divided into Groups (“GR”). Two groups (GRs. 3 and 4) received seven doses of immunizations containing mRNA encoding an HIV-1 envelope protein, with either a Native or Modified CD4 receptor-binding ability, co-formulated with mRNA encoding an SIV group-specific antigen (Gag) protein (Table 1). The other two groups (GRs. 1 and 2) received five doses of the same formula and two doses of pre-made soluble HIV-1 Env protein (SOSIP trimer) administered with an adjuvant (Adjuplex). The immunizations were delivered approximately every eight weeks (
The first two doses contained mRNA encoding an Env protein from Clade B. These were followed by either a third dose of the same formula (GRs. 3 and 4) or a dose of the soluble envelope proteins (
Blood draws were taken and neutralization titers were performed against autologous HIV-1 strains starting at week 13 (after the second dose) as well as a broad-spectrum neutralization of heterologous HIV-1 strains at week 58 (Tables 2 and 3). As Table 2 shows, there is an increasing immunological response to the strain from Clade B, which response persists and increases beyond the administration of the doses containing the strain. This can also be seen in
Monkeys
Fifteen female Rhesus macaques (Macaca mulatta), aged 6 to 12, were maintained in accordance with the guidelines of the Committee on Care and Use of Laboratory Animals (which is incorporated herein by reference) and housed in a biosafety level 2 facility at BIOQUAL, Inc. (Rockville, MD). The animals were grouped by carefully balancing age, weight, and complete blood count (CBC)/chemistry parameters. Four additional naïve macaques were included in the study during the challenge phase. All animals were negative for the major histocompatibility complex (MHC) class I Mamu-A*01 allele.
Proteins
Soluble stabilized envelope proteins (SOSIP trimers) were produced in 293 Freestyle cells by transient co-transfection of plasmids encoding Env DNA and the cellular protease Furin. Cell culture supernatants were harvested 5 or 6 days after transfection. After 0.22 um filtering, the supernatants were sequentially loaded on a Galanthus nivalis lectin column, followed by passage on a size-exclusion column and then on a mAb 446-52D negative selection column. Finally, the purified trimers were concentrated to 1-2 mg/ml in PBS and stored at −80° C. Site-directed mutagenesis was performed to introduce specific mutations. The N188 glycan was introduced in Clade B WITO.33 and WITO.33 113C-432GCG SOSIP. Other SOSIP proteins included BG505 (Clade A) containing the following mutations: T332N, 241N, 289N, 375Y or BG505 T332N, 241N, 289N, 375Y, D113C-R429C; JR-FL (Clade B) containing the following mutations: 375Y and JR-FL, D113C-R432GCG 375Y; and DU422 (Clade C) containing the following mutations: 295N, 386N, 375Y and Du422 295N, 386N, 375Y, 113C-432GCG.
mRNA Purification
Purification of the nucleic acids described herein may include, but is not limited to, nucleic acid clean-up, quality assurance and quality control. Clean-up may be performed by methods known in the arts such as, but not limited to, AGENCOURT® beads (Beckman Coulter Genomics, Danvers, MA), poly-T beads, LNATM oligo-T capture probes (EXIQON® Inc, Vedbaek, Denmark) or HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC). The term “purified” when used in relation to a nucleic acid such as a “purified nucleic acid” refers to one that is separated from at least one contaminant. A “contaminant” is any substance that makes another unfit, impure or inferior. Thus, a purified nucleic acid (e.g., DNA and RNA) is present in a form or setting different from that in which it is found in nature, or a form or setting different from that which existed prior to subjecting it to a treatment or purification method.
A quality assurance and/or quality control check may be conducted using methods such as, but not limited to, gel electrophoresis, UV absorbance, or analytical HPLC.
In some embodiments, the nucleic acids may be sequenced by methods including, but not limited to reverse-transcriptase-PCR.
mRNA Quantification
In some embodiments, the nucleic acids of the present disclosure may be quantified in exosomes or when derived from one or more bodily fluid. Bodily fluids include peripheral blood, serum, plasma, ascites, urine, cerebrospinal fluid (CSF), sputum, saliva, bone marrow, synovial fluid, aqueous humor, amniotic fluid, cerumen, breast milk, broncheoalveolar lavage fluid, semen, prostatic fluid, cowper's fluid or pre-ejaculatory fluid, sweat, fecal matter, hair, tears, cyst fluid, pleural and peritoneal fluid, pericardial fluid, lymph, chyme, chyle, bile, interstitial fluid, menses, pus, sebum, vomit, vaginal secretions, mucosal secretion, stool water, pancreatic juice, lavage fluids from sinus cavities, bronchopulmonary aspirates, blastocyl cavity fluid, and umbilical cord blood. Alternatively, exosomes may be retrieved from an organ selected from the group consisting of lung, heart, pancreas, stomach, intestine, bladder, kidney, ovary, testis, skin, colon, breast, prostate, brain, esophagus, liver, and placenta.
Assays may be performed using construct specific probes, cytometry, qRT-PCR, real-time PCR, PCR, flow cytometry, electrophoresis, mass spectrometry, or combinations thereof while the exosomes may be isolated using immunohistochemical methods such as enzyme linked immunosorbent assay (ELISA) methods. Exosomes may also be isolated by size exclusion chromatography, density gradient centrifugation, differential centrifugation, nanomembrane ultrafiltration, immunoabsorbent capture, affinity purification, microfluidic separation, or combinations thereof.
These methods afford the investigator the ability to monitor, in real time, the level of nucleic acids remaining or delivered. This is possible because the nucleic acids of the present disclosure, in some embodiments, differ from the endogenous forms due to the structural or chemical modifications.
In some embodiments, the nucleic acid may be quantified using methods such as, but not limited to, ultraviolet visible spectroscopy (UV/Vis). A non-limiting example of a UV/Vis spectrometer is a NANODROP® spectrometer (ThermoFisher, Waltham, MA). The quantified nucleic acid may be analyzed in order to determine if the nucleic acid may be of proper size, check that no degradation of the nucleic acid has occurred. Degradation of the nucleic acid may be checked by methods such as, but not limited to, agarose gel electrophoresis, HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC), liquid chromatography-mass spectrometry (LCMS), capillary electrophoresis (CE) and capillary gel electrophoresis (CGE).
Viruses
In vivo-titrated SHIVAD8-EO virus stocks were provided by Dr. Malcolm A. Martin (LMM, NIAID). Virus stocks were prepared by transfecting 293T cells with SHIV AD8-CK15 molecular clones using Lipofectamine 2000. Culture supernatants were collected 48 hours later. The virus stock infectivity was measured by infecting Con A-stimulated rhesus PBMCs and aliquots were stored at −80° C. until use.
For in vitro neutralization assays, HIV-1 pseudoparticles expressing wide-type or mutated gp160 from BG505 and other isolates were produced in HEK 293T cells by co-transfecting Env-expressing plasmids with a backbone plasmid, pSG3Δenv, expressing a full-length HIV-1 clone with a defective env gene using Mirus293 Transfection Reagent. Culture supernatants were collected 48 hours later and aliquots were stored at −80° C. until use; virus stock infectivity titers were measured by using serial dilutions in TZM-b1 cells.
Experimental Replication, Randomization, and Blinding
For vaccination, 15 macaques were allocated to experimental groups in order to balance the average age, weight and peripheral WBC and CD4+ T-cell counts. Each in vitro experiment was independently performed at least twice in duplicate wells to ensure reproducibility.
Lipid Nanoparticle
An ionizable cationic lipid nanoparticle formulation, comprising a molar ratio of 20-60% ionizable cationic lipid (Compound 1), 5-25% non-cationic lipid, 25-55% sterol, and 0.5-15% PEG-modified lipid, was used for these experiments.
Dosing
All macaque immunizations were performed at BIOQUAL, Inc facility. All 15 macaques were immunized with 500 μl of the dosing material via the intramuscular route into the right posterior thigh of each animal. Injections included 500 μl of co-formulated Env+Gag mRNAs, or SOSIP.664 trimers (wild-type or interdomain-stabilized) pre-mixed with 100 μL of Adjuplex adjuvant (Sigma). Immunizations were performed at weeks 0, 11, 19, 27, 35, 43, 47, 51, 56, and 59.
Blood Draws
Animals were sedated and blood was drawn from a posterior leg vein generally at 2 weeks after each immunization, as well as every week during the virus challenge phase. Plasma and PBMC were collected and stored frozen. An aliquot of blood was regularly sent to an external laboratory for blood chemistry and CBC counts.
Virus Challenge
The SHIVAD8-EO is a CCR5-tropic tier 2 (neutralization-sensitivity phenotype) pathogenic strain that replicates to high levels in rhesus macaques. The virus stock was titrated in macaque PBMC and diluted in PBS to 10 TCID50 at the time of challenge. All animals were inoculated intra-rectally with low-dose (10 tissue culture infectious doses per dose) SHIVAD8-EO at weekly intervals until infection became established. A 3 ml speculum was used to gently open the rectum, and a 1-ml suspension of virus in a tuberculin syringe was slowly infused into the rectal cavity.
Titers
Macaque plasma samples were collected from two weeks post-immunization and other interested time points (e.g., plasma samples were collected at weeks-2, 7, 19, 27, 31, 35, 43, 47, 53, and 60). The neutralization was performed by using single-cycle infection of TZM-b1 cells by ENV pseudoviruses. Serial dilutions of plasma samples were incubated with pseduotyped viruses for 30 minutes in 96 well plates and then 100 μl TZM-B1 cells that contain 10,000 cells were added. Reporter gene activation signal was detected at 48 hours later after removing 150 μl media and adding the 40 μl Luciferase Assay Reagent per well. Relative Light Unit were recorded and half-maximal inhibitory concentrations (IC50) were performed using Graphpad Prism 7.
The data in this set of experiments shows that the SIV Gag polyprotein is efficiently processed to its final products, including the main core protein p27, in the presence of SIV protease (
The data in this set of experiments shows that fully processed SIV core protein p27 is efficiently and selectively incorporated into virus-like particles (VLPs) in the presence of SIV protease (
The data in this set of experiments shows that the production of extracellular SHIV VLPs is markedly increased in the presence of SIV protease (
The data in this set of experiments shows that the efficiency of Env processing to gp120 (
The data in this set of experiments shows that both HIV-1 Env and Gag are fully processed in virus-like particles (VLPs) produced using Gag-Pol (which expresses also the viral protease) (
The data in this set of experiments shows that VLPs produced using Gag-Pol display a desired vaccine-relevant antigenic profile, with high expression of epitopes recognized by broadly neutralizing antibodies (bNAbs) (
In this example, we cloned a significant number of diverse antibodies specific for the CD4-binding site. A majority of them use VH4, which is the heavy chain used by all but 2 of the anti-CD4-binding site neutralizing antibodies cloned from macaques in another study (Mason et al. PLOS Pathogen, 2016, DOI:10.1371/journal.ppat.1005537).
All references, patents and patent applications disclosed herein are incorporated by reference with respect to the subject matter for which each is cited, which in some cases may encompass the entirety of the document.
The indefinite articles “a” and “an,” as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to mean “at least one.”
It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited.
In the claims, as well as in the specification above, all transitional phrases such as “comprising,” “including,” “carrying,” “having,” “containing,” “involving,” “holding,” “composed of,” and the like are to be understood to be open-ended, i.e., to mean including but not limited to. Only the transitional phrases “consisting of” and “consisting essentially of” shall be closed or semi-closed transitional phrases, respectively, as set forth in the United States Patent Office Manual of Patent Examining Procedures, Section 2111.03.
The terms “about” and “substantially” preceding a numerical value mean±10% of the recited numerical value.
Where a range of values is provided, each value between the upper and lower ends of the range are specifically contemplated and described herein.
This application is a national stage filing under 35 U.S.C. § 371 of International Application No. PCT/US2020/022710, filed Mar. 13, 2020, which claims the benefit under 35 U.S.C. § 119(e) of U.S. Provisional Application No. 62/819,394, filed Mar. 15, 2019, each of which is incorporated by reference herein in its entirety.
