Incorporation of unnatural amino acids into proteins using base editing

Information

  • Patent Grant
  • 11542509
  • Patent Number
    11,542,509
  • Date Filed
    Thursday, August 24, 2017
    7 years ago
  • Date Issued
    Tuesday, January 3, 2023
    2 years ago
Abstract
Provided herein are systems, compositions, and methods for the incorporation of unnatural amino acids into proteins via nonsense suppression or rare codon suppression. Nonsense codons and rare codons may be introduced into the coding sequence of a protein of interest using a CRISPR/Cas9-based nucleobase editor described herein. The nucleobase editors are able to be programmed by guide nucleotide sequences to edit the target codons in the coding sequence of the protein of interest. Also provided are application enabled by the technology described herein.
Description
REFERENCE TO A SEQUENCE LISTING SUBMITTED AS A TEXT FILE VIA EFS-WEB

The instant application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Sep. 8, 2020, is named H082470236US01-SEQ-GJM and is 3,304 kilobytes in size.


BACKGROUND

The ability to study cellular systems and the mechanisms that drive disease-relevant and fundamental biological processes relies on a suite of chemical and genetic perturbagens to interrogate these complex systems in situ using experimental paradigms as close to the native state as possible. To date, there are no programmable tools for unbiased high-throughput interrogation of the proteome in living cells. Currently available paradigms are used to study individual proteins, or at best small collections of proteins. Medium-throughput screening modalities have been engineered for specific families of proteins, for example, in activity-based protein profiling (ABPP), but these tools are limited to proteins whose enzymatic activity can be readily harnessed using a reactive biochemical handle.


SUMMARY

Described herein are systems, methods, and compositions for incorporation of unnatural amino acids into virtually any protein. The methodology relies on CRISPR/Cas9-based base-editing technology coupled with stop-codon or rare codon suppression to incorporate unnatural amino acids into proteins. Provided herein are methods to treat live cells with libraries of nucleotide sequences (e.g., guide RNA or guide ssDNA) complexed with Cas9 nucleobase editors to transform contain codons (e.g., the target codons listed Table 2) into stop codons or rare codons in a guide nucleotide sequence-programmable manner. Further provided herein are applications enabled by this novel concept, as well as the chemical tools/probes required to connect genome/base-editing and proteome-wide interrogation of protein functions.


Accordingly, some aspects of the present disclosure provide methods of incorporating an unnatural amino acid into a protein of interest at one or more specific position(s), the method comprising: (i) contacting a polynucleotide encoding the protein of interest with a fusion protein comprising (a) a guide nucleotide sequence-programmable DNA-binding protein domain; and (b) a cytosine deaminase domain, wherein the fusion protein is associated with a guide nucleotide sequence, and whereby the contacting results in changing a target codon to a stop codon or a rare codon via deamination of a cytosine (C) base; (ii) using the polynucleotide containing the stop or rare codon in a translation system, whereby the unnatural amino acids are incorporated into the protein of interest at the suppressible stop codon or rare codon during translation of the protein, wherein the polynucleotide comprises a coding strand and a complementary strand.


In some embodiments, the guide nucleotide sequence-programmable DNA binding protein domain is selected from the group consisting of: a nuclease inactive Cas9 (dCas9), a nuclease inactive Cpf1, and a nuclease inactive Argonaute.


In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain is a nuclease inactive Cas9 (dCas9).


In some embodiments, the amino acid sequence of the dCas9 domain comprises mutations corresponding to a D10A and/or H840A mutation in SEQ ID NO: 1.


In some embodiments, the amino acid sequence of the dCas9 domain comprises a mutation corresponding to a D10A mutation in SEQ ID NO: 1, and wherein the dCas9 domain comprises a histidine at a position corresponding to amino acid 840 of SEQ ID NO:


In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain comprises a nuclease inactive Cpf1 (dCpf1).


In some embodiments, the dCpf1 is from Acidaminococcus or Lachnospiraceae.


In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain comprises a nuclease inactive Argonaute (dAgo).


In some embodiments, the (dAgo) is from Natronobacterium gregoryi (dNgAgo).


The method of any of claims 1-9, wherein the cytosine deaminase is an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase.


In some embodiments, the cytosine deaminase is selected from the group consisting of APOBEC1, APOBEC2, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3D, APOBEC3F, APOBEC3G deaminase, APOBEC3H deaminase, APOBEC4 deaminase, and activation-induced deaminase (AID).


In some embodiments, the cytosine deaminase comprises an amino acid sequence of any one of SEQ ID NOs: 270-288 and 378-381.


In some embodiments, the fusion protein of (a) further comprises a uracil glycosylase inhibitor (UGI) domain. In some embodiments, the cytosine deaminase domain is fused to the N-terminus of the guide nucleotide sequence-programmable DNA-binding protein domain. In some embodiments, the UGI domain is fused to the C-terminus of the guide nucleotide sequence-programmable DNA-binding protein domain. In some embodiments, the cytosine deaminase and the guide nucleotide sequence-programmable DNA-binding protein domain is fused via an optional linker. In some embodiments, the UGI domain is fused to the dCas9 domain via an optional linker.


In some embodiments, the fusion protein comprises the structure NH2-[cytosine deaminase domain]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA-binding protein domain]-[optional linker sequence]-[UGI domain]-COOH.


In some embodiments, the linker comprises (GGGS)n (SEQ ID NO: 362), (GGGGS)n (SEQ ID NO: 363), (G)n, (EAAAK)n (SEQ ID NO: 364), (GGS)n, SGSETPGTSESATPES (SEQ ID NO: 365), or (XP)n motif, or a combination of any of these, wherein n is independently an integer between 1 and 30, and wherein X is any amino acid. In some embodiments, the linker comprises the amino acid sequence SGSETPGTSESATPES (SEQ ID NO: 365). In some embodiments, the linker is (GGS)n, and wherein n is 1, 3, or 7.


In some embodiments, the fusion protein comprises the amino acid sequence of any one of SEQ ID NO: 291-295 and 382-386.


In some embodiments, the target codon is changed to a stop codon selected from the group consisting of TAG (Amber), TGA (Opal), and TAA (Ochre).


In some embodiments, the target codon is a sense codon selected from the group consisting of CAG, TGG, CGA, CAA, and CGG.


In some embodiments, the change of codon is selected from the group consisting of: CAG to TAG, TGG to TAG, CGA to TGA, CAA to TAA, TGG to TGA, CGG to TAG, and CGA to TAA.


In some embodiments, the CAG to TAG is via the deamination of the first C on the coding strand. In some embodiments, the CGA to TGA change is via the deamination of the first C on the coding strand. In some embodiments, the CAA to TAA change is via the deamination of the first C on the coding strand. In some embodiments, the TGG to TAG change is via the deamination of the second C on the complementary strand. In some embodiments, the TGG to TGA change is via the deamination of the third C on the complementary strand. In some embodiments, the CGG to TAG change is via the deamination of the first C on the coding strand, and the deamination of the second C on the complementary strand. In some embodiments, the CGA to TAA change is via the deamination of the first C on the coding strand, and the deamination of the second C on the complementary strand. In some embodiments, the target codon is a non-sense codon selected from TGA and TAG. In some embodiments, the change of codon is selected from TGA to TAA, and TAG to TAA. In some embodiments, wherein the TGA to TAA change is via the deamination of the second C on the complementary strand. In some embodiments, the TAG to TAA change is via the deamination of the third C on the complementary strand.