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/US2020/022710 | 3/13/2020 | WO |
| Publishing Document | Publishing Date | Country | Kind |
|---|---|---|---|
| WO2020/190750 | 9/24/2020 | WO | A |
| Number | Name | Date | Kind |
|---|---|---|---|
| 3906092 | Hilleman et al. | Sep 1975 | A |
| 5589466 | Felgner et al. | Dec 1996 | A |
| 5686601 | Weber | Nov 1997 | A |
| 5750114 | Burke et al. | May 1998 | A |
| 5955088 | Ghiasi et al. | Sep 1999 | A |
| 5965726 | Pavlakis et al. | Oct 1999 | A |
| 6214804 | Feigner et al. | Apr 2001 | B1 |
| 6413518 | Koelle et al. | Jul 2002 | B1 |
| 6500419 | Hone et al. | Dec 2002 | B1 |
| 6514948 | Raz et al. | Feb 2003 | B1 |
| 6534312 | Shiver et al. | Mar 2003 | B1 |
| 6610044 | Mathiesen | Aug 2003 | B2 |
| 7001890 | Wagner et al. | Feb 2006 | B1 |
| 8158601 | Chen et al. | Apr 2012 | B2 |
| 8183352 | Ayyavoo et al. | May 2012 | B2 |
| 8217016 | Hoerr et al. | Jul 2012 | B2 |
| 8242087 | Adelfinskaya et al. | Aug 2012 | B2 |
| 8569256 | Heyes et al. | Oct 2013 | B2 |
| 8609142 | Troiano et al. | Dec 2013 | B2 |
| 8613954 | Zale et al. | Dec 2013 | B2 |
| 8617608 | Zale et al. | Dec 2013 | B2 |
| 8673316 | Kinney et al. | Mar 2014 | B2 |
| 8691961 | Puffer et al. | Apr 2014 | B1 |
| 8710200 | Schrum et al. | Apr 2014 | B2 |
| 8734832 | O'Hagan et al. | May 2014 | B2 |
| 8734853 | Sood et al. | May 2014 | B2 |
| 8754062 | De Fougerolles et al. | Jun 2014 | B2 |
| 8822663 | Schrum et al. | Sep 2014 | B2 |
| 8877206 | Chen et al. | Nov 2014 | B2 |
| 8980864 | Hoge et al. | Mar 2015 | B2 |
| 8999380 | Bancel et al. | Apr 2015 | B2 |
| 9000141 | Chang et al. | Apr 2015 | B2 |
| 9149543 | Hecker et al. | Oct 2015 | B2 |
| 9221891 | Bancel et al. | Dec 2015 | B2 |
| 9243041 | Weiner et al. | Jan 2016 | B2 |
| 9255126 | Polo et al. | Feb 2016 | B2 |
| 9267114 | Yamshchikov et al. | Feb 2016 | B2 |
| 9283287 | Bancel et al. | Mar 2016 | B2 |
| 9303079 | Bancel et al. | Apr 2016 | B2 |
| 9464124 | Bancel et al. | Oct 2016 | B2 |
| 9512456 | Wang et al. | Dec 2016 | B2 |
| 9533047 | de Fougerolles et al. | Jan 2017 | B2 |
| 9572896 | Bancel et al. | Feb 2017 | B2 |
| 9597380 | Chakraborty et al. | Mar 2017 | B2 |
| 9669089 | Thess et al. | Jun 2017 | B2 |
| 9675668 | Bancel et al. | Jun 2017 | B2 |
| 9868691 | Benenato et al. | Jan 2018 | B2 |
| 9868692 | Benenato et al. | Jan 2018 | B2 |
| 9872900 | Ciaramella et al. | Jan 2018 | B2 |
| 9950068 | de Fougerolles et al. | Apr 2018 | B2 |
| 10022435 | Ciaramella et al. | Jul 2018 | B2 |
| 10023626 | Bolen et al. | Jul 2018 | B2 |
| 10064934 | Ciaramella et al. | Sep 2018 | B2 |
| 10064935 | Ciaramella et al. | Sep 2018 | B2 |
| 10124055 | Ciaramella et al. | Nov 2018 | B2 |
| 10207010 | Besin et al. | Feb 2019 | B2 |
| 10232055 | Kariko et al. | Mar 2019 | B2 |
| 10273269 | Ciaramella | Apr 2019 | B2 |
| 10286086 | Roy et al. | May 2019 | B2 |
| 10323076 | Ellsworth et al. | Jun 2019 | B2 |
| 10385088 | Fraley et al. | Aug 2019 | B2 |
| 10442756 | Benenato et al. | Oct 2019 | B2 |
| 10449244 | Ciaramella et al. | Oct 2019 | B2 |
| 10465190 | Chen et al. | Nov 2019 | B1 |
| 10493143 | Ciaramella et al. | Dec 2019 | B2 |
| 10526629 | Rabideau et al. | Jan 2020 | B2 |
| 10653712 | Hoge | May 2020 | B2 |
| 10653767 | Ciaramella et al. | May 2020 | B2 |
| 10695419 | Ciaramella et al. | Jun 2020 | B2 |
| 10709779 | Ciaramella et al. | Jul 2020 | B2 |
| 10857105 | Benenato et al. | Dec 2020 | B2 |
| 10898574 | de Fougerolles et al. | Jan 2021 | B2 |
| 10925958 | Ciaramella | Feb 2021 | B2 |
| 11027025 | Hoge et al. | Jun 2021 | B2 |
| 11045540 | Ciaramella | Jun 2021 | B2 |
| 11103578 | Ciaramella et al. | Aug 2021 | B2 |
| 11351242 | Lori et al. | Jun 2022 | B1 |
| 11384352 | Miracco | Jul 2022 | B2 |
| 11406703 | Kramarczyk et al. | Aug 2022 | B2 |
| 11464848 | Ciaramella et al. | Oct 2022 | B2 |
| 11485960 | Dousis et al. | Nov 2022 | B2 |
| 11497807 | Ciaramella et al. | Nov 2022 | B2 |
| 11564893 | Smith | Jan 2023 | B2 |
| 11576961 | Ciaramella et al. | Feb 2023 | B2 |
| 11643441 | Ciaramella et al. | May 2023 | B1 |
| 11696946 | Ciaramella | Jul 2023 | B2 |
| 20010001066 | Cezayirli et al. | May 2001 | A1 |
| 20020147167 | Armstrong et al. | Oct 2002 | A1 |
| 20030032615 | Felgner et al. | Feb 2003 | A1 |
| 20030050468 | Shiver et al. | Mar 2003 | A1 |
| 20030092653 | Kisich et al. | May 2003 | A1 |
| 20040005667 | Ratti et al. | Jan 2004 | A1 |
| 20040132683 | Felgner et al. | Jul 2004 | A1 |
| 20050032730 | Von Der Mulbe et al. | Feb 2005 | A1 |
| 20050059624 | Hoerr et al. | Mar 2005 | A1 |
| 20050170508 | Huang et al. | Aug 2005 | A1 |
| 20050250723 | Hoerr et al. | Nov 2005 | A1 |
| 20060172003 | Meers et al. | Aug 2006 | A1 |
| 20060172966 | Lipford et al. | Aug 2006 | A1 |
| 20070280929 | Hoerr et al. | Dec 2007 | A1 |
| 20070292453 | Floyd et al. | Dec 2007 | A1 |
| 20080025944 | Hoerr et al. | Jan 2008 | A1 |
| 20080171079 | Hanon et al. | Jul 2008 | A1 |
| 20080171711 | Hoerr et al. | Jul 2008 | A1 |
| 20090098162 | Freiman et al. | Apr 2009 | A1 |
| 20090148467 | Friedman et al. | Jun 2009 | A1 |
| 20090305324 | Kuzushima et al. | Dec 2009 | A1 |
| 20100112042 | Polisky et al. | May 2010 | A1 |
| 20100130588 | Yaworski et al. | May 2010 | A1 |
| 20100189729 | Hoerr et al. | Jul 2010 | A1 |
| 20100203076 | Fotin-Mleczek et al. | Aug 2010 | A1 |
| 20100239608 | Von Der Mulbe et al. | Sep 2010 | A1 |
| 20100249208 | Hecker et al. | Sep 2010 | A1 |
| 20100291156 | Barner et al. | Nov 2010 | A1 |
| 20100303851 | Hoerr et al. | Dec 2010 | A1 |
| 20100305196 | Probst et al. | Dec 2010 | A1 |
| 20100330122 | Smith et al. | Dec 2010 | A1 |
| 20110117125 | Hope et al. | May 2011 | A1 |
| 20110250225 | Fotin-Mleczek et al. | Oct 2011 | A1 |
| 20110269950 | Von Der Mulbe et al. | Nov 2011 | A1 |
| 20110311472 | Hoerr et al. | Dec 2011 | A1 |
| 20120009221 | Hoerr et al. | Jan 2012 | A1 |
| 20120101148 | Aking et al. | Apr 2012 | A1 |
| 20120189700 | Aguilar et al. | Jul 2012 | A1 |
| 20120219573 | Baumhof et al. | Aug 2012 | A1 |
| 20120232133 | Balazs et al. | Sep 2012 | A1 |
| 20120258046 | Mutske | Oct 2012 | A1 |
| 20120328655 | Dubensky et al. | Dec 2012 | A1 |
| 20130022538 | Rossi | Jan 2013 | A1 |
| 20130028925 | Friedman et al. | Jan 2013 | A1 |
| 20130102034 | Schrum et al. | Apr 2013 | A1 |
| 20130121988 | Hoerr et al. | May 2013 | A1 |
| 20130142818 | Baumhof et al. | Jun 2013 | A1 |
| 20130156849 | De Fougerolles et al. | Jun 2013 | A1 |
| 20130171234 | Fairman et al. | Jul 2013 | A1 |
| 20130171241 | Geall | Jul 2013 | A1 |
| 20130183355 | Jain et al. | Jul 2013 | A1 |
| 20130189351 | Geall | Jul 2013 | A1 |
| 20130195867 | Hoerr et al. | Aug 2013 | A1 |
| 20130195967 | Guild et al. | Aug 2013 | A1 |
| 20130195968 | Geall et al. | Aug 2013 | A1 |
| 20130195969 | Geall et al. | Aug 2013 | A1 |
| 20130202684 | Geall et al. | Aug 2013 | A1 |
| 20130209454 | Diskin et al. | Aug 2013 | A1 |
| 20130236533 | Von Andrian et al. | Sep 2013 | A1 |
| 20130236974 | De Fougerolles | Sep 2013 | A1 |
| 20130243848 | Lobovkina et al. | Sep 2013 | A1 |
| 20130245103 | de Fougerolles et al. | Sep 2013 | A1 |
| 20130245107 | de Fougerolles et al. | Sep 2013 | A1 |
| 20130259923 | Bancel et al. | Oct 2013 | A1 |
| 20130266640 | De Fougerolles et al. | Oct 2013 | A1 |
| 20130295043 | Kallen et al. | Nov 2013 | A1 |
| 20130336998 | Kallen et al. | Dec 2013 | A1 |
| 20140037660 | Folin-Mleczek et al. | Feb 2014 | A1 |
| 20140065228 | Yarowoski et al. | Mar 2014 | A1 |
| 20140127247 | Dubensky et al. | May 2014 | A1 |
| 20140134201 | Tureci et al. | May 2014 | A1 |
| 20140147432 | Bancel et al. | May 2014 | A1 |
| 20140148502 | Bancel et al. | May 2014 | A1 |
| 20140193482 | Bancel et al. | Jul 2014 | A1 |
| 20140206752 | Afeyan et al. | Jul 2014 | A1 |
| 20140206753 | Guild et al. | Jul 2014 | A1 |
| 20140271829 | Lilja et al. | Sep 2014 | A1 |
| 20140308304 | Manoharan et al. | Oct 2014 | A1 |
| 20140378538 | Bancel | Dec 2014 | A1 |
| 20150051268 | Bancel et al. | Feb 2015 | A1 |
| 20150056253 | Bancel et al. | Feb 2015 | A1 |
| 20150064242 | Heyes et al. | Mar 2015 | A1 |
| 20150118183 | Baumhof et al. | Apr 2015 | A1 |
| 20150141499 | Bancel et al. | May 2015 | A1 |
| 20150307542 | Roy et al. | Oct 2015 | A1 |
| 20150315541 | Bancel et al. | Nov 2015 | A1 |
| 20150376115 | Ansell et al. | Dec 2015 | A1 |
| 20160024140 | Issa et al. | Jan 2016 | A1 |
| 20160024141 | Issa et al. | Jan 2016 | A1 |
| 20160151284 | Heyes et al. | Jan 2016 | A1 |
| 20160032273 | Shahrokh et al. | Feb 2016 | A1 |
| 20160038612 | Hoge et al. | Feb 2016 | A1 |
| 20160130308 | Weiner et al. | May 2016 | A1 |
| 20160194368 | Hoge et al. | Jul 2016 | A1 |
| 20160243221 | Hoge et al. | Aug 2016 | A1 |
| 20160271272 | Bancel et al. | Sep 2016 | A1 |
| 20160303224 | Kanekiyo et al. | Oct 2016 | A1 |
| 20160317647 | Ciaramella et al. | Nov 2016 | A1 |
| 20160331828 | Ciaramella et al. | Nov 2016 | A1 |
| 20160367658 | Kinney et al. | Dec 2016 | A1 |
| 20170043037 | Kariko et al. | Feb 2017 | A1 |
| 20170065675 | Bancel et al. | Mar 2017 | A1 |
| 20170202979 | Chakraborty et al. | Jul 2017 | A1 |
| 20170204152 | Nelson et al. | Jul 2017 | A1 |
| 20170210698 | Benenato et al. | Jul 2017 | A1 |
| 20170239371 | Guild et al. | Aug 2017 | A1 |
| 20170130255 | Wang et al. | Oct 2017 | A1 |
| 20170340724 | Ciaramella et al. | Nov 2017 | A1 |
| 20170340725 | Ciaramella et al. | Nov 2017 | A1 |
| 20180000953 | Almarsson et al. | Jan 2018 | A1 |
| 20180002393 | Bancel et al. | Jan 2018 | A1 |
| 20180008700 | Heineman et al. | Jan 2018 | A1 |
| 20180028645 | Ciaramella et al. | Feb 2018 | A1 |
| 20180028664 | Besin et al. | Feb 2018 | A1 |
| 20180078634 | Ogembo et al. | Mar 2018 | A1 |
| 20180147298 | Besin et al. | May 2018 | A1 |
| 20180214537 | Mutzke et al. | Aug 2018 | A1 |
| 20180237849 | Thompson | Aug 2018 | A1 |
| 20180243225 | Ciaramella | Aug 2018 | A1 |
| 20180243230 | Smith | Aug 2018 | A1 |
| 20180256628 | Hoge et al. | Sep 2018 | A1 |
| 20180271795 | Martini et al. | Sep 2018 | A1 |
| 20180271970 | Ciaramella et al. | Sep 2018 | A1 |
| 20180273977 | Mousavi et al. | Sep 2018 | A1 |
| 20180274009 | Marquardt et al. | Sep 2018 | A1 |