In some embodiments, the target codon is changed to a rare codon selected from the group consisting of AGG, ATA, AGT, TTT, and TTC. In some embodiments, the target codon is selected from the group consisting of GGG, ATG, ACA, GGT, TCT, TCC, CTT, and CTC. In some embodiments, the change of codon is selected from the group consisting of: GGG to AGG, ATG to ATA, GGT to AGT, ACA to ATA, CTC to TTC, TCT to TTT, TCC to TTC, CTT to TTT, CTC to TTT, and TCC to TTT.


In some embodiments, the GGG to AGG change is via the deamination of the first C on the complementary strand. In some embodiments, the ATG to ATA change is via the deamination of the first C on the complementary strand. In some embodiments, the GGT to AGT change is via the deamination of the first C on the complementary strand. In some embodiments, the ACA to ATA change is via the deamination of the second C on the coding strand. In some embodiments, the CTC to TTC change is via the deamination of the first C on the coding strand. In some embodiments, the TCT to TTT change is via the deamination of the second C on the coding strand. In some embodiments, the TCC to TTC change is via the deamination of the second C on the coding strand. In some embodiments, the CTT to TTT change is via the deamination of the first C on the coding strand. In some embodiments, the CTC to TTT change is via the deamination of the first C and the third C on the coding strand. In some embodiments, the TCC to TTT change is via the deamination of the second C and the third C on the coding strand.


In some embodiments, a PAM sequence is located 3′ of the C being changed. In some embodiments, the PAM sequence is selected from the group consisting of: NGG, NGAN, NGNG, NGAG, NGCG, NNGRRT, NGRRN, NNNRRT, NNNGATT, NNAGAAW, NAAAC, NNT, NNNT, and YNT, wherein Y is pyrimidine, and N is any nucleobase. In some embodiments, no PAM sequence is located 3′ of the C being changed.


In some embodiments, the translation system comprises: (a) an orthogonal tRNA (OtRNA); (b) an orthogonal aminoacyl tRNA synthetase (ORS); and (c) an unnatural amino acid, wherein the ORS preferentially aminoacylates the OtRNA with the unnatural amino acid, and the OtRNA recognizes at least one suppressible stop codon.


In some embodiments, the translation system further comprises components needed for the translation of the protein of interest. In some embodiments, the components needed for the translation of the protein of interest comprise RNA polymerases, translation initiation factor, ribosomes, release factor-1, release factor-2, release factor-3, ATPs, GTPs, CTPs, UTPs, elongation factor-Tu, natural aminoacyl-tRNA synthetases, natural tRNAs, and/or natural amino acids.


In some embodiments, the OtRNA is derived from Tyr-tRNA, Glu-tRNA, Trp-tRNA, Leu-tRNA, Pyl-tRNA, Phe-tRNA, or amber-tRNA. In some embodiments, the OtRNA comprises a nucleotide sequence of any one of SEQ ID NOs: 5-7. In some embodiments, the ORS is derived from TyrRS, GluRS, TrpRS, LeuRS, PylRS, PheRS, or amberRS. In some embodiments, the ORS comprises an amino acid sequence of any one of SEQ ID NOs: 330-361. In some embodiments, the ORS is encoded by a polynucleotide comprising the nucleic acid sequence of any one of SEQ ID NOs: 299-329.


In some embodiments, the unnatural amino acid is selected from the group consisting of: O-methyl-L-tyrosine, L-3-(2-naphthyl)alanine, 3-methyl-phenylalanine, O-4-allyl-L-tyrosine, 4-propyl-L-tyrosine, tri-O-acetyl-GlcNAcβ-serine, L-dopa, fluorinated phenylalanine, isopropyl-L-phenylalanine, p-azido-L-phenylalanine, p-acyl-L-phenylalanine, p-benzoyl-L-phenylalanine, L-phosphoserine, phosphonoserine, phosphonotyrosine, p-iodo-phenylalanine, p-bromophenylalanine, p-amino-L-phenylalanine, and isopropyl-L-phenylalanine.


In some embodiments, the unnatural amino acid is selected from the group consisting of: unnatural analogues of tyrosine, unnatural analogues of glutamine, unnatural analogues of phenylalanine, unnatural analogues of serine, unnatural analogues of threonine, unnatural analogues of alanine, unnatural analogues of cysteine, unnatural analogues of aspartic acid, unnatural analogues of glutamic acid, unnatural analogues of glycine, unnatural analogues of histidine, unnatural analogues of isoleucine, unnatural analogues of lysine, unnatural analogues of leucine, unnatural analogues of methionine, unnatural analogues of asparagine, unnatural analogues of proline, unnatural analogues of arginine, unnatural analogues of valine, and unnatural analogues of tryptophan.


In some embodiments, the unnatural amino acid is selected from the group consisting of: alkyl, aryl, acyl, azido, cyano, halo, hydrazine, hydrazide, hydroxyl, alkenyl, alkynl, ether, thiol, sulfonyl, seleno, ester, thioacid, borate, boronate, phospho, phosphono, phosphine, heterocyclic, enone, imine, aldehyde, hydroxylamine, keto, and amino-substituted amino acids, and any combinations thereof.


In some embodiments, the unnatural amino acid is selected from the group consisting of: amino acids with a photoactivatable cross-linker; spin-labeled amino acids; fluorescent amino acids; amino acids with a novel functional group; amino acids that covalently or noncovalently interacts with another molecule; metal binding amino acids; metal-containing amino acids; radioactive amino acids; photocaged and/or photoisomerizable amino acids; biotin or biotin-analogue containing amino acids; glycosylated or carbohydrate modified amino acids; keto containing amino acids; amino acids comprising polyethylene glycol or polyether; heavy atom substituted amino acids; chemically cleavable or photocleavable amino acids; amino acids with an elongated side chain; amino acids containing a toxic group; sugar substituted amino acids; carbon-linked sugar-containing amino acids; redox-active amino acid; a-hydroxy-containing acids; amino thio acid containing amino acid; α,α di-substituted amino acids; β-amino acids; and cyclic amino acids other than proline.


In some embodiments, the unnatural amino acid is selected from any unnatural amino acid in FIG. 3. In some embodiments, the unnatural amino acid comprises a click chemistry handle. In some embodiments, the click chemistry handle is an azide moiety. In some embodiments, the click chemistry handle is an alkyne moiety. In some embodiments, the click chemistry handle is an aziridine moiety. In some embodiments, the handle allows attachment of other chemical moieties to the protein.