| 20180280496 | Ciaramella et al. | Oct 2018 | A1 |
| 20180289792 | Ciaramella et al. | Oct 2018 | A1 |
| 20180296663 | Hipp et al. | Oct 2018 | A1 |
| 20180303925 | Weissman et al. | Oct 2018 | A1 |
| 20180303929 | Ciaramella et al. | Oct 2018 | A1 |
| 20180311336 | Ciaramella et al. | Nov 2018 | A1 |
| 20180311343 | Huang et al. | Nov 2018 | A1 |
| 20180312549 | Ciaramella | Nov 2018 | A1 |
| 20180318409 | Valiante et al. | Nov 2018 | A1 |
| 20180363019 | Hoge | Dec 2018 | A1 |
| 20180369374 | Frederick et al. | Dec 2018 | A1 |
| 20180371047 | Ticho et al. | Dec 2018 | A1 |
| 20190002890 | Martini et al. | Jan 2019 | A1 |
| 20190008938 | Ciaramella et al. | Jan 2019 | A1 |
| 20190008948 | Ciaramella et al. | Jan 2019 | A1 |
| 20190015501 | Ciaramella et al. | Jan 2019 | A1 |
| 20190085368 | Bancel et al. | Mar 2019 | A1 |
| 20190099481 | Ciaramella et al. | Apr 2019 | A1 |
| 20190125839 | Frederick et al. | May 2019 | A1 |
| 20190167811 | Benenato et al. | Jun 2019 | A1 |
| 20190175517 | Martini et al. | Jun 2019 | A1 |
| 20190175727 | Huang et al. | Jun 2019 | A1 |
| 20190192646 | Cohen et al. | Jun 2019 | A1 |
| 20190192653 | Hoge et al. | Jun 2019 | A1 |
| 20190274968 | Weissman et al. | Sep 2019 | A1 |
| 20190275170 | Benenato et al. | Sep 2019 | A1 |
| 20190298657 | Martini et al. | Oct 2019 | A1 |
| 20190298658 | Benenato | Oct 2019 | A1 |
| 20190300906 | Martini et al. | Oct 2019 | A1 |
| 20190314292 | Benenato et al. | Oct 2019 | A1 |
| 20190314493 | Ciaramella et al. | Oct 2019 | A1 |
| 20190336452 | Brader | Nov 2019 | A1 |
| 20190336595 | Ciaramella | Nov 2019 | A1 |
| 20190351040 | Valiante et al. | Nov 2019 | A1 |
| 20190367561 | Cui et al. | Dec 2019 | A1 |
| 20190382774 | Hoge et al. | Dec 2019 | A1 |
| 20190390181 | Benenato et al. | Dec 2019 | A1 |
| 20200030432 | Ciaramella et al. | Jan 2020 | A1 |
| 20200032274 | Mauger et al. | Jan 2020 | A1 |
| 20200038499 | Narayanan et al. | Feb 2020 | A1 |
| 20200054737 | Ciaramella et al. | Feb 2020 | A1 |
| 20200069599 | Smith et al. | Mar 2020 | A1 |
| 20200069793 | Ciaramella | Mar 2020 | A1 |
| 20200069794 | Ciaramella et al. | Mar 2020 | A1 |
| 20200071689 | Miracco | Mar 2020 | A1 |
| 20200085916 | Martini et al. | Mar 2020 | A1 |
| 20200109420 | Brito et al. | Apr 2020 | A1 |
| 20200129445 | Patel et al. | Apr 2020 | A1 |
| 20200129608 | Ciaramella et al. | Apr 2020 | A1 |
| 20200129615 | Ciaramella et al. | Apr 2020 | A1 |
| 20200163878 | Baumhof et al. | May 2020 | A1 |
| 20200164059 | Mcguire et al. | May 2020 | A1 |
| 20200172928 | Yao | Jun 2020 | A1 |
| 20200239869 | Issa et al. | Jul 2020 | A1 |
| 20200254086 | Hoge et al. | Aug 2020 | A1 |
| 20200276295 | Ogembo et al. | Sep 2020 | A1 |
| 20200282047 | Ciaramella et al. | Sep 2020 | A1 |
| 20200306191 | Schariter et al. | Oct 2020 | A1 |
| 20200338004 | Hansson et al. | Oct 2020 | A1 |
| 20200338190 | Ciaramella et al. | Oct 2020 | A1 |
| 20200368162 | Martini | Nov 2020 | A1 |
| 20210046173 | Ciaramella et al. | Feb 2021 | A1 |
| 20210087135 | Benenato et al. | Mar 2021 | A1 |
| 20210163919 | Issa et al. | Jun 2021 | A1 |
| 20210187097 | Ciaramella et al. | Jun 2021 | A1 |
| 20210206818 | Huang et al. | Jul 2021 | A1 |
| 20210217484 | Giessel et al. | Jul 2021 | A1 |
| 20210228707 | Mektar et al. | Jul 2021 | A1 |
| 20210268086 | Zhong et al. | Sep 2021 | A1 |
| 20210309976 | Dousis et al. | Oct 2021 | A1 |
| 20210378980 | Horhota et al. | Dec 2021 | A1 |
| 20220031631 | Almarsson et al. | Feb 2022 | A1 |
| 20220047518 | Hennessy et al. | Feb 2022 | A1 |
| 20220054653 | Martini et al. | Feb 2022 | A1 |
| 20220062175 | Smith et al. | Mar 2022 | A1 |
| 20220062408 | Kramarczyk et al. | Mar 2022 | A1 |
| 20220125899 | Ashburn et al. | Apr 2022 | A1 |
| 20220145381 | Elich et al. | May 2022 | A1 |
| 20220236253 | Hopson | Jul 2022 | A1 |
| 20220241399 | Lusso et al. | Aug 2022 | A1 |
| 20220347292 | Panther et al. | Nov 2022 | A1 |
| 20220348900 | Shamashkin et al. | Nov 2022 | A1 |
| 20220349006 | Amato et al. | Nov 2022 | A1 |
| 20230000970 | Nachbagauer et al. | Jan 2023 | A1 |
| 20230142529 | White et al. | May 2023 | A1 |
| 20230181481 | White et al. | Jun 2023 | A1 |
| 20230190761 | Brader et al. | Jun 2023 | A1 |
| 20230212645 | Marquardt et al. | Jul 2023 | A1 |
| Number | Date | Country |
|---|---|---|
| 652831 | Sep 1994 | AU |
| 2015210364 | Mar 2017 | AU |
| 2473135 | Jun 2003 | CA |
| 10 2004 035227 | Feb 2006 | DE |
| 0969862 | Jan 2000 | EP |
| 1083232 | Feb 2005 | EP |
| 1301614 | Nov 2006 | EP |
| 1383556 | Oct 2007 | EP |
| 1905844 | Feb 2008 | EP |
| 1026253 | Dec 2012 | EP |
| 2188379 | Jan 2013 | EP |
| 2548960 | Jan 2013 | EP |
| WO 1987005326 | Sep 1987 | WO |
| WO 1990011092 | Oct 1990 | WO |
| WO 1991007425 | May 1991 | WO |
| WO 1992019752 | Nov 1992 | WO |
| WO 1993014778 | Aug 1993 | WO |
| WO 1993015749 | Aug 1993 | WO |
| WO 1995027069 | Mar 1995 | WO |
| WO 1995024485 | Sep 1995 | WO |
| WO 1995026204 | Oct 1995 | WO |
| WO 1995033835 | Dec 1995 | WO |
| WO 199748370 | Dec 1997 | WO |
| WO 1998020016 | May 1998 | WO |
| WO 199834640 | Aug 1998 | WO |
| WO 199847913 | Oct 1998 | WO |
| WO 1999033982 | Jul 1999 | WO |
| WO 1999052503 | Oct 1999 | WO |
| WO 2000029561 | May 2000 | WO |
| WO 2000063364 | Oct 2000 | WO |
| WO 2001021810 | Mar 2001 | WO |
| WO 2001093836 | Dec 2001 | WO |
| WO 2004058166 | Jul 2004 | WO |
| WO 2004076645 | Sep 2004 | WO |
| WO 2005007689 | Jan 2005 | WO |
| WO 2005009346 | Feb 2005 | WO |
| WO 2005034992 | Apr 2005 | WO |
| WO 2005120152 | Dec 2005 | WO |
| WO 2006020071 | Feb 2006 | WO |
| WO 2006056027 | Jun 2006 | WO |
| WO 2006071903 | Jul 2006 | WO |
| WO 2006095259 | Sep 2006 | WO |
| WO 2007095976 | Aug 2007 | WO |
| WO 2008011609 | Jan 2008 | WO |
| WO 2008014979 | Feb 2008 | WO |
| WO 2008052770 | May 2008 | WO |
| WO 2008083949 | Jul 2008 | WO |
| WO 2009030254 | Mar 2009 | WO |
| WO 2009030481 | Mar 2009 | WO |
| WO 2009095226 | Aug 2009 | WO |
| WO 2009127230 | Oct 2009 | WO |
| WO 2010037408 | Apr 2010 | WO |
| WO 2010037539 | Apr 2010 | WO |
| WO 2010042877 | Apr 2010 | WO |
| WO 2010054406 | May 2010 | WO |
| WO 2010088927 | Aug 2010 | WO |
| WO 2010115046 | Oct 2010 | WO |
| WO 2011005799 | Jan 2011 | WO |
| WO 2011106607 | Feb 2011 | WO |
| WO 2011026641 | Mar 2011 | WO |
| WO 2011068810 | Jun 2011 | WO |
| WO 2011069529 | Jun 2011 | WO |
| WO 2011069586 | Jun 2011 | WO |
| WO 2012024629 | Aug 2011 | WO |
| WO 2011144358 | Nov 2011 | WO |
| WO 2018232357 | Dec 2011 | WO |
| WO 2012006369 | Jan 2012 | WO |
| WO 2012006376 | Jan 2012 | WO |
| WO 2012006380 | Jan 2012 | WO |
| WO 2012019630 | Feb 2012 | WO |
| WO 2012019780 | Feb 2012 | WO |
| WO 2012030904 | Mar 2012 | WO |
| WO 2012051211 | Apr 2012 | WO |
| WO 2012075040 | Jun 2012 | WO |
| WO 2012089225 | Jul 2012 | WO |
| WO 2012106377 | Aug 2012 | WO |
| WO 2012113513 | Aug 2012 | WO |
| WO 2012116714 | Sep 2012 | WO |
| WO 2012116715 | Sep 2012 | WO |
| WO 2012116810 | Sep 2012 | WO |
| WO 2012116811 | Sep 2012 | WO |
| WO 2012149376 | Nov 2012 | WO |
| WO 2013006825 | Jan 2013 | WO |
| WO 2013006834 | Jan 2013 | WO |
| WO 2013006837 | Jan 2013 | WO |
| WO 2013006838 | Jan 2013 | WO |
| WO 2013006842 | Jan 2013 | WO |
| WO 2013019669 | Feb 2013 | WO |
| WO 2013030778 | Mar 2013 | WO |
| WO 2013052167 | Apr 2013 | WO |
| WO 2013055905 | Apr 2013 | WO |
| WO 2013056132 | Apr 2013 | WO |
| WO 2013059496 | Apr 2013 | WO |
| WO 2013074696 | May 2013 | WO |
| WO 2013086373 | Jun 2013 | WO |
| WO 2013090186 | Jun 2013 | WO |
| WO 2013090648 | Jun 2013 | WO |
| WO 2013102203 | Jul 2013 | WO |
| WO 2013109604 | Jul 2013 | WO |
| WO 2013112778 | Aug 2013 | WO |
| WO 2013113502 | Aug 2013 | WO |
| WO 2013120497 | Aug 2013 | WO |
| WO 2013120628 | Aug 2013 | WO |
| WO 2013120629 | Aug 2013 | WO |
| WO 2013143555 | Oct 2013 | WO |
| WO 2013174409 | Nov 2013 | WO |
| WO 2013185069 | Dec 2013 | WO |
| WO 2014039185 | Mar 2014 | WO |
| WO 2014063059 | Apr 2014 | WO |
| WO 2014071963 | May 2014 | WO |
| WO 2014072061 | May 2014 | WO |
| WO 2014089239 | Jun 2014 | WO |
| WO 2014089486 | Jun 2014 | WO |
| WO 2014093924 | Jun 2014 | WO |
| WO 2014127917 | Aug 2014 | WO |
| WO 2014136086 | Sep 2014 | WO |
| WO 2014144196 | Sep 2014 | WO |
| WO 2014152027 | Sep 2014 | WO |
| WO 2014152774 | Sep 2014 | WO |
| WO 2014152940 | Sep 2014 | WO |
| WO 2014159813 | Oct 2014 | WO |
| WO 2014160243 | Oct 2014 | WO |
| WO 2015005253 | Jan 2015 | WO |
| WO 2015013551 | Jan 2015 | WO |
| WO 2015024667 | Feb 2015 | WO |
| WO 2015024668 | Feb 2015 | WO |
| WO 2015054639 | Apr 2015 | WO |
| WO 2015164674 | Apr 2015 | WO |
| WO 2015110659 | Jul 2015 | WO |
| WO 2015130584 | Sep 2015 | WO |
| WO 2015134332 | Sep 2015 | WO |
| WO 2015143193 | Sep 2015 | WO |
| WO 2015189425 | Dec 2015 | WO |
| WO 2015199952 | Dec 2015 | WO |
| WO 2016044023 | Mar 2016 | WO |
| WO 2016057912 | Apr 2016 | WO |
| WO 2016092460 | Jun 2016 | WO |
| WO 2016116904 | Jul 2016 | WO |
| WO 2016149384 | Sep 2016 | WO |
| WO 2016164762 | Oct 2016 | WO |
| WO 2016176330 | Nov 2016 | WO |
| WO 2016184822 | Nov 2016 | WO |
| WO 2016201377 | Dec 2016 | WO |
| WO 2016203025 | Dec 2016 | WO |
| WO 2017011773 | Jan 2017 | WO |
| WO 2017015457 | Jan 2017 | WO |
| WO 2017015463 | Jan 2017 | WO |
| WO 2017019935 | Feb 2017 | WO |
| WO 2017020026 | Feb 2017 | WO |
| WO 2017021546 | Feb 2017 | WO |
| WO 2017031232 | Feb 2017 | WO |
| WO 2017031241 | Feb 2017 | WO |
| WO 2017049245 | Mar 2017 | WO |
| WO 2017062513 | Apr 2017 | WO |
| WO 2017066789 | Apr 2017 | WO |
| WO 2017070601 | Apr 2017 | WO |
| WO 2017070616 | Apr 2017 | WO |
| WO 2017070618 | Apr 2017 | WO |
| WO 2017070620 | Apr 2017 | WO |
| WO 2017070622 | Apr 2017 | WO |
| WO 2017070623 | Apr 2017 | WO |
| WO 2017070624 | Apr 2017 | WO |
| WO 2017075531 | May 2017 | WO |
| WO 2017109222 | Jun 2017 | WO |
| WO 2017112865 | Jun 2017 | WO |
| WO 2017127750 | Jul 2017 | WO |
| WO 2017140905 | Aug 2017 | WO |
| WO 2017147458 | Aug 2017 | WO |
| WO 2017162265 | Sep 2017 | WO |
| WO 2017165317 | Sep 2017 | WO |
| WO 2017201333 | Nov 2017 | WO |
| WO 2017201340 | Nov 2017 | WO |
| WO 2017201342 | Nov 2017 | WO |
| WO 2017201347 | Nov 2017 | WO |
| WO 2017201349 | Nov 2017 | WO |
| WO 2017208191 | Dec 2017 | WO |
| WO 2017210215 | Dec 2017 | WO |
| WO 2017210364 | Dec 2017 | WO |
| WO 2016091391 | Feb 2018 | WO |
| WO 2018020271 | Feb 2018 | WO |
| WO 2018052549 | Mar 2018 | WO |
| WO 2018053209 | Mar 2018 | WO |
| WO 2018075980 | Apr 2018 | WO |
| WO 2018078053 | May 2018 | WO |
| WO 2018081459 | May 2018 | WO |
| WO 2018081462 | May 2018 | WO |
| WO 2018081638 | May 2018 | WO |
| WO 2018089851 | May 2018 | WO |
| WO 2018091540 | May 2018 | WO |
| WO 2018107088 | Jun 2018 | WO |
| WO 2018111967 | Jun 2018 | WO |
| WO 2018132537 | Jul 2018 | WO |
| WO 2018140733 | Aug 2018 | WO |
| WO 2018144082 | Aug 2018 | WO |
| WO 2018144778 | Aug 2018 | WO |
| WO 2018151816 | Aug 2018 | WO |
| WO 2018157009 | Aug 2018 | WO |
| WO 2018170245 | Sep 2018 | WO |
| WO 2018170256 | Sep 2018 | WO |
| WO 2018170260 | Sep 2018 | WO |
| WO 2018170270 | Sep 2018 | WO |
| WO 2018170347 | Sep 2018 | WO |
| WO 2018175783 | Sep 2018 | WO |
| WO 2018187590 | Oct 2018 | WO |
| WO 2018200737 | Nov 2018 | WO |
| WO 2018232355 | Dec 2018 | WO |
| WO 2019036670 | Feb 2019 | WO |
| WO 2019036682 | Feb 2019 | WO |
| WO 2019036683 | Feb 2019 | WO |
| WO 2019036685 | Feb 2019 | WO |
| WO 2019055807 | Mar 2019 | WO |
| WO 2019055887 | Mar 2019 | WO |
| WO 2019103993 | May 2019 | WO |
| WO 2019148101 | Aug 2019 | WO |
| WO 2019195314 | Oct 2019 | WO |
| WO 2020006242 | Jan 2020 | WO |
| WO 2020056370 | Mar 2020 | WO |
| WO 2020061284 | Mar 2020 | WO |
| WO 2020061295 | Mar 2020 | WO |
| WO 2020061367 | Mar 2020 | WO |
| WO 2020097291 | May 2020 | WO |
| WO 2020172239 | Aug 2020 | WO |
| WO 2020185811 | Sep 2020 | WO |
| WO 2020190750 | Sep 2020 | WO |
| WO 2020243561 | Dec 2020 | WO |
| WO 2021030533 | Feb 2021 | WO |
| WO 2021050864 | Mar 2021 | WO |
| WO 2021055811 | Mar 2021 | WO |
| WO 2021155243 | Aug 2021 | WO |
| WO 2021155274 | Aug 2021 | WO |
| WO 2021159040 | Aug 2021 | WO |
| WO 2021159130 | Aug 2021 | WO |
| WO 2021211343 | Oct 2021 | WO |
| WO 2021222304 | Nov 2021 | WO |
| WO 2021231929 | Nov 2021 | WO |
| WO 2021231963 | Nov 2021 | WO |
| WO 2021237084 | Nov 2021 | WO |
| WO 2021247817 | Dec 2021 | WO |
| WO 2022032154 | Feb 2022 | WO |
| WO 2022067010 | Mar 2022 | WO |
| WO 2022150717 | Jul 2022 | WO |
| WO 2022155524 | Jul 2022 | WO |
| WO 2022155530 | Jul 2022 | WO |
| WO 2022187698 | Sep 2022 | WO |
| WO 2022204491 | Sep 2022 | WO |
| WO 2022212191 | Oct 2022 | WO |
| WO 2022212442 | Oct 2022 | WO |
| WO 2022212711 | Oct 2022 | WO |
| WO 2022221335 | Oct 2022 | WO |
| WO 2022221336 | Oct 2022 | WO |
| WO 2022221359 | Oct 2022 | WO |
| WO 2022221440 | Oct 2022 | WO |
| WO 2022232585 | Nov 2022 | WO |
| WO 2022241103 | Nov 2022 | WO |
| WO 2022266010 | Dec 2022 | WO |
| WO 2022266012 | Dec 2022 | WO |
| WO 2022266389 | Dec 2022 | WO |
| WO 2023283642 | Jan 2023 | WO |
| WO 2023283645 | Jan 2023 | WO |
| WO 2023283651 | Jan 2023 | WO |
| WO 2023014649 | Feb 2023 | WO |
| WO 2023018773 | Feb 2023 | WO |
| WO 2023018923 | Feb 2023 | WO |
| WO 2023019181 | Feb 2023 | WO |
| WO 2023092069 | May 2023 | WO |
| WO 2023107999 | Jun 2023 | WO |
| WO 2023114307 | Jun 2023 | WO |
| WO 2023132885 | Jul 2023 | WO |
| WO 2023137149 | Jul 2023 | WO |
| Entry |
|---|
| International Search Report and Written Opinion for Application No. PCT/US2020/022710, mailed Jun. 3, 2020. |
| [No Author Listed], “Messenger RNA”, Internet: Wikipedia. Jun. 19, 2013, XP002699196, Retrieved from the Internet: URL: http://en.wikipedia.org/wiki/Messenger RNA. |
| Adamiak, et al. glycoprotein E [Human alphaherpesvirus 2]. GenBank: ABU45436.1. Pub. Nov. 29, 2007. 1 page. |
| Ajbani et al., Immunogenicity of Semliki Forest Virus Based Self-Amplifying RNA Expressing Indian HIV-1C Genes in Mice. Int J Biol Macromol. Nov. 2015;81:794-802. doi: 10.1016/j.ijbiomac.2015.09.010. Epub Sep. 8, 2015. |
| Alconada et al., A tyrosine-based motif and a casein kinase II phosphorylation site regulate the intracellular trafficking of the varicella-zoster virus glycoprotein I, a protein localized in the trans-Golgi network. EMBO J. Nov. 15, 1996;15(22):6096-110. |
| Anderson et al., Incorporation of pseudouridine into mRNA enhances translation by diminishing PKR activation, Nucleic Acids Res. Sep. 2010;38(17):5884-92. doi: 10.1093/nar/gkq347. Epub May 10, 2010. |
| Anderson et al., Stability of mRNA/cationic lipid lipoplexes in human and rat cerebrospinal fluid: methods and evidence for nonviral mRNA gene delivery to the central nervous system. Hum Gene Ther. Feb. 10, 2003;14(3):191-202. |
| Archer, Induction of a T-cell specific antigen on bone marrow lymphocytes with thymus RNA. Immunology. Jan. 1978;34(1):123-9. |
| Ashley et al., Bone marrow-generated dendritic cells pulsed with tumor extracts or tumor RNA induce antitumor immunity against central nervous system tumors. J Exp Med. Oct. 6, 1997; 186(7): 1177-82. |
| Awasthi et al., Nucleoside-modified mRNA encoding HSV-2 glycoproteins C, D, and E prevents clinical and subclinical genital herpes. Sci Immunol. Sep. 20, 2019;4(39):eaaw7083. |
| Awasthi et al., A paradigm shift: vaccine-induced antibodies as an immune correlate of protection against herpes simplex virus type 1 genital herpes. J Infect Dis. Mar. 2014;209(6):813-5. doi: 10.1093/infdis/jit658. Epub Nov. 27, 2013. |
| Awasthi et al., An HSV-2 Trivalent Vaccine Is Immunogenic in Rhesus Macaques and Highly Efficacious in Guinea Pigs. PLoS Pathog. Jan. 19, 2017;13(1):e1006141. doi: 10.1371/journal.ppat.1006141. eCollection Jan. 2017. |
| Awasthi et al., Immunization With a Vaccine Combining Herpes Simplex Virus 2 (HSV-2) Glycoprotein C (gC) and gD Subunits Improves the Protection of Dorsal Root Ganglia in Mice and Reduces the Frequency of Recurrent Vaginal Shedding of HSV-2 DNA in Guinea Pigs Compared to Immunization With gD Alone. J Virol . Oct. 2011;85(20):10472-86. doi: 10.1128/JVI.00849-11. Epub Aug. 3, 2011. |
| Azarkh et al. Synthesis and decay of varicella zoster virus transcripts. J Neurovirol. Jun. 2011;17(3):281-7. doi: 10.1007/s13365-011-0029-2. Epub Apr. 1, 20112. |
| Bahl et al., Preclinical and Clinical Demonstration of Immunogenicity by mRNA Vaccines against H10N8 and H7N9 Influenza Viruses. Mol Ther. Jun. 7, 2017;25(6):1316-1327. doi: 10.1016/j.ymthe.2017.03.035. Epub Apr. 27, 2017. |
| Balazs et al., Vectored immunoprophylaxis protects humanized mice from mucosal HIV transmission. Nat Med. Mar. 2014;20(3):296-300. doi: 10.1038/nm.3471. Epub Feb. 9, 2014. Author Manuscript, 17 pages. |
| Barouch et al., Therapeutic efficacy of potent neutralizing HIV-1-specific monoclonal antibodies in SHIV-infected rhesus monkeys. Nature. Nov. 14, 2013;503(7475):224-8. doi: 10.1038/nature12744. Epub Oct. 30, 2013. Author Manuscript, 24 pages. |
| Belliveau, N.M., et al., Microfluidic synthesis of highly potent limit-size lipid nanoparticles for in vivo delivery of siRNA. Mol Ther Nucleic Acids. Aug. 2012; 1(8): e37. |
| Bettinger et al., Peptide-mediated RNA delivery: a novel approach for enhanced transfection of primary and post-mitotic cells. Nucleic Acids Res. Sep. 15, 2001;29(18):3882-91. |
| Bogers et al., Potent immune responses in rhesus macaques induced by nonviral delivery of a self-amplifying RNA vaccine expressing HIV type 1 envelope with a cationic nanoemulsion. J Infect Dis. Mar. 15, 2015;211(6):947-55. doi: 10.1093/infdis/jiu522. Epub Sep. 18, 2014. |
| Bonehill et al., Single-step antigen loading and activation of dendritic cells by mRNA electroporation for the purpose of therapeutic vaccination in melanoma patients. Clin Cancer Res. May 2009; 15(10): 3366-3375. |
| Borza et al., Use of gHgL for attachment of Epstein-Barr virus to epithelial cells compromises infection. J Virol. May 2004;78(10):5007-14. doi: 10.1128/jvi.78.10.5007-5014.2004. |
| Bose et al., Influence of cationic lipid concentration on properties of lipid-polymer hybrid nanospheres for gene delivery. Int J Nanomedicine. Sep. 2, 2015;10:5367-82. doi: 10.2147/IJN.S87120. eCollection 2015. |
| Bowie et al., Deciphering the message in protein sequences: tolerance to amino acid substitutions. Science. Mar. 16, 1990;247(4948):1306-10. |
| Bridge et al., Heterologous prime-boost-boost immunisation of Chinese cynomolgus macaques using DNA and recombinant poxvirus vectors expressing HIV-1 virus-like particles. Virol J. Sep. 7, 2011;8:429. doi: 10.1186/1743-422X-8-429. |
| Brito et al., A cationic nanoemulsion for the delivery of next-generation RNA vaccines. Mol Ther. Dec. 2014;22(12):2118-29. doi: 10.1038/mt.2014.133. Epub Jul. 16, 2014. |
| Brito et al., Self-amplifying mRNA vaccines. Adv Genet. 2015;89:179-233. doi: 10.1016/bs.adgen.2014.10.005. Epub Dec. 4, 2014. |
| Burton et al., Efficient neutralization of primary isolates of HIV-1 by a recombinant human monoclonal antibody. Science. Nov. 11, 1994;266(5187):1024-7. doi: 10.1126/science.7973652. |
| Cairns et al., Patient-Specific Neutralizing Antibody Responses to Herpes Simplex Virus Are Attributed to Epitopes on gD, gB, or Both and Can Be Type Specific. J Virol. Sep. 2015;89(18):9213-31. doi: 10.1128/JVI.01213-15. Epub Jun. 24, 2015. |
| Chahal et al., An RNA nanoparticle vaccine against Zika virus elicits antibody and CD8+ T cell responses in a mouse model. Sci Rep. Mar. 21, 2017;7(1):252. doi: 10.1038/s41598-017-00193-w. |
| Chattopadhyay et al., A chimeric vesiculo/alphavirus is an effective alphavirus vaccine. J Virol. Jan. 2013;87(1):395-402. |
| Chen et al., Human monoclonal antibodies targeting the haemagglutinin glycoprotein can neutralize H7N9 influenza virus. Nat Commun. Mar. 30, 2015;6:6714. doi: 10.1038/ncomms7714. |
| Chen et al., Influence of Particle Size on the in Vivo Potency of Lipid Nanoparticle Formulations of siRNA. J Control Release. Aug. 10, 2016;235:236-244. doi: 10.1016/j.jconrel.2016.05.059. Epub May 26, 2016. |
| Cheng et al., Multifunctional triblock copolymers for intracellular messenger RNA delivery. Biomaterials. Oct. 2012; 33(28): 6868-6876. |
| Cohen et al., Vaccine Development for Epstein-Barr Virus.Adv Exp Med Biol. 2018;1045:477-493. doi: 10.1007/978-981-10-7230-7_22. |
| Cohen, Epstein-barr virus vaccines. Clin Transl Immunology. Jan. 23, 2015;4(1):e32. doi: 10.1038/cti.2014.27. eCollection Jan. 2015. |