In some embodiments, the other chemical moiety directs the protein for degradation by the proteasome. In some embodiments, the chemical moiety is selected from the group consisting of: thalidomide, pathalimide, PROTACs, and lenalidomide.


In some embodiments, the click chemistry handle enables the attachment of a localization signal to the protein. In some embodiments, the localization signal directs the localization of the protein to the nucleus, mitochondria, periplasm, or membrane.


In some embodiments, the click chemistry handle enables the attachment of chemical moieties that mimic post-translational modification of the protein, thereby altering the function of the protein. In some embodiments, the post-translational modification is lipidation, glycosylation, acetylation, methylation, or phosphorylation.


In some embodiments, the click chemistry handle enables the attachment of programmable interaction tags to the protein. In some embodiments, the programmable interaction tag is SNAP-tag, HALO-tag, Rapamycin, CLIP tag, or FK-506. In some embodiments, the programmable interaction tags allow the target protein to form complexes with other proteins.


In some embodiments, the protein is a therapeutic protein. In some embodiments, the protein is selected from the group consisting of: alpha-1 antitrypsin, angiostatin, antihemolytic factor, antibodies, apolipoprotein, apoprotein, atrial natriuretic factors, atrial natriuretic polypeptide, atrial peptides, C-X-C chemokine, T39765, NAP-2, ENA-78, Gro-a, Gro-b, Gro-c, IP-10, GCP-2, NAP-4, SDF-1, PF4, MIG, calcitonin, c-kit ligand, cytokines, CC chemokines, monocyte chemoattractant protein-1, monocyte chemoattractant protein-2, monocyte chemoattractant protein-3, monocyte inflammatory protein-1 alpha, monocyte inflammatory protein-i beta, RANTES, 1309, R83915, R91733, HCC1, T58847, D31065, T64262, CD40, CD40 ligand, hyalurin/CD44, C-kit Ligand, collagen, colony stimulating factor (CSF), complement factor 5a, complement inhibitor, complement receptor 1, cytokine, epithelial neutrophil activating peptide-78, GROα/MGSA, GROβ, GROγ, MIP-1α, MIP-16, MCP-1, epidermal growth factor (EGF), epithelial neutrophil activating peptide, erythropoietin (EPO), transcriptional activators, transcriptional suppressors, exfoliating toxin, factor IX, factor VII, factor VIII, factor X, fibroblast growth factor (FGF), fibrinogen, fibronectin, G-CSF, GM-CSF, glucocerebrosidase, gonadotropin, growth factors, growth factor receptors, hedgehog protein, hemoglobin, hepatocyte growth factor (HGF), signal transduction molecules, Hirudin, human serum albumin, ICAM-1, ICAM-1 receptors, LFA-1, LFA-1 receptors, insulin, insulin-like growth factors (IGF), IGF-I, IGF-II, interferons, IFN-α, IFN-β, IFN-γ, interleukin, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, keratinocyte growth factor (KGF), lactoferrin, leukemia inhibitory factor, luciferase, neurturin, neutrophil inhibitory factors (NIF), oncostatin M, osteogenic proteins, oncogene products, parathyroid hormone, PD-ECSF, PDGF, peptide hormones, human growth hormone, pleiotropin, protein A, protein G, pyrogenic exotoxins A, B, or C, relaxin, renin, SCF, soluble complement receptor I, soluble I-CAM 1, soluble interleukin receptors, TNF, soluble TNF receptors, somatomedin, somatostatin, somatotropin, streptokinase, superantigens, staphylococcal enterotoxins, SEA, SEB, SEC1, SEC2, SEC3, SED, SEE, steroid hormone receptors, superoxide dismutase, toxic shock syndrome toxins, thymosin alpha 1, tissue plasminogen activators, tumor growth factors (TGF), TGF-α, TGF-β, tumor necrosis factors, tumor necrosis factor alpha, tumor necrosis factor beta, tumor necrosis factor receptor (TNFR), VLA-4 proteins, VCAM-1 protein, vascular endothelial growth factor (VEGEF), urokinase, Mos, Ras, Raf, Met, p53, Tat, Fos, Myc, Jun, Myb, Rel, estrogen receptors, progesterone receptors, testosterone receptors, aldosterone receptors, BRD4, PRSS2, and LDL receptors.


In some embodiments, 1, 2, 3, 4, 5, 6, 7, 8, or more types of unnatural amino acids are incorporated into the protein of interest simultaneously. In some embodiments, the unnatural amino acid is incorporated into 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more proteins of interest. In some embodiments, the unnatural amino acid is incorporated proteome-wide. In some embodiments, a plurality of guide nucleotide sequences are used.


In some embodiments, the protein of interest is BRD4 or PRSS2. In some embodiments, the guide nucleotide sequence is a RNA. In some embodiments, the guide nucleotide sequence is selected from SEQ ID NOs: 367-373.


In some embodiments, the method is carried out in vitro. In some embodiments, The method of any one of claims 1-87, wherein the method is carried out in a cell. In some embodiments, the cell is a bacterial cell. In some embodiments, the cell is an Escherichia coli cell. In some embodiments, the cell is a mammalian cell. In some embodiments, the cell is a human cell.


Other aspects of the present disclosure provide cells comprising the fusion protein and the translation system described here, or cells comprising a polynucleotide encoding the fusion protein and the guide nucleotide sequence described herein.


In some embodiments, the cell further comprises the OtRNA and the ORS described herein or nucleic acid vectors encoding the OtRNA and the ORS described herein.


Other aspects of the present disclosure provide compositions comprising the fusion protein and the translation system described herein. In some embodiments, the composition further comprises unnatural amino acids.


Other aspects of the present disclosure provide kits comprising nucleic acid vectors for the expression of the fusion protein and the guide nucleotide sequence described herein. In some embodiments, the kit further comprises the translation system described herein. In some embodiments, the kit further comprises unnatural amino acids. In some embodiments, the kit further comprises instructions for use.


Other aspects of the present disclosure provide kits for in vitro incorporation of unnatural amino acids into a protein of interest comprising: (i) a fusion protein comprising (a) a guide nucleotide sequence-programmable DNA-binding protein domain; and (b) a cytosine deaminase domain, wherein the fusion protein is associated with a guide nucleotide sequence, and whereby the contacting results in changing a target codon to a stop codon or a rare codon via deamination of a cytosine (C) base; and (ii) a translation system comprising (a) an orthogonal tRNA (OtRNA); (b) an orthogonal aminoacyl tRNA synthetase (ORS); and (c) an unnatural amino acid, wherein the ORS preferentially aminoacylates the OtRNA with the unnatural amino acid, and the OtRNA recognizes at least one suppressible stop codon.


In some embodiments, the kit further comprises components needed for the translation of the protein. In some embodiments, the components comprise isolated RNA polymerases, isolated translation initiation factor, isolated ribosomes, isolated release factor-1, isolated release factor-2, isolated release factor-3, ATPs, GTPs, CTPs, UTPs, isolated elongation factor-Tu, natural aminoacyl-tRNA synthetases, natural tRNAs, natural amino acids, and/or unnatural amino acids. In some embodiments, the kit further comprises instructions for use.