| Conry et al., Characterization of a messenger RNA polynucleotide vaccine vector. Cancer Res. Apr. 1, 1995 ;55 (7):1397-1400. |
| Cross, Without these lipid shells, there would be no mRNA vaccines for COVID-19. Chem Eng News. Mar. 6, 2021; 99(8). 4 pages. |
| Cu et al., Enhanced Delivery and Potency of Self-Amplifying mRNA Vaccines by Electroporation in Situ, Vaccines, 2013, 1, 367-383. Abstract Only. |
| Cuchet et al., Characterization of anti proliferative and cytotoxic properties of the HSV-1 immediate-early ICPo protein. J Gene Med. Sep. 2005;7(9):1187-99. doi: 10.1002/jgm.761. |
| Cui et al., Rabbits immunized with Epstein-Barr virus gH/gL or gB recombinant proteins elicit higher serum virus neutralizing activity than gp350. Vaccine. Jul. 25, 2016;34(34):4050-5. doi: 10.1016/j.vaccine.2016.06.021. Epub Jun. 10, 2016. |
| Cullis et al., Lipid Nanoparticle Systems for Enabling Gene Therapies. Mol Ther. Jul. 5, 2017;25(7):1467-1475. doi: 10.1016/j.ymthe.2017.03.013. Epub Apr. 13, 2017. |
| Cunnigham, The herpes zoster subunit vaccine. Expert Opin Biol Ther. 2016;16(2):265-71. doi: 10.1517/14712598.2016.1134481. PMID: 26865048. |
| Dahlman et al., In vivo endothelial siRNA delivery using polymeric nanoparticles with low molecular weight. Nat Nanotechnol. Aug. 2014;9(8):648-655. doi: 10.1038/nnano.2014.84. Epub May 11, 2014. |
| Daubeuf et al., HSV ICP0 recruits USP7 to modulate TLR-mediated innate response. Blood. Apr. 2, 2009;113(14):3264-75. Epub Oct. 24, 2008. |
| Davison, envelope glycoprotein D [Human alphaherpesvirus 2]. NCBI Reference Sequence: YP 009137218.1. May 12, 2015. 3 pages. |
| De Jong et al., Drug delivery and nanoparticles:applications and hazards. Int J Nanomedicine. 2008;3(2):133-49. |
| De La Pena et al., Immunogenicity in Rabbits of HIV-1 SOSIP Trimers from Clades A, B, and C, Given Individually, Sequentially, or in Combination. J Virol. Mar. 28, 2018;92(8):e01957-17. doi: 10.1128/JVI.01957-17. Print Apr. 15, 2018. |
| De Lucca, FL et al., Effect of the calcium phosphate-mediated RNA uptake on the transfer of cellular immunity of a synthetic peptide of HIV-1 to human lymphocytes by exogenous RNA. Mol Cell Biochem. Dec. 2001;228(1-2):9-14. doi: 10.1023/a:1013305708539. |
| Deering et al., Nucleic acid vaccines: prospects for non-viral delivery of mRNA vaccines.Expert Opin Drug Deliv. Jun. 2014;11(6):885-99. doi: 10.1517/17425247.2014.901308. Epub Mar. 26, 2014. |
| Dicaro et al., In Vivo Delivery of Nucleic Acid-Formulated Microparticles as a Potential Tolerogenic Vaccine for Type 1 Diabetes. Rev Diabet Stud. 2012 Winter;9(4):348-56. |
| Diken et al., Current Developments in Actively Personalized Cancer Vaccination with a Focus on RNA as the Drug Format. Prog Tumor Res. 2015;42:44-54. doi: 10.1159/000437184. Epub Sep. 4, 2015. Review. |
| Dropulic et al., The challenge of developing a herpes simplex virus 2 vaccine. xpert Rev Vaccines. Dec. 2012; 11(12):1429-40. doi:10.1586/erv.12.129. |
| Durbin et al., RNAs Containing Modified Nucleotides Fail To Trigger RIG-I Conformational Changes for Innate Immune Signaling. mBio. Sep. 20, 2016;7(5):e00833-16. doi: 10.1128/mBio.00833-16. |
| Dutton et al., A novel DNA vaccine technology conveying protection against a lethal herpes simplex viral challenge in mice. PLoS One. Oct. 3, 2013;8(10):e76407. doi: 10.1371/journal.pone.0076407. eCollection 2013. |
| Egan et al., An HSV-2 nucleoside-modified mRNA genital herpes vaccine containing glycoproteins gC, gD, and gE protects mice against HSV-1 genital lesions and latent infection. PLoS Pathog. Jul. 27, 2020;16(7):e1008795. |
| Ernsting et al., Factors controlling the pharmacokinetics, biodistribution and intratumoral penetration of nanoparticles. J Control Release. Dec. 28, 2013;172(3):782-94. doi: 10.1016/j.jconrel.2013.09.013. Epub Sep. 25, 2013. |
| Escalante et al., A Pentavalent Epstein-Barr Virus-Like Particle Vaccine Elicits High Titers of Neutralizing Antibodies against Epstein-Barr Virus Infection in Immunized Rabbits. Vaccines (Basel). Apr. 6, 2020;8(2):169. doi: 10.3390/vaccines8020169. |
| Everett et al., Herpes simplex virus type 1 regulatory protein ICP0 aids infection in cells with a preinduced interferon response but does not impede interferon-induced gene induction. J Viral. May 2009;83(10):4978-83. doi: 10.1128/JV1.02595-08. Epub Mar. 4, 2009. |
| Ewert et al., Cationic liposome-nucleic acid complexes for gene delivery and silencing: pathways and mechanisms for plasmid DNA and siRNA. Top Curr Chem. 2010;296:191-226. |
| Fleeton et al., Self-replicative RNA vaccines elicit protection against influenza A virus, respiratory syncytial virus, and a tickborne encephalitis virus. J Infect Dis. May 1, 2001;183(9):1395-8. Epub Mar. 30, 2001. |
| Furuichi et al., Viral and cellular mRNA capping: past and prospects. Adv Virus Res. 2000;55:135-84. doi: 10.1016/s0065-3527(00)55003-9. |
| Furuichi, Caps on Eukaryotic mRNAs. eLS. John Wiley & Sons. Jul. 2014. 1-12. |
| Gaskell et al., Feline herpesvirus. Vet Res. Mar.-Apr. 2007;38(2):337-54. Epub Feb. 13, 2007. |
| Geall et al., Nonviral delivery of self-amplifying RNA vaccines. Proc Natl Acad Sci U S A. Sep. 4, 2012;109(36):14604-9. doi:10.1073/pnas. 1209367109. Epub Aug. 20, 2012. |
| Gilboa et al., Cancer immunotherapy with mRNA-transfected dendritic cells. Immunol Rev. Jun. 2004;199:251-63. |
| Gjetting et al., In vitro and in vivo effects of polyethylene glycol (PEG)-modified lipid in DOTAP/cholesterol-mediated gene transfection. Int J Nanomedicine. Aug. 9, 2010;5:371-83. |
| Gorander et al., Secreted portion of glycoprotein g of herpes simplex virus type 2 is a novel antigen for type-discriminating serology. J Clin Microbiol. Aug. 2003;41(8):3681-6. |
| Grabbe et al., Translating nanoparticulate-personalized cancer vaccines into clinical applications: case study with RNA-lipoplexes for the treatment of melanoma. Nanomedicine (Lond). Oct. 2016;11(20):2723-2734. |
| Gram et al., Immunological analysis of a Lactococcus lactis-based DNA vaccine expressing HIV gp120. Genet Vaccines Ther. Jan. 29, 2007;5:3. doi: 10.1186/1479-0556-5-3. |
| Gupta et al., TcVac3 induced control of Trypanosoma cruzi infection and chronic myocarditis in mice. PLoS One. 2013;8(3):e59434. doi: 10.1371/journal.pone.0059434. Epub Mar. 26, 2013. |
| Haas et al., Codon usage limitation in the expression of HIV-1 envelope glycoprotein. Curr Biol. Mar. 1, 1996;6(3):315-24. doi: 10.1016/s0960-9822(02)00482-7. |
| Haddad et al., Depletion of glycoprotein gp85 from virosomes made with Epstein-Barr virus proteins abolishes their ability to fuse with virus receptor-bearing cells. J Virol. Dec. 1989;63(12):4998-5005. doi: 10.1128/JVI.63.12.4998-5005.1989. |
| Hadinoto et al., Lipid-polymer Hybrid Nanoparticles as a New Generation Therapeutic Delivery Platform: A Review. Eur J Pharm Biopharm. Nov. 2013;85(3 Pt A):427-43. doi: 10.1016/j.ejpb.2013.07.002. Epub Jul. 17, 2013. |
| Hagglund et al., Role of ICP0 in the strategy of conquest of the host cell by herpes simplex virus 1. J Viral. Mar. 2004;78(5): 2169-78. doi: 10.1128/jvi.78.5.2169-2178.2004. |
| Hajj et al., Tools for translation: non-viral materials for therapeutic mRNA delivery. Nat Rev Mat. Sep. 2017;2:17056. |
| Halford et al., ICP0 antagonizes Stat 1-dependent repression of herpes simplex virus: implications for the regulation of viral latency. Viral J. Jun. 9, 2006;3:44. |
| Hassett et al., Optimization of Lipid Nanoparticles for Intramuscular Administration of mRNA Vaccines. Mol Ther Nucleic Acids. Apr. 15, 2019;15:1-11. Epub Feb. 7, 2019. |
| Hecker et al., Non-Viral DNA and mRNA Gene Delivery to the CNS Pre-Operatively for Neuroprotection and Following Neurotrauma. Molecular Therapy. 2004; 9, S258-S258. |
| Hecker, Nonviral, cationic lipid-mediated delivery of mRNA. Methods Mol Biol. 2013;969:73-88. doi: 10.1007/978-1-62703-260-5_5. |
| Heidenreich et al., A novel RNA-based adjuvant combines strong immunostimulatory capacities with a favorable safety profile. Int J Cancer. Jul. 15, 2015;137(2):372-84. doi: 10.1002/ijc.29402. Epub Jan. 8, 2015. |
| Heiser et al., Induction of polyclonal prostate cancer-specific CTL using dendritic cells transfected with amplified tumor RNA. J Immunol. Mar. 1, 2001; 166(5):2953-60. |
| Hess et al., Vaccination with mRNAs encoding tumor-associated antigens and granulocyte-macrophage colony-stimulating factor efficiently primes CTL responses, but is insufficient to overcome tolerance to a model tumor/self antigen. Cancer Immunol Immunother. Jun. 2006;55(6):672-83. Epub Aug. 20, 2005. |
| Heyes et al., Cationic lipid saturation influences intracellular delivery of encapsulated nucleic acids. J Control Release. Oct. 3, 2005;107(2):276-87. |
| Hobbs et al., Efficient activation of viral genomes by levels of herpes simplex virus ICP0 insufficient to affect cellular gene expression or cell survival. J Viral. Apr. 2001;75(7):3391-403. doi: 10.1128/JVI. 75. 7.3391-3403.2001. |
| Hodgman et al. RecName: Full=Envelope glycoprotein I; Short=gl; Flags: Precursor. UniProtKB/Swiss-Prot: P06764.1. Rev. Jan. 10, 2015. 1 page. |
| Hoerr et al., In vivo application of RNA leads to induction of specific cytotoxic T lymphocytes and antibodies. EurJ Immunol. Jan. 2000;30(1):1-7. |
| Hoerr et al., Stabilized Messenger RNA (RNActiveTM) as a Tool for Innovative Gene Delivery. Tissue Engineering. Apr. 2007; 13(4): 865-925. |
| Hoerr, More than a messenger: A new class of drugs-mRNA-based therapeutics. Genetic Engineering & Biotechnology News. Jun. 18, 2013. http://www.genengnews.com/gen-articles/more-than-a-messenger-a-new-class-of-drugs-mrna-based-therapeutics/4916/ [last accessed Mar. 25, 2016]. |
| Holtkamp et al., Modification of antigen-encoding RNA increases stability, translational efficacy, and T-cell stimulatory capacity of dendritic cells. Blood. Dec. 15, 2006;108(13):4009-17. |
| Hori et al., Antitumor Activity of Cationic Liposome-Mediated Bax mRNA Transfer in HOSM-1 Mandibular Osteoosarcoma Cells: A Comparative Study of Local Administration and Systemic Administration. Journal of Oral and Maxillofacial Surgery, 2014, vol. 72, No. 9, SUPPL. 1, p. e107, Abstract No. 98. |