Other aspects of the present disclosure provide methods of incorporating an unnatural amino acid into a protein of interest at one or more specific position(s), the method comprising: (i) contacting a polynucleotide encoding the protein of interest with a fusion protein comprising (a) a programmable DNA-binding protein domain; and (b) a deaminase domain, whereby the contacting results in changing a target codon to a stop codon or a rare codon via deamination of a target base; (ii) using the polynucleotide containing the stop or rare codon in a translation system, whereby the unnatural amino acids are incorporated into the protein of interest at the suppressible stop codon or rare codon during translation of the protein, wherein the polynucleotide comprises a coding strand and a complementary strand.


In some embodiments, the programmable DNA-binding domain is a Zinc Finger Nuclease domain. In some embodiments, the programmable DNA-binding domain is a TALEN domain.


In some embodiments, the programmable DNA-binding domain is a guide nucleotide sequence-programmable DNA binding protein domain.


In some embodiments, the programmable DNA-binding domain is selected from the group consisting of: nuclease-inactive Cas9 domains, nuclease inactive Cpf1 domains, nuclease inactive Argonaute domains, and variants thereof. In some embodiments, wherein the programmable DNA-binding domain is associated with a guide nucleotide sequence.


In some embodiments, the deaminase is a cytosine deaminase. In some embodiments, the target base is a cytosine (C) base and the deamination of the target C base results in a C to thymine (T) change.


The details of certain embodiments of the disclosure are set forth in the Detailed Description of Certain Embodiments, as described below. Other features, objects, and advantages of the disclosure will be apparent from the Definitions, Examples, Figures, and Claims.





BRIEF DESCRIPTION OF THE DRAWINGS

The accompanying drawings, which constitute a part of this specification, illustrate several embodiments of the disclosure and together with the description, serve to explain the principles of the disclosure.



FIG. 1 shows the mechanism of stop-codon suppression to introduce unnatural amino acids into a protein. The mechanism is shown during the ribosomal translation of an arbitrary mRNA sequence derived from a protein-coding gene that can be edited using a Cas9 base editor (a dCas9-deaminase fusion protein)1-4,8-10,13,16.



FIG. 2 shows examples of high-throughput proteome-wide applications enabled by the present disclosure.



FIG. 3 shows examples of functionalized amino acids that can be introduced into living cells using the present disclosure4.



FIG. 4 shows the synthesis of probe reagents for programmable induction of protein degradation, each of which is known to react with available unnatural amino acids (shown in FIG. 3).



FIG. 5 shows the synthesis of probe reagents for programmable plasma-membrane interaction, each of which is known to react with available unnatural amino acids (shown in FIG. 3).



FIG. 6 shows the synthesis of probe reagents for programmable nuclear or mitochondrial co-localization, each of which is known to react with available unnatural amino acids (shown in FIG. 3). The nuclear localization signal (NLS) corresponds to SEQ ID NO: 9. Similar chemistry is possible with a mitochondrial transport signal (MTS) peptide (SEQ ID NO: 10) as shown.



FIG. 7 shows the synthesis probe reagents for programmable formation of hetero-dimeric protein complexes, each of which is known to react with available unnatural amino acids (shown in FIG. 3). Similar chemistry is possible with the SNAP-tag and CLIP-tag as shown.



FIG. 8A shows the orthogonal charging of tRNAs and the application of multiplexed stop-codon suppression after base-editing.



FIG. 8B shows all possible transformations to stop codons, which are boxed.





DEFINITIONS

As used herein and in the claims, the singular forms “a,” “an,” and “the” include the singular and the plural reference unless the context clearly indicates otherwise. Thus, for example, a reference to “an agent” includes a single agent and a plurality of such agents.


The term “translation system” refers to the components necessary to incorporate a naturally occurring amino acid into a growing polypeptide chain (protein). Components of a translation system can include, e.g., ribosomes, tRNAs, synthetases, mRNAs, and the like.


As used herein, the term “unnatural amino acid” refers to any amino acid, modified amino acid, and/or amino acid analogue that is not one of the 20 naturally occurring amino acids or seleno cysteine.


As used herein, the term “orthogonal” refers to a molecule (e.g., an orthogonal tRNA (OtRNA) and/or an orthogonal aminoacyl tRNA synthetase (ORS)) that is used with reduced efficiency by a system of interest (e.g., a translational system, e.g., a cell). Orthogonal refers to the inability or reduced efficiency, e.g., less than 20% efficient, less than 10% efficient, less than 5% efficient, or e.g., less than 1% efficient, of an orthogonal tRNA and/or orthogonal RS to function on the endogenous translation machinery. For example, an orthogonal tRNA in a translation system of interest aminoacylates any endogenous RS of a translation system of interest with reduced or even zero efficiency, when compared to aminoacylation of an endogenous tRNA by the endogenous RS. In another example, an orthogonal RS aminoacylates any endogenous tRNA in the translation system of interest with reduced or even zero efficiency, as compared to aminoacylation of the endogenous tRNA by an endogenous RS.


The term “proteome” refers to the entire set of proteins expressed by a genome, cell, tissue, or organism at a certain time. More specifically, it is the set of expressed proteins in a given type of cell or organism, at a given time, under certain conditions. The term is a blend of proteins and genome. “Proteome-wide” refers to each and every protein in the proteome without any bias.


The term “genome” refers to the genetic material of a cell or organism. It typically includes DNA (or RNA in the case of RNA viruses). The genome includes both the genes, the coding regions, the noncoding DNA, and the genomes of the mitochondria and chloroplasts. A genome does not typically include genetic material that is artificially introduced into a cell or organism, e.g., a plasmid that is transformed into a bacteria is not a part of the bacterial genome.


The term “interactome” refers to the whole set of molecular interactions in a particular cell. The term specifically refers to physical interactions among molecules (such as those among proteins, also known as protein-protein interactions) but can also describe sets of indirect interactions among genes (genetic interactions). Molecular interactions can occur between molecules belonging to different biochemical families (proteins, nucleic acids, lipids, carbohydrates, metabolites, etc.) and also within a given family. Whenever such molecules are connected by physical interactions, they form molecular interaction networks that are generally classified by the nature of the compounds involved. Most commonly, interactome refers to protein-protein interaction (PPI) networks (PIN) or subsets thereof.