| Hsu et al., Cationic lipid nanoparticles for therapeutic delivery of siRNA and miRNA to murine liver tumor. Nanomedicine. Nov. 2013;9(8):1169-80. doi: 10.1016/j.nano.2013.05.007. Epub May 30, 2013. |
| Ito et al., Full-length EBNA1 mRNA-transduced dendritic cells stimulate cytotoxic T lymphocytes recognizing a novel HLA-Cw*0303- and -Cw*0304-restricted epitope on EBNA1-expressing cells.J Gen Virol. Mar. 2007;88(Pt 3):770-80. |
| Jirikowski et al., Reversal of diabetes insipidus in Brattleboro Rats: Intrahypothalamic injection of vasopressin mRNA. Science. Feb. 1992; 255(5047): 996-998. |
| Jochum et al., RNAs in Epstein-Barr virions control early steps of infection. Proc Natl Acad Sci U S A. May 22, 2012;109(21):E1396-404. doi: 10.1073/pnas.1115906109. Epub Apr. 27, 2012. |
| John et al., Multi-antigenic human cytomegalovirus mRNA vaccines that elicit potent humoral and cell-mediated immunity. Vaccine. Mar. 14, 2018;36(12):1689-1699. doi:10.1016/j.vaccine.2018.01.029. Epub Feb. 15, 2018. |
| Johnston et al., Status of vaccine research and development of vaccines for herpes simplex virus. Vaccine. Jun. 3, 2016;34(26):2948-2952. doi: 10.1016/j.vaccine.2015.12.076. Epub Mar. 11, 2016. |
| Julien et al., Broadly neutralizing antibody PGT121 allosterically modulates CD4 binding via recognition of the HIV-1 gp120 V3 base and multiple surrounding glycans. PLoS Pathog. 2013;9(5):e1003342. doi: 10.1371/journal.ppat. 1003342. Epub May 2, 2013. |
| Kalantari-Dehagi et al., Discovery of Potential Diagnostic and Vaccine Antigens in Herpes Simplex Virus 1 and 2 by Proteome-Wide Antibody Profiling. J Virol. Apr. 2012;86(8):4328-39. doi: 10.1128/JVI.05194-11. Epub Feb. 8, 2012. |
| Kallen et al., A development that may evolve into a revolution in medicine: mRNA as the basis for novel, nucleotide-based vaccines and drugs. Ther Adv Vaccines. Jan. 2014;2(1):10-31. doi: 10.1177/2051013613508729. |
| Kallen et al., A novel, disruptive vaccination technology: self-adjuvanted RNActive(®) vaccines. Hum Vaccin Immunother. Oct. 2013;9(10):2263-76. doi: 10.4161/hv.25181. Epub Jun. 4, 2013. Review. |
| Kanapathipillai et al., Nanoparticle targeting of anti-cancer drugs that alter intracellular signaling or influence the tumor microenvironment. Adv Drug Deliv Rev. Dec. 15, 2014;79-80:107-18. doi: 10.1016/j.addr.2014.05.005. Epub May 9, 2014. |
| Kariko et al., Generating the optimal mRNA for therapy: HPLC purification eliminates immune activation and improves translation of nucleoside-modified, protein-encoding mRNA, Nucleic Acids Research, Oxford University Press, GB, vol. 39, No. 21, Sep. 2, 2011 (Sep. 2, 2011), e142. doi: 10.1093/nar/gkr695. Epub Sep. 2, 2011. |
| Kauffman et al., Efficacy and immunogenicity of unmodified and pseudouridine-modified mRNA delivered systemically with lipid nanoparticles in vivo. Biomaterials. Dec. 2016;109:78-87. doi: 10.1016/j.biomaterials.2016.09.006. Epub Sep. 25, 2016. |
| Kauffman et al., Materials for non-viral intracellular delivery of messenger RNA therapeutics. J Control Release. Oct. 28, 2016;240:227-234. doi: 10.1016/j.jconrel.2015.12.032. Epub Dec. 21, 2015. |
| Kauffman et al., Optimization of Lipid Nanoparticle Formulations for mRNA Delivery in Vivo with Fractional Factorial and Definitive Screening Designs. Nano Lett. Nov. 11, 2015;15(11):7300-6. doi: 10.1021/acs.nanolett.5b02497. Epub Oct. 20, 2015. |
| Khanna et al., Vaccine strategies against Epstein-Barr virus-associated diseases: lessons from studies on cytotoxic T-cell-mediated immune regulation. Immunol Rev. Aug. 1999; 170:49-64. doi: 10.1111/j.1600-065x.1999.tb01328.x. |
| Kirschner et al., Soluble Epstein-Barr virus glycoproteins gH, gL, and gp42 form a 1:1:1 stable complex that acts like soluble gp42 in B-cell fusion but not in epithelial cell fusion. J Virol. Oct. 2006;80(19):9444-54. doi: 10.1128/JVI.00572-06. |
| Kisich et al., Antimycobacterial agent based on mRNA encoding human beta-defensin 2 enables primary macrophages to restrict growth of Mycobacterium tuberculosis.Infect Immun. Apr. 2001;69(4):2692-9. |
| Klasse et al., Sequential and Simultaneous Immunization of Rabbits with HIV-1 Envelope Glycoprotein SOSIP.664 Trimers from Clades A, B and C. PLoS Pathog. Sep. 14, 2016;12(9):e1005864. doi: 10.1371/journal.ppat.1005864. eCollection Sep. 2016. |
| Koelle et al., Recent progress in herpes simplex virus immunobiology and vaccine research. Clin Microbiol Rev. Jan. 2003;16(1):96-113. doi: 10.1128/CMR.16.1.96-113.2003. |
| Kofler et al., Mimicking live flavivirus immunization with a noninfectious RNA vaccine. Proc. Natl. Acad. Sci. U S A. Feb. 2004;101(7):1951-1956. |
| Kohl et al., Limited antibody-dependent cellular cytotoxicity antibody response induced by a herpes simplex virus type 2 subunit vaccine. J Infect Dis. Jan. 2000;181(1):335-9. doi: 10.1086/315208. |
| Kozielski et al., Bioreducible Cationic Polymer-Based Nanoparticles for Efficient and Environmentally Triggered Cytoplasmic siRNA Delivery to Primary Human Brain Cancer Cells, ACS Nano. Apr. 22, 2014;8(4):3232-41. doi: 10.1021/nn500704t. Epub Apr. 3, 2014. |
| Kreiter et al., Intranodal vaccination with naked antigen-encoding RNA elicits potent prophylactic and therapeutic antitumoral immunity. Cancer Res. 2010; 70: 9031-9040. |
| Kreiter et al., Tumor vaccination using messenger RNA: prospects of a future therapy. Curr Opinion in Immun. Jun. 2011; 23(3): 399-406. |
| Krisky et al., Deletion of multiple immediate-early genes from herpes simplex virus reduces cytotoxicity and permits long-term gene expression in neurons. Gene Ther. Dec. 1998;5(12):1593-603. |
| Kuhn et al., mRNA as a versatile tool for exogenous protein expression. Current Gene Therapy. Oct. 2012; 12 (5): 347-361. |
| Kumar et al., Shielding of Lipid Nanoparticles for siRNA Delivery: Impact on Physicochemical Properties, Cytokine Induction, and Efficacy. Mol Ther Nucleic Acids. Nov. 18, 2014;3(11):e210. doi: 10.1038/mtna.2014.61. |
| Kurimoto et al., PEG-OligoRNA Hybridization of mRNA for Developing Sterically Stable Lipid Nanoparticles toward In Vivo Administration. Molecules. Apr. 3, 2019;24(7): 1303. |
| Kusakabe et al., The timing of GM-CSF expression plasmid administration influences the Th1/Th2 response induced by an HIV-1-specific DNA vaccine. J Immunol. Mar. 15, 2000;164(6):3102-11. doi: 10.4049/jimmunol.164.6.3102. |
| Kussie et al., A single engineered amino acid substitution changes antibody fine specificity. J Immunol. Jan. 1, 1994;152(1):146-52. |
| Kwoh et al., Transcription-based amplification system and detection of amplified human immunodeficiency virus type 1 with a bead-based sandwich hybridization format. Proc Natl Acad Sci U S A. Feb. 1989;86(4):1173-7. doi: 10.1073/pnas.86.4.1173. |
| Kwok et al., Genomic sequencing and comparative analysis of Epstein-Barr virus genome isolated from primary nasopharyngeal carcinoma biopsy. PLoS One. 2012;7(5):e36939. doi: 10.1371/journal.pone.0036939. Epub May 10, 2012. |
| Kwong et al., Broadly neutralizing antibodies and the search for an HIV-1 vaccine: the end of the beginning. Nat Rev Immunol. Sep. 2013;13(9):693-701. doi: 10.1038/nri3516. |
| Lanfranca et al., HSV-1 ICP0: An E3 Ubiquitin Ligase That Counteracts Host Intrinsic and Innate Immunity. Cells. May 20, 2014;3(2):438-54. |
| Ledford, H., Supercharged Antibodies Fight HIV-Related Virus in Monkeys, Nature. News & Comment. Oct. 30, 2013. 4 pages. doi: 10.1038/nature.2013.14060. |
| Leitner et al., DNA and RNA-based vaccines: principles, progress and prospects. Vaccine. Dec. 10, 1999;18 (9-10):765-77. |
| Leroueil et al., Wide varieties of cationic nanoparticles induce defects in supported lipid bilayers. Nano Lett. Feb. 2008;8(2):420-4. doi: 10.1021/n10722929. Epub Jan. 25, 2008. |
| Li et al., Developing lipid nanoparticle-based siRNA therapeutics for hepatocellular carcinoma using an integrated approach. Mol Cancer Ther. Nov. 2013;12(11):2308-18. doi: 10.1158/1535-7163.MCT-12-0983-T. Epub Aug. 13, 2013. |
| Li et al., Overcoming obstacles to develop effective and safe siRNA therapeutics. Expert Opin Biol Ther. May 2009; 9(5): 609-19. |
| Lian et al., Trends and developments in liposome drug delivery systems. J Pharm Sci. Jun. 2001;90(6):667-80. |
| Liang et al., Efficient Targeting and Activation of Antigen-Presenting Cells In Vivo after Modified mRNA Vaccine Administration in Rhesus Macaques. Mol Ther. Dec. 6, 2017;25(12):2635-2647. doi: 10.1016/j.ymthe.2017.08.006. Epub Aug. 12, 2017. |
| Lin et al., Lipid-based nanoparticles in the systemic delivery of siRNA. Nanomedicine (Lond). Jan. 2014;9(1):105-20. doi: 10.2217/nnm.13.192. |
| Lindgren et al., Induction of Robust B Cell Responses after Influenza mRNA Vaccination Is Accompanied by Circulating Hemagglutinin-Specific ICOS+PD-1+CXCR3+T Follicular Helper Cells. Front Immunol. Nov. 13, 2017;8:1539. doi: 10.3389/fimmu.2017.01539. eCollection 2017. |
| Liu et al., Human herpesvirus 2 strain 16293 glycoprotein D (US6) gene, complete cds. GenBank: AY779754. Encodes AAW23134. Apr. 14, 2009. |
| Lohith, In vivo imaging of mRNA based vaccine antigen in non-human primates using PET reporter mRNA-probe combination, Molecular Imaging and Biology, Dec. 2017, vol. 19, No. 1 Supplement, Page S703. |
| Loparev, Unknown [Human alphaherpesvirus 3]. Gen Bank: ABE03086.1. Dep Apr. 15, 2007. (Year: 2007). |
| Lorenzi et al., Intranasal vaccination with messenger RNA as a new approach in gene therapy: Use against tuberculosis. BMC Biotechnol. Oct. 2010; 10(77): 1-11. |
| MacLachlan, Lipid Nanoparticle-mediated delivery of messenger RNA. Presentation. 1st International mRNA Health Conference. Tubingen, Germany. Oct. 24, 2013. http://files.shareholder.com/downloads/ABEA-50QJTB/2628241206x0x699789/47543d12-db34-4e6e-88a9-f3ae5d97b1d2/MacLachlan_mRNA_Conf_2013.pdf. Last accessed Dec. 22, 2016. |
| Madden et al., Administration of nucleoside-modified mRNA encoding broadly neutralizing antibody protects humanized mice from HIV-1 challenge. Nat Commun. Mar. 2, 2017;8:14630. doi: 10.1038/ncomms14630. Available at https://acuitastx.com/wp-content/uploads/2015/01/Poster-Second-International-mRNA-Health-Conference.pdf. |