A “programmable DNA-binding protein,” as used herein, refers to DNA binding proteins that can be programmed to navigate to any desired target nucleotide sequence within the genome. To program the DNA-binding protein to bind a desired nucleotide sequence, the DNA binding protein may be modified to change its binding specificicity, e.g., zinc finger nuclease (ZFN) or transcription activator-like effector proteins (TALE). ZFNs are artificial restriction enzymes generated by fusing a zinc finger DNA-binding domain to a DNA-cleavage domain. Zinc finger domains can be engineered to target specific desired DNA sequences and this enables zinc-finger nucleases to target unique sequences within complex genomes. Transcription activator-like effector nucleases (TALEN) are restriction enzymes that can be engineered to cut specific sequences of DNA. They are made by fusing a TAL effector DNA-binding domain to a DNA cleavage domain (a nuclease which cuts DNA strands). Transcription activator-like effectors (TALEs) can be engineered to bind practically any desired DNA sequence, so when combined with a nuclease, DNA can be cut at specific locations. The restriction enzymes can be introduced into cells, for use in gene editing or for genome editing in situ, Methods of programming ZFNs and TALEs are familiar to one skilled in the art. For example, such methods are described in Maeder, et al., Mol. Cell 31 (2): 294-301, 2008; Carroll et al., Genetics Society of America, 188 (4): 773-782, 2011; Miller et al., Nature Biotechnology 25 (7): 778-785, 2007; Christian et al., Genetics 186 (2): 757-61, 2008; Li et al., Nucleic Acids Res 39 (1): 359-372, 2010; and Moscou et al., Science 326 (5959): 1501, 2009, the entire contents of each of which are incorporated herein by reference.


A “guide nucleotide sequence-programmable DNA-binding protein,” as used herein, refers to a protein, a polypeptide, or a domain that is able to bind DNA, and the binding to its target DNA sequence is mediated by a guide nucleotide sequence. Thus, it is appreciated that the guide nucleotide sequence-programmable DNA-binding protein binds to a guide nucleotide sequence. The “guide nucleotide” may be a RNA molecule or a DNA molecule (e.g., a single-stranded DNA or ssDNA molecule) that is complementary to the target sequence and can guide the DNA binding protein to the target sequence. As such, a guide nucleotide sequence-programmable DNA-binding protein may be a RNA-programmable DNA-binding protein (e.g., a Cas9 protein), or an ssDNA-programmable DNA-binding protein (e.g., an Argonaute protein). “Programmable” means the DNA-binding protein may be programmed to bind any DNA sequence that the guide nucleotide targets.


In some embodiments, the guide nucleotide sequence exists as a single nucleotide molecule and comprises comprise two domains: (1) a domain that shares homology to a target nucleic acid (e.g., and directs binding of a guide nucleotide sequence-programmable DNA-binding protein to the target); and (2) a domain that binds a guide nucleotide sequence-programmable DNA-binding protein. In some embodiments, the guide nucleotide is a guide RNA (gRNA). In some embodiments, domain (2) of the gRNA corresponds to a sequence known as a tracrRNA, and comprises a stem-loop structure. For example, in some embodiments, domain (2) is identical or homologous to a tracrRNA as provided in Jinek et al., Science 337:816-821(2012), the entire contents of which is incorporated herein by reference. Other examples of gRNAs (e.g., those including domain 2) can be found in U.S. Provisional Patent Application, U.S. Ser. No. 61/874,682, filed Sep. 6, 2013, entitled “Switchable Cas9 Nucleases And Uses Thereof,” and U.S. Provisional Patent Application, U.S. Ser. No. 61/874,746, filed Sep. 6, 2013, entitled “Delivery System For Functional Nucleases,” the entire contents of each are hereby incorporated by reference in their entirety.


Because the guide nucleotide sequence hybridizes to target DNA sequence, the guide nucleotide sequence-programmable DNA-binding proteins are able to be targeted, in principle, to any sequence specified by the guide nucleotide sequence. Methods of using guide nucleotide sequence-programmable DNA-binding protein, such as Cas9, for site-specific cleavage (e.g., to modify a genome) are known in the art (see e.g., Cong, L. et al. Science 339, 819-823 (2013); Mali, P. et al. Science 339, 823-826 (2013); Hwang, W. Y. et al. Nature biotechnology 31, 227-229 (2013); Jinek, M. et al. eLife 2, e00471 (2013); Dicarlo, J. E. et al. Nucleic acids research (2013); Jiang, W. et al. Nature biotechnology 31, 233-239 (2013); the entire contents of each of which are incorporated herein by reference).


It is to be understood that any DNA binding domain that is programmable by a guide nucleotide sequence may be used in accordance with the present disclosure. For example, in some embodiments, the guide nucleotide sequence-programmable DNA binding protein may be a Cas9 protein, or a variant thereof. One skilled in the art would understand that the present disclosure is not limited to the use of Cas9 as the guide nucleotide sequence-programmable DNA binding protein, but that other DNA binding proteins that adopt similar mechanism of target sequence binding may also be used.


As used herein, the term “Cas9” or “Cas9 nuclease” refers to an RNA-guided nuclease comprising a Cas9 protein, a fragment, or a variant thereof. A Cas9 nuclease is also referred to sometimes as a casn1 nuclease or a CRISPR (clustered regularly interspaced short palindromic repeat)-associated nuclease. CRISPR is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). In type II CRISPR systems correct processing of pre-crRNA requires a trans-encoded small RNA (tracrRNA), endogenous ribonuclease 3 (rnc) and a Cas9 protein. The tracrRNA serves as a guide for ribonuclease 3-aided processing of pre-crRNA. Subsequently, Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer. The target strand not complementary to crRNA is first cut endonucleolytically, then trimmed 3′-5′ exonucleolytically. In nature, DNA-binding and cleavage typically requires protein and both RNAs. However, single guide RNAs (“sgRNA”, or simply “gNRA”) can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek et al., Science 337:816-821(2012), the entire contents of which is incorporated herein by reference.


Cas9 nuclease sequences and structures are well known to those of skill in the art (see, e.g., Ferretti et al., Proc. Natl. Acad. Sci. 98:4658-4663(2001); Deltcheva E. et al., Nature 471:602-607(2011); and Jinek et al., Science 337:816-821(2012), the entire contents of each of which are incorporated herein by reference). Cas9 orthologs have been described in various species, including, but not limited to, S. pyogenes and S. thermophilus. Additional suitable Cas9 nucleases and sequences will be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski et al., (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference. In some embodiments, wild type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCBI Reference Sequence: NC_002737.2, SEQ ID NO: 4 (nucleotide); and Uniport Reference Sequence: Q99ZW2, SEQ ID NO: 1 (amino acid).