| Madden et al., Systemic delivery of mRNA therapeutics using lipid nanoparticles (LNP): improved potency for novel LNP and influence of route of administration on protein expression. 2nd International mRNA Health Conference. Nov. 12, 2014. https://acuitastx.com/wp-content/uploads/2015/01/Poster-Second-International-mRNA-Health-Conference.pdf. 1 page. |
| Magini et al., Self-Amplifying mRNA Vaccines Expressing Multiple Conserved Influenza Antigens Confer Protection against Homologous and Heterosubtypic Viral Challenge. PLoS One. Aug. 15, 2016;11(8):e0161193. doi: 10.1371/journal.pone.0161193. eCollection 2016. |
| Maier et al., Biodegradable Lipids Enabling Rapidly Eliminated Lipid Nanoparticles for Systemic Delivery of RNAi Therapeutics. Mol Ther. Aug. 2013; 21(8): 1570-1578. |
| Martinon et al., Induction of virus-specific cytotoxic T lymphocytes in vivo by liposome-entrapped mRNA. EurJ Immunol. Jul. 1993;23(7):1719-22. |
| McAllister et al., Prospects and perspectives for development of a vaccine against herpes simplex virus infections. Expert Rev Vaccines. Nov. 2014;13(11):1349-60. doi: 10.1586/14760584.2014.932694. Epub Jul. 31, 2014. |
| McCafferty et al., In Vivo Validation of a Reversible Small Molecule-Based Switch for Synthetic Self-Amplifying mRNA Regulation. Mol Ther. Mar. 3, 2021;29(3):1164-1173. doi: 10.1016/j.ymthe.2020.11.010. Epub Nov. 11, 2020. |
| McClements et al., Immunization with DNA vaccines encoding glycoprotein Dor glycoprotein B, alone or in combination, induces protective immunity in animal models of herpes simplex virus-2 disease. Proc Natl Acad Sci U Sa. Oct. 15, 1996;93(21):11414-20. |
| McKenzie et al., Nucleic acid vaccines: tasks and tactics. Immunol Res. 2001;24(3):225-44. |
| Midoux et al., Lipid-based mRNA vaccine delivery systems. Expert Rev Vaccines. Feb. 2015;14(2):221-34. doi: 10.1586/14760584.2015.986104. Epub Dec. 26, 2014. Review. |
| Mitchell et al., RNA transfected dendritic cells as cancer vaccines. Curr Opin Mal Ther. Apr. 2000;2(2):176-81. |
| Mitchell et al., RNA-transfected dendritic cells in cancer immunotherapy. J Clin Invest. Nov. 2000;106 (9):1065-9. |
| Miyagawa et al., Herpes simplex viral-vector design for efficient transduction of nonneuronal cells without cytotoxicity. Proc Natl Acad Sci U Sa. Mar. 31, 2015 ;112(13):E1632-41. Epub Mar. 16, 2015. (Year: 2015). |
| Mockey et al., mRNA-based cancer vaccine: prevention of B16 melanoma progression and metastasis by systemic injection of MART1 mRNA histidylated lipopolyplexes. Cancer Gene Ther. Sep. 2007;14(9):802-14. Epub Jun. 22, 2007. |
| Moffat et al., Functions of the C-terminal domain of varicella-zoster virus glycoprotein E in viral replication in vitro and skin and T-cell tropism in vivo. J Virol. Nov. 2004;78(22):12406-15. |
| Molesworth et al., Epstein-Barr virus gH is essential for penetration of B cells but also plays a role in attachment of virus to epithelial cells. J Virol. Jul. 2000;74(14):6324-32. doi: 10.1128/jvi.74.14.6324-6332.2000. |
| Monslow et al., Immunogenicity generated by mRNA vaccine encoding VZV gE antigen is comparable to adjuvanted subunit vaccine and better than live attenuated vaccine in nonhuman primates. Vaccine. Aug. 10, 2020;38(36):5793-5802. doi: 10.1016/j.vaccine.2020.06.062. Epub Jul. 20, 2020. |
| Morello et al., Immunization With Herpes Simplex Virus 2 (HSV-2) Genes Plus Inactivated HSV-2 Is Highly Protective Against Acute and Recurrent HSV-2 Disease. J Virol. Apr. 2011;85(7):3461-72. doi: 10.1128/JVI.02521-10. Epub Jan. 26, 2011. |
| Mosca et al., Activation of human immunodeficiency virus by herpesvirus infection: identification of a region within the long terminal repeat that responds to a trans-acting factor encoded by herpes simplex virus 1. Proc Natl Acad Sci U S A. Nov. 1987;84(21):7408-12. doi: 10.1073/pnas.84.21.7408. |
| Mosca et al., Activation of human immunodeficiency virus by herpesvirus infection: identification of a region within the long terminal repeat that responds to a trans-acting factor encoded by herpes simplex virus 1. Proc Natl Acad Sci USA. Nov. 1987;84(21):7408-12. |
| Muller et al., Transfection of dendritic cells with RNA induces CD4- and COB-mediated T cell immunity against breast carcinomas and reveals the immunodominance of presented T cell epitopes. J Immunol. Jun. 15, 2003;170 (12):5892-6. |
| Murakawa et al., Direct detection of HIV-1 RNA from AIDS and ARC patient samples. DNA. May 1988;7(4):287-95. doi: 10.1089/dna.1988.7.287. |
| Natuk et al., Recombinant vesicular stomatitis virus vectors expressing herpes simplex virus type 2 gD elicit robust CD4+Th1 immune responses and are protective in mouse and guinea pig models of vaginal challenge. J Viral. May 2006;80(9):4447-57. |
| Paladino et al., Cellular localization of the herpes simplex virus ICP0 protein dictates its ability to block IRF3-mediated innate immune responses. PLoS One. Apr. 29, 2010;5(4):e10428. |
| Pardi et al., Administration of nucleoside-modified mRNA encoding broadly neutralizing antibody protects humanized mice from HIV-1 challenge. Nat Commun. Mar. 2, 2017;8:14630. doi: 10.1038/ncomms14630. |
| Pardi et al., Expression Kinetics of Nucleoside-Modified mRNA Delivered in Lipid Nanoparticles to Mice by Various Routes. J Control Release. Nov. 10, 2015;217:345-51. doi: 10.1016/j.jconrel.2015.08.007. Epub Aug. 8, 2015. |
| Pardi et al., mRNA vaccines—a new era in vaccinology. Nat Rev Drug Discov. Apr. 2018;17(4):261-279. doi: 10.1038/nrd.2017.243. Epub Jan. 12, 2018. |
| Parisien et al., Rationalization and prediction of selective decoding of pseudouridine-modified nonsense and sense codons. RNA. Mar. 2012;18(3):355-67. doi: 10.1261/rna.031351.111. Epub Jan. 26, 2012. |
| Perche et al., Enhancement of dendritic cells transfection in vivo and of vaccination against B16F10 melanoma with mannosylated histidylated lipopolyplexes loaded with tumor antigen messenger RNA. Nanomedicine. Aug. 2011;7(4):445-53. doi: 10.1016/j.nano.2010.12.010. Epub Jan. 8, 2011. |
| Perez et al. Novel Epstein-Barr virus-like particles incorporating gH/gL-EBNA1 or GB-LMP2 induce high neutralizing antibody titers and EBV-specific T-cell responses in immunized mice. Oncotarget. Mar. 21, 2017;8(12):19255-19273. doi: 10.18632/oncotarget.13770. |
| Petro et al., Herpes simplex type 2 virus deleted in glycoprotein D protects against vaginal, skin and neural disease. Elife. Mar. 10, 2015;4:e06054. doi: 10.7554/eLife.06054. |
| Petsch et al., Protective efficacy of in vitro synthesized, specific mRNA vaccines against influenza A virus infection. Nat Biotechnol. Dec. 2012;30(12):1210-6. doi: 10.1038/nbt.2436. Epub Nov. 25, 2012. |
| Phua et al., Messenger RNA (mRNA) nanoparticle tumour vaccination. Nanoscale. Jul. 21, 2014;6(14):7715-29. doi: 10.1039/c4nr01346h. Review. |
| Pollard et al., Type I IFN counteracts the induction of antigen-specific immune responses by lipid-based delivery of mRNA vaccines. Mol Ther. Jan. 2013; 21 (1): 251-259. |
| Poveda et al., Establishing Preferred Product Characterization for the Evaluation of RNA Vaccine Antigens. Vaccines (Basel). Sep. 27, 2019;7(4):131. doi: 10.3390/vaccines7040131. |
| Pulford et al., Liposome-siRNA-peptide complexes cross the blood-brain barrier and significantly decrease PrP'C on neuronal cells and PrP'RES in infected cell cultures. PLoS One. 201 O; 5(6): e11085. |
| Rabinovich et al., Synthetic messenger RNA as a tool for gene therapy. Hum. Gene Ther. Oct. 2006; 17: 1027-1035. |
| Reichmuth et al., mRNA Vaccine Delivery Using Lipid Nanoparticles. Ther Deliv. 2016;7(5):319-34. doi: 10.4155/tde-2016-0006. |
| Rittig et al., Intradermal vaccinations with RNA coding for TAA generate CD8+and CD4+immune responses and induce clinical benefit in vaccinated patients. Mol Ther. May 2011;19(5):990-9. doi: 10.1038/mt.2010.289. Epub Dec. 28, 2010. |
| Rodriguez et al., Delivery of recombinant vaccines against bovine herpesvirus type 1 gD and Babesia bovis MSA-2c to mice using liposomes derived from egg yolk lipids. Vet J. Jun. 2013;196(3):550-1. doi: 10.1016/j.tvjl.2012.10.036. Epub Nov. 24, 2012. |
| Rodriguez et al., The HSV-1 ubiquitin ligase ICP0: Modifying the cellular proteome to promote infection. Virus Res. Aug. 2020;285:198015. Epub May 13, 2020. |
| Rouse et al., Induction in vitro of primary cytotoxic T-lymphocyte responses with DNA encoding herpes simplex virus proteins. J Virol. Sep. 1994;68(9):5685-9. |
| Routy et al. Immunologic activity and safety of autologous HIV RNA-electroporated dendritic cells in HIV-1 infected patients receiving antiretroviral therapy. Clin Immunol. Feb. 2010;134(2):140-7. doi: 10.1016/j.clim.2009.09.009. Epub Nov. 4, 2009. |
| Samaniego et al., The herpes simplex virus immediate-early protein ICP0 affects transcription from the viral genome and infected-cell survival in the absence of ICP4 and ICP27. J Viral. Jun. 1997;71(6):4614-25. |
| Sathiyamoorthy et al., Inhibition of EBV-mediated membrane fusion by anti-gHgL antibodies. Proc Natl Acad Sci U S A. Oct. 10, 2017;114(41):E8703-E8710. doi: 10.1073/pnas.1704661114. Epub Sep. 22, 2017. |
| Sayour et al., RNA Nanoparticle Vaccines Facilitate and Sustain Adoptive Cellular Therapy Targeting Pediatric Intracranial Malignancies. Pediatric Blood and Cancer, Jun. 2015, vol. 62, Supplement 2, p. S24, Abstract No. 4012. |
| Scheid et al., Sequence and structural convergence of broad and potent HIV antibodies that mimic CD4 binding. Science. Sep. 16, 2011;333(6049):1633-7. doi: 10.1126/science.1207227. Epub Jul. 14, 2011. |
| Schirrmacher et al., Intra-pinna anti-tumor vaccination with self-replicating infectious RNA or with DNA encoding a model tumor antigen and a cytokine. Gene Ther. Jul. 2000;7(13):1137-47. |
| Schlake et al., Developing mRNA-vaccine technologies. RNA Biol. Nov. 2012;9(11):1319-30. doi: 10.4161/rna.22269. Epub Oct. 12, 2012. |
| Schmidt-Chanasit, glycoprotein B [Human alphaherpesvirus 2]. Gen Bank: ADG45118.1. Jun. 24, 2010. 2 pages. |
| Schmitt et al., In vitro induction of a bladder cancer-specific T-cell response by mRNA- transfected dendritic cells. J Cancer Res Clin Oncol. 2001 ;127(3):203-6. |
| Schott et al., Viral and non-viral approaches for transient delivery of mRNA and proteins. Current Gene Ther. 2011; 11 (5): 382-398. |
| Schwendener, Liposomes as vaccine delivery systems: a review of the recent advances. Ther Adv Vaccines. Nov. 2014;2(6):159-82. doi: 10.1177/2051013614541440. |
| Sciortino et al., RNAs extracted from herpes simplex virus 1 virions: apparent selectivity of viral but not cellular RNAs packaged in virions. J Virol. Sep. 2001;75(17):8105-16. |
| Segura et al., Monitoring gene therapy by external imaging of mRNA: Pilot study on murine erythropoietin. Ther Drug Monit. Oct. 2007; 29(5): 612-8. |
| Sekulovich et al., The herpes simplex virus type 1 alpha protein ICP27 can act as a trans-repressor or a trans-activator in combination with ICP4 and ICP0. J Viral. Dec. 1988;62(12):4510-22. doi: 10.1128/JV1.62.12.4510-4522.1988. |
| Shah et al., Shingrix for Herpes Zoster: A Review. Skin Therapy Lett. Jul. 2019;24(4):5-7. |
| Shingai et al., Antibody-mediated immunotherapy of macaques chronically infected with SHIV suppresses viraemia. Nature. Nov. 14, 2013;503(7475):277-80. doi: 10.1038/nature12746. Epub Oct. 30, 2013. |
| Small et al., Viruses—from pathogens to vaccine carriers.Curr Opin Virol. Oct. 2011;1(4):241-5. doi: 10.1016/j.coviro.2011.07.009. |
| Smits et al. RNA-based gene transfer for adult stem cells and T cells. Leukemia. 2004; 18: 1898-1902. |
| Sohn et al., In-vivo particle mediated delivery of mRNA to mammalian tissues: ballistic and biological effects. Wound Rep and Regen. Jul.-Aug. 2001; 287-296. |
| Sohn et al., Measurement of CD8+ and CD4+ T Cell Frequencies Specific for EBV LMP1 and LMP2a Using mRNA-Transfected DCs.PLoS One. May 29, 2015;10(5):e0127899. doi: 10.1371/journal.pone.0127899. eCollection 2015. |
| Stanberry et al., Glycoprotein-D-adjuvant vaccine to prevent genital herpes. N Engl J Med. Nov. 21, 2002;347(21):1652-61. |
| Strong et al., Incorporation of beta-globin untranslated regions into a Sindbis virus vector for augmentation of heterologous mRNA expression. Gene Ther. Jun. 1997;4(6):624-7. |
| Su et al., Antigen presenting cells transfected with LMP2a RNA induce CD4+LMP2a-specific cytotoxic T lymphocytes which kill via a Fas-independent mechanism.Leuk Lymphoma. Aug. 2002;43(8):1651-62. |
| Sullenger et al., Emerging clinical applications of RNA. Nature. Jul. 11, 2002;418(6894):252-8. |
| Svinarchuk et al., Inhibition of HIV proliferation in MT-4 cells by antisense oligonucleotide conjugated to lipophilic groups. Biochimie. 1993;75(1-2):49-54. doi: 10.1016/0300-9084(93)90024-m. |
| Swain et al. RecName: Full=Envelope glycoprotein C; Flags: Precursor UniProtKB/Swiss-Prot: P06475.1. Rev. Jan. 7, 2015. 3 pages. |
| Szebeni et al., Activation of complement by therapeutic liposomes and other lipid excipient-based therapeutic products: prediction and prevention. Adv Drug Deliv Rev. Sep. 16, 2011;63(12):1020-30. doi: 10.1016/j.addr.2011.06.017. Epub Jul. 14, 2011. |
| Szebeni et al., Complement activation as a bioequivalence issue relevant to the development of generic liposomes and other nanoparticulate drugs. Biochem Biophys Res Commun. Dec. 18, 2015;468(3):490-7. doi: 10.1016/j.bbrc.2015.06.177. Epub Jul. 14, 2015. |
| Szebeni, Complement activation-related pseudoallergy: a stress reaction in blood triggered by nanomedicines and biologicals. Mol Immunol. Oct. 2014;61(2):163-73. doi: 10.1016/j.molimm.2014.06.038. Epub Aug. 12, 2014. |
| Tavernier et al., mRNA as gene therapeutic: How to control protein expression. J. of Controlled Release. Mar. 2011; 150(3): 238-247. |
| Taylor et al., Therapeutic vaccination strategies to treat nasopharyngeal carcinoma. Chin Clin Oncol. Apr. 2016;5(2):23. doi: 10.21037/cco.2016.03.20. |
| Tekmira, Lipid Nanoparticle-mediated delivery of messenger RNA (retrieved from the internet). Published Oct. 24, 2013. Available at http://files.shareholder.com/downloads/ABEA-50QJTB/2628241206x0x699789/47543d12-db34-4e6e-88a9-f3ae5d97b1d2/MacLachlan_mRNA_Conf_2013.pdf. |
| Terada et al., Characterization of Lipid Nanoparticles Containing Ionizable Cationic Lipids Using Design-of-Experiments Approach. Langmuir. Jan. 26, 2021;37(3):1120-1128. doi: 10.1021/acs.langmuir.0c03039. Epub Jan. 13, 2021. |
| Teufel et al., Human peripheral blood mononuclear cells transfected with messenger RNA stimulate antigen-specific cytotoxic T-lymphocytes in vitro. Cell Mol Life Sci. Aug. 2005;62(15):1755-62. |
| Thess et al., Sequence-engineered mRNA Without Chemical Nucleoside Modifications Enables an Effective Protein Therapy in Large Animals. Mol Ther. Sep. 2015;23(9):1456-64.doi: 10.1038/mt.2015.103. Epub Jun. 8, 2015. |
| Torrecilla et al., Lipid Nanoparticles as Carriers for RNAi Against Viral Infections: Current Status and Future Perspectives. Biomed Res Int. 2014;2014:161794. doi: 10.1155/2014/161794. Epub Aug. 12, 2014. |
| Uzgun, S., et al., PEGylation improves nanoparticle formation and transfection efficiency of messenger RNA. Pharm Res. Sep. 2011; 28(9); 2223-2232. |
| Vassilev et al., Microparticle-mediated RNA immunization against bovine viral diarrhea virus. Vaccine. Feb. 28, 2001;19(15-16):2012-9. |
| Wang et al., Epstein-Barr virus lacking glycoprotein gp42 can bind to B cells but is not able to infect. J Virol. Jan. 1998;72(1):158-63. doi: 10.1128/JVI.72.1.158-163.1998. |
| Wang et al., Essential role played by the C-terminal domain of glycoprotein I in envelopment of varicella-zoster virus in the trans-Golgi network: interactions of glycoproteins with tegument. J Virol. Jan. 2001;75(1):323-40. |
| Wang et al., Gene inoculation generates immune responses against human immunodeficiency virus type 1. Proc Natl Acad Sci U S A. May 1, 1993;90(9):4156-60. doi: 10.1073/pnas.90.9.4156. |
| Wang et al., Immune Responses to Varicella-Zoster Virus Glycoprotein E Formulated with Poly(Lactic-co-Glycolic Acid) Nanoparticles and Nucleic Acid Adjuvants in Mice. Virol Sin. Aug. 5, 2020. doi: 10.1007/s12250-020-00261-y. |
| Wang et al., Systemic delivery of modified mRNA encoding herpes simplex virus 1 thymidine kinase for targeted cancer gene therapy. Mol Ther. Feb. 2013;21(2):358-67. doi: 10.1038/mt.2012.250. Epub Dec. 11, 2012. |
| Weilhammer et al., The use of nanolipoprotein particles to enhance the immunostimulatory properties of innate immune agonists against lethal influenza challenge. Biomaterials. Dec. 2013;34(38):10305-18. doi: 10.1016/j.biomaterials.2013.09.038. Epub Sep. 27, 2013. |
| Weissman et al., Dendritic cells express and use multiple HIV coreceptors. Adv Exp Med Biol. 1997;417:401-6. doi: 10.1007/978-1-4757-9966-8_65. |
| Weissman et al., HIV GAG mRNA transfection of dendritic cells (DC) delivers encoded antigen to MHC class I and II molecules, causes DC maturation, and induces a potent human in vitro primary immune response. J Immunol. Oct. 15, 2000;165(8):4710-7. doi: 10.4049/jimmunol.165.8.4710. |
| Whisnant et al., Integrative functional genomics decodes herpes simplex virus 1. Nat Commun. Apr. 27, 2020;11 (1):2038. (Year: 2020). |
| Whitley et al., Clinical management of herpes simplex virus infections: past, present, and future. Version 1. F1000Res. 2018; 7: F1000 Faculty Rev-1726. |
| Wilkinson et al., Structure of the Fab fragment of F105, a broadly reactive anti-human immunodeficiency virus (HIV) antibody that recognizes the CD4 binding site of HIV type 1 gp120. J Virol. Oct. 2005;79(20):13060-9. doi: 10.1128/JVI.79.20.13060-13069.2005. |
| Winkler et al., Changing the antigen binding specificity by single point mutations of an anti-p24 (HIV-1) antibody. J Immunol. Oct. 15, 2000;165(8):4505-14. doi: 10.4049/jimmunol.165.8.4505. |
| Winkler et al., Changing the antigen binding specificity by single point mutations of an anti-p24 (HIV-1) antibody. J Immunol. Oct. 15, 2000;165(8):4505-14. |
| Wong et al., An mRNA vaccine for influenza. Nat Biotechnol. Dec. 2012;30(12):1202-4. doi: 10.1038/nbt.2439. |
| Woodberry et al., Immunogenicity of a human immunodeficiency virus (HIV) polytope vaccine containing multiple HLA A2 HIV CD8(+) cytotoxic T-cell epitopes. J Virol. Jul. 1999;73(7):5320-5. doi: 10.1128/JVI.73.7.5320-5325.1999. |
| Wu et al., Prolonged gene expression and cell survival after infection by a herpes simplex virus mutant defective in the immediate-early genes encoding ICP4, ICP27, and ICP22. J Viral. Sep. 1996;70(9):6358-69. (Year: 1996). |
| Xue et al., Lipid-Based Nanocarriers for RNA Delivery. Curr Pharm Des. 2015;21(22):3140-7. |
| Yamamoto et al., Current prospects for mRNA gene delivery. Eur J Pharm Biopharm. Mar. 2009;71(3):484-9. doi: 10.1016/j.ejpb.2008.09.016. Epub Oct. 10, 2008. |
| Ying et al., Cancer therapy using a self-replicating RNA vaccine. Nat Med. Jul. 1999;5(7):823-7. |
| Zhao et al., Chapter Two: Lipid Nanoparticles for Gene Delivery. Book: Advances in Genetics. Elsevier, 2014. 24 pages. |
| Zhao et al., Nanoparticle vaccines. Vaccine. Jan. 9, 2014;32(3):327-37. doi: 10.1016/j.vaccine.2013.11.069. Epub Dec. 2, 2013. |
| Zhou et al., RNA melanoma vaccine: induction of antitumor immunity by human glycoprotein 100 mRNA immunization. Hum Gene Ther. Nov. 1, 1999;10(16):2719-24. |
| Zhu et al., Targeting of glycoprotein I (gE) of varicella-zoster virus to the trans-Golgi network by an AYRV sequence and an acidic amino acid-rich patch in the cytosolic domain of the molecule. J Virol. Oct. 1996;70(10):6563-75. |
| Zou et al., Lipid-mediated delivery of RNA is more efficient than delivery of DNA in non-dividing cells. Int J Pharm. Apr. 15, 2010;389(1-2):232-43. doi: 10.1016/j.ijpharm.2010.01.019. Epub Jan. 18, 2010. |
| Zwick et al., Identification and characterization of a peptide that specifically binds the human, broadly neutralizing anti-human immunodeficiency virus type 1 antibody b12. J Virol. Jul. 2001;75(14):6692-9. doi: 10.1128/JVI.75.14.6692-6699.2001. |
| Zwick et al., Molecular features of the broadly neutralizing immunoglobulin G1 b12 required for recognition of human immunodeficiency virus type 1 gp120. J Virol. May 2003;77(10):5863-76. doi: 10.1128/jvi.77.10.5863-5876.2003. |
| Number | Date | Country | |
|---|---|---|---|
| 20220241399 A1 | Aug 2022 | US |
| Number | Date | Country | |
|---|---|---|---|
| 62819394 | Mar 2019 | US |