(SEQ ID NO: 4)



ATGGATAAGAAATACTCAATAGGCTTAGATATCGGCACAAATAGCGTCGGATGGGCGGTGATCAC 






TGATGAATATAAGGTTCCGTCTAAAAAGTTCAAGGTTCTGGGAAATACAGACCGCCACAGTATCA 





AAAAAAATCTTATAGGGGCTCTTTTATTTGACAGTGGAGAGACAGCGGAAGCGACTCGTCTCAAA 





CGGACAGCTCGTAGAAGGTATACACGTCGGAAGAATCGTATTTGTTATCTACAGGAGATTTTTTCA 





AATGAGATGGCGAAAGTAGATGATAGTTTCTTTCATCGACTTGAAGAGTCTTTTTTGGTGGAAGAA 





GACAAGAAGCATGAACGTCATCCTATTTTTGGAAATATAGTAGATGAAGTTGCTTATCATGAGAAA 





TATCCAACTATCTATCATCTGCGAAAAAAATTGGTAGATTCTACTGATAAAGCGGATTTGCGCTTA 





ATCTATTTGGCCTTAGCGCATATGATTAAGTTTCGTGGTCATTTTTTGATTGAGGGAGATTTAAATC 





CTGATAATAGTGATGTGGACAAACTATTTATCCAGTTGGTACAAACCTACAATCAATTATTTGAAG 





AAAACCCTATTAACGCAAGTGGAGTAGATGCTAAAGCGATTCTTTCTGCACGATTGAGTAAATCAA 





GACGATTAGAAAATCTCATTGCTCAGCTCCCCGGTGAGAAGAAAAATGGCTTATTTGGGAATCTCA 





TTGCTTTGTCATTGGGTTTGACCCCTAATTTTAAATCAAATTTTGATTTGGCAGAAGATGCTAAATT 





ACAGCTTTCAAAAGATACTTACGATGATGATTTAGATAATTTATTGGCGCAAATTGGAGATCAATA 





TGCTGATTTGTTTTTGGCAGCTAAGAATTTATCAGATGCTATTTTACTTTCAGATATCCTAAGAGTA 





AATACTGAAATAACTAAGGCTCCCCTATCAGCTTCAATGATTAAACGCTACGATGAACATCATCAA 





GACTTGACTCTTTTAAAAGCTTTAGTTCGACAACAACTTCCAGAAAAGTATAAAGAAATCTTTTTT 





GATCAATCAAAAAACGGATATGCAGGTTATATTGATGGGGGAGCTAGCCAAGAAGAATTTTATAA 





ATTTATCAAACCAATTTTAGAAAAAATGGATGGTACTGAGGAATTATTGGTGAAACTAAATCGTGA 





AGATTTGCTGCGCAAGCAACGGACCTTTGACAACGGCTCTATTCCCCATCAAATTCACTTGGGTGA 





GCTGCATGCTATTTTGAGAAGACAAGAAGACTTTTATCCATTTTTAAAAGACAATCGTGAGAAGAT 





TGAAAAAATCTTGACTTTTCGAATTCCTTATTATGTTGGTCCATTGGCGCGTGGCAATAGTCGTTTT 





GCATGGATGACTCGGAAGTCTGAAGAAACAATTACCCCATGGAATTTTGAAGAAGTTGTCGATAA 





AGGTGCTTCAGCTCAATCATTTATTGAACGCATGACAAACTTTGATAAAAATCTTCCAAATGAAAA 





AGTACTACCAAAACATAGTTTGCTTTATGAGTATTTTACGGTTTATAACGAATTGACAAAGGTCAA 





ATATGTTACTGAAGGAATGCGAAAACCAGCATTTCTTTCAGGTGAACAGAAGAAAGCCATTGTTG 





ATTTACTCTTCAAAACAAATCGAAAAGTAACCGTTAAGCAATTAAAAGAAGATTATTTCAAAAAA 





ATAGAATGTTTTGATAGTGTTGAAATTTCAGGAGTTGAAGATAGATTTAATGCTTCATTAGGTACC 





TACCATGATTTGCTAAAAATTATTAAAGATAAAGATTTTTTGGATAATGAAGAAAATGAAGATATC 





TTAGAGGATATTGTTTTAACATTGACCTTATTTGAAGATAGGGAGATGATTGAGGAAAGACTTAAA 





ACATATGCTCACCTCTTTGATGATAAGGTGATGAAACAGCTTAAACGTCGCCGTTATACTGGTTGG 





GGACGTTTGTCTCGAAAATTGATTAATGGTATTAGGGATAAGCAATCTGGCAAAACAATATTAGAT 





TTTTTGAAATCAGATGGTTTTGCCAATCGCAATTTTATGCAGCTGATCCATGATGATAGTTTGACAT 





TTAAAGAAGACATTCAAAAAGCACAAGTGTCTGGACAAGGCGATAGTTTACATGAACATATTGCA 





AATTTAGCTGGTAGCCCTGCTATTAAAAAAGGTATTTTACAGACTGTAAAAGTTGTTGATGAATTG 





GTCAAAGTAATGGGGCGGCATAAGCCAGAAAATATCGTTATTGAAATGGCACGTGAAAATCAGAC 





AACTCAAAAGGGCCAGAAAAATTCGCGAGAGCGTATGAAACGAATCGAAGAAGGTATCAAAGAA 





TTAGGAAGTCAGATTCTTAAAGAGCATCCTGTTGAAAATACTCAATTGCAAAATGAAAAGCTCTAT 





CTCTATTATCTCCAAAATGGAAGAGACATGTATGTGGACCAAGAATTAGATATTAATCGTTTAAGT 





GATTATGATGTCGATCACATTGTTCCACAAAGTTTCCTTAAAGACGATTCAATAGACAATAAGGTC 





TTAACGCGTTCTGATAAAAATCGTGGTAAATCGGATAACGTTCCAAGTGAAGAAGTAGTCAAAAA 





GATGAAAAACTATTGGAGACAACTTCTAAACGCCAAGTTAATCACTCAACGTAAGTTTGATAATTT 





AACGAAAGCTGAACGTGGAGGTTTGAGTGAACTTGATAAAGCTGGTTTTATCAAACGCCAATTGG 





TTGAAACTCGCCAAATCACTAAGCATGTGGCACAAATTTTGGATAGTCGCATGAATACTAAATACG 





ATGAAAATGATAAACTTATTCGAGAGGTTAAAGTGATTACCTTAAAATCTAAATTAGTTTCTGACT 





TCCGAAAAGATTTCCAATTCTATAAAGTACGTGAGATTAACAATTACCATCATGCCCATGATGCGT 





ATCTAAATGCCGTCGTTGGAACTGCTTTGATTAAGAAATATCCAAAACTTGAATCGGAGTTTGTCT 





ATGGTGATTATAAAGTTTATGATGTTCGTAAAATGATTGCTAAGTCTGAGCAAGAAATAGGCAAA 





GCAACCGCAAAATATTTCTTTTACTCTAATATCATGAACTTCTTCAAAACAGAAATTACACTTGCA 





AATGGAGAGATTCGCAAACGCCCTCTAATCGAAACTAATGGGGAAACTGGAGAAATTGTCTGGGA 





TAAAGGGCGAGATTTTGCCACAGTGCGCAAAGTATTGTCCATGCCCCAAGTCAATATTGTCAAGAA 





AACAGAAGTACAGACAGGCGGATTCTCCAAGGAGTCAATTTTACCAAAAAGAAATTCGGACAAGC 





TTATTGCTCGTAAAAAAGACTGGGATCCAAAAAAATATGGTGGTTTTGATAGTCCAACGGTAGCTT 





ATTCAGTCCTAGTGGTTGCTAAGGTGGAAAAAGGGAAATCGAAGAAGTTAAAATCCGTTAAAGAG 





TTACTAGGGATCACAATTATGGAAAGAAGTTCCTTTGAAAAAAATCCGATTGACTTTTTAGAAGCT 





AAAGGATATAAGGAAGTTAAAAAAGACTTAATCATTAAACTACCTAAATATAGTCTTTTTGAGTTA 





GAAAACGGTCGTAAACGGATGCTGGCTAGTGCCGGAGAATTACAAAAAGGAAATGAGCTGGCTCT 





GCCAAGCAAATATGTGAATTTTTTATATTTAGCTAGTCATTATGAAAAGTTGAAGGGTAGTCCAGA 





AGATAACGAACAAAAACAATTGTTTGTGGAGCAGCATAAGCATTATTTAGATGAGATTATTGAGC 





AAATCAGTGAATTTTCTAAGCGTGTTATTTTAGCAGATGCCAATTTAGATAAAGTTCTTAGTGCAT 





ATAACAAACATAGAGACAAACCAATACGTGAACAAGCAGAAAATATTATTCATTTATTTACGTTG 





ACGAATCTTGGAGCTCCCGCTGCTTTTAAATATTTTGATACAACAATTGATCGTAAACGATATACG 





TCTACAAAAGAAGTTTTAGATGCCACTCTTATCCATCAATCCATCACTGGTCTTTATGAAACACGC 





ATTGATTTGAGTCAGCTAGGAGGTGACTGA





(SEQ ID NO: 1)



MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETALATRLKRTAR 






RRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLR





KKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDA 





KAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDN





LLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEK 





YKEIFFDQSKNGYAGYIDGGASQLEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHL





GELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGA





SAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFK 





TNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLT





LFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRN





FMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVI






EMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQEL







DINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRK







FDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSD







FRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKA 







TAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQ 







TGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIME






RSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLA





SHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENI





IHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD 


(single underline: HNHdomain; double underline: RuvC domain)






In some embodiments, Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs: NC_016782.1, NC_016786.1); Spiroplasma syrphidicola (NCBI Ref: NC_021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma taiwanense (NCBI Ref: NC_021846.1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquisI (NCBI Ref: NC_018721.1); Streptococcus thermophilus (NCBI Ref: YP_820832.1), Listeria innocua (NCBI Ref: NP_472073.1), Campylobacter jejuni (NCBI Ref: YP_002344900.1) or Neisseria meningitidis (NCBI Ref: YP_002342100.1) or to a Cas9 from any of the organisms listed in Example 1 (SEQ ID NOs: 11-260).


To be used as in the fusion protein of the present disclosure as the guide nucleotide sequence-programmable DNA binding protein domain, a Cas9 protein needs to be nuclease inactive. A nuclease-inactive Cas9 protein may interchangeably be referred to as a “dCas9” protein (for nuclease-“dead” Cas9). Methods for generating a Cas9 protein (or a fragment thereof) having an inactive DNA cleavage domain are known (See, e.g., Jinek et al., Science. 337:816-821(2012); Qi et al., (2013) Cell. 28;152(5):1173-83, the entire contents of each of which are incorporated herein by reference). For example, the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvC1 subdomain. The HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvC1 subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9. For example, the mutations D10A and H840A completely inactivate the nuclease activity of S. pyogenes Cas9 (Jinek et al., Science. 337:816-821(2012); Qi et al., Cell. 28;152(5):1173-83 (2013)).










dCas9 (D10A and H840A)



(SEQ ID NO: 2)



MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTAR






RRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLR





KKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDA 





KAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDN





LLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEK





YKEIFFDQSKNGYAGYIDGGASQLEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHL





GELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGA





SAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFK 





TNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLT





LFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRN





FMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVI






EMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQEL







DINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRK







FDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSD 







FRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKA 







TAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQ 







TGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIME 






RSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLA





SHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENI





IHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRI


(single underline: HNHdomain; double underline: RuvC domain). 






The dCas9 of the present disclosure encompasses completely inactive Cas9 or partially inactive Cas9. For example, the dCas9 may have one of the two nuclease domain inactivated, while the other nuclease domain remains active. Such a partially active Cas9 may also be referred to as a Cas9 nickase, due to its ability to cleave one strand of the targeted DNA sequence. The Cas9 nickase suitable for use in accordance with the present disclosure has an active HNH domain and an inactive RuvC domain and is able to cleave only the strand of the target DNA that is bound by the sgRNA. The Cas9 nickase of the present disclosure may comprise mutations that inactivate the RuvC domain, e.g., a D10A mutation. It is to be understood that any mutation that inactivates the RuvC domain may be included in a Cas9 nickase, e.g., insertion, deletion, or single or multiple amino acid substitution in the RuvC domain. In a Cas9 nickase described herein, while the RuvC domain is inactivated, the HNH domain remains activate. Thus, while the Cas9 nickase may comprise mutations other than those that inactivate the RuvC domain (e.g., D10A), those mutations do not affect the activity of the HNH domain. In a non-limiting Cas9 nickase example, the histidine at position 840 remains unchanged. The sequence of an exemplary Cas9 nickase suitable for the present disclosure is provided below.










Cas9 Nickase (D10A)



(SEQ ID NO: 3)



MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTAR






RRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLR





KKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDA 





KAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDN





LLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEK 





YKEIFFDQSKNGYAGYIDGGASQLEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHL





GELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGA





SAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFK 





TNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLT





LFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRN





FMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVI






EMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQEL







DINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRK







FDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSD







FRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKA 







TAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQ 







TGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIME






RSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLA





SHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENI





IHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD 


(single underline: HNHdomain; double underline: RuvC domain)






It is appreciated that when the term “dCas9” or “nuclease-inactive Cas9” is used herein, it refers to Cas9 variants that are inactive in both HNH and RuvC domains as well as Cas9 nickases. For example, the dCas9 used in the present disclosure may include the amino acid sequence set forth in SEQ ID NO: 2 or SEQ ID NO: 3. In some embodiments, the dCas9 may comprise other mutations that inactivate RuvC or HNH domain. Additional suitable mutations that inactivate Cas9 will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure. Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D839A and/or N863A (See, e.g., Prashant et al., Nature Biotechnology. 2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference), or K603R (See, e.g., Chavez et al., Nature Methods 12, 326-328, 2015, the entire contents of which is incorporated herein by reference). The term Cas9, dCas9, or Cas9 variant also encompasses Cas9, dCas9, or Cas9 variant from any organism. Also appreciated is that dCas9, Cas9 nickase, or other appropriate Cas9 variants from any organisms may be used in accordance with the present disclosure.


A “deaminase” refers to an enzyme that catalyzes the removal of an amine group from a molecule, or deamination. In some embodiments, the deaminase is a cytidine deaminase, catalyzing the hydrolytic deamination of cytidine or deoxycytidine to uridine or deoxyuridine, respectively. In some embodiments, the deaminase is a cytosine deaminase, catalyzing the hydrolytic deamination of cytosine to uracil (e.g., in RNA) or thymine (e.g., in DNA). In some embodiments, the deaminase is a naturally-occurring deaminase from an organism, such as a human, chimpanzee, gorilla, monkey, cow, dog, rat, or mouse. In some embodiments, the deaminase is a variant of a naturally-occurring deaminase from an organism, that does not occur in nature. For example, in some embodiments, the deaminase or deaminase domain is at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75% at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring deaminase from an organism. A “cytosine deaminase” refers to an enzyme that catalyzes the chemical reaction “cytosine+H2Ocustom characteruracil+NH3.” As it may be apparent from the reaction formula, such chemical reactions result in a C to U/T nucleobase change. In the context of a gene, such nucleotide change, or mutation, may in turn lead to an amino acid residue change in the protein, which may affect the protein function, e.g., loss-of-function or gain-of-function.


One exemplary suitable class of cytosine deaminases is the apolipoprotein B mRNA-editing complex (APOBEC) family of cytosine deaminases encompassing eleven proteins that serve to initiate mutagenesis in a controlled and beneficial manner. The apolipoprotein B editing complex 3 (APOBEC3) enzyme provides protection to human cells against a certain HIV-1 strain via the deamination of cytosines in reverse-transcribed viral ssDNA. These cytosine deaminases all require a Zn2+-coordinating motif (His-X-Glu-X23-26-Pro-Cys-X2-4-Cys; SEQ ID NO: 289) and bound water molecule for catalytic activity. The Glu residue acts to activate the water molecule to a zinc hydroxide for nucleophilic attack in the deamination reaction. Each family member preferentially deaminates at its own particular “hotspot”, ranging from WRC (W is A or T, R is A or G) for hAID, to TTC for hAPOBEC3F. A recent crystal structure of the catalytic domain of APOBEC3G revealed a secondary structure comprised of a five-stranded β-sheet core flanked by six a-helices, which is believed to be conserved across the entire family. The active center loops have been shown to be responsible for both ssDNA binding and in determining “hotspot” identity. Overexpression of these enzymes has been linked to genomic instability and cancer, thus highlighting the importance of sequence-specific targeting. Another suitable cytosine deaminase is the activation-induced cytidine deaminase (AID), which is responsible for the maturation of antibodies by converting cytosines in ssDNA to uracils in a transcription-dependent, strand-biased fashion.


“Base editors” or “nucleobase editors,” as used herein, broadly refer to any of the fusion proteins described herein and in some embodiments, are capable of precisely deaminase a target base to convert it to a different base, e.g., the base editor may target C bases in a nucleic acid sequence and convert to T base. As such, a base editor may be a cytosine deaminase-dCas9 fusion protein. In some embodiments, the base editor may be a deaminase-dCas9-UGI fusion protein. In some embodiments, the base editor may be a APOBEC1-dCas9-UGI fusion protein. In some embodiments, the base editor may be APOBEC1-Cas9 nickase-UGI fusion protein. In some embodiments, the base editor may be APOBEC1-dCpf1-UGI fusion protein. In some embodiments, the base editor may be APOBEC1-dNgAgo-UGI fusion protein. In some embodiments, the base editor may be a pmCDA1-Cas9 nickase-UGI fusion protein. In some embodiments, the base editor may be a human APOBEC3G-Cas9 nickase UGI fusion protein. Non-limiting exemplary sequences of the nucleobase editors described herein are provided in Example 1, SEQ ID NOs: 291-295 and 382-386. Such nucleobase editors and methods of using them for genome editing have been described in the art, e.g., in U.S. Pat. No. 9,068,179, US Patent Application Publications US 20150166980, US 20150166981, US 20150166982, US 20150166984, and US 20150165054, and U.S. Provisional Applications, U.S. Ser. No. 62/245,828, 62/279,346, 62/311,763, 62/322,178, and 62/357,352, and 62/370,700, 62/398,490, 62/498,686, PCT Application No. PCT/US2016/058344, U.S. patent application Ser. No. 15/331,852, and in Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage, Nature, 533(7603):420-4, 2016, the entire contents of each of which are incorporated herein by reference.


The term “target site” or “target sequence” refers to a sequence within a nucleic acid molecule (e.g., a DNA molecule) that is deaminated by the fusion protein provided herein. In some embodiments, the target sequence is a polynucleotide (e.g., a DNA), wherein the polynucleotide comprises a coding strand and a complementary strand. The meaning of a “coding strand” and “complementary strand” is the common meaning of the terms in the art. In some embodiments, the target sequence is a sequence in the genome of a mammal. In some embodiments, the target sequence is a sequence in the genome of a human. The term “target codon” refers to the amino acid codon that is edited by the base editor and converted to a different codon via deamination of C base. In some embodiments, the target codon is edited in the coding strand. In some embodiments, the target codon is edited in the complementary strand.


The term “linker,” as used herein, refers to a chemical group or a molecule linking two molecules or moieties, e.g., two domains of a fusion protein, such as, for example, a nuclease-inactive Cas9 domain and a nucleic acid editing domain (e.g., a deaminase domain). Typically, the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two. In some embodiments, the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein). In some embodiments, the linker is an organic molecule, group, polymer, or chemical moiety. In some embodiments, the linker is 5-100 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 30-35, 35-40, 40-45, 45-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-150, or 150-200 amino acids in length. Longer or shorter linkers are also contemplated.


The term “mutation,” as used herein, refers to a substitution of a residue within a sequence, e.g., a nucleic acid or amino acid sequence, with another residue, or a deletion or insertion of one or more residues within a sequence. Mutations are typically described herein by identifying the original residue followed by the position of the residue within the sequence and by the identity of the newly substituted residue. Various methods for making the amino acid substitutions (mutations) provided herein are well known in the art, and are provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)).


The terms “nucleic acid” and “nucleic acid molecule,” as used herein, refer to a compound comprising a nucleobase and an acidic moiety, e.g., a nucleoside, a nucleotide, or a polymer of nucleotides. Typically, polymeric nucleic acids, e.g., nucleic acid molecules comprising three or more nucleotides are linear molecules, in which adjacent nucleotides are linked to each other via a phosphodiester linkage. In some embodiments, “nucleic acid” refers to individual nucleic acid residues (e.g. nucleotides and/or nucleosides). In some embodiments, “nucleic acid” refers to an oligonucleotide chain comprising three or more individual nucleotide residues. As used herein, the terms “oligonucleotide” and “polynucleotide” can be used interchangeably to refer to a polymer of nucleotides (e.g., a string of at least three nucleotides). In some embodiments, “nucleic acid” encompasses RNA as well as single and/or double-stranded DNA. Nucleic acids may be naturally occurring, for example, in the context of a genome, a transcript, an mRNA, tRNA, rRNA, siRNA, snRNA, a plasmid, cosmid, chromosome, chromatid, or other naturally occurring nucleic acid molecule. On the other hand, a nucleic acid molecule may be a non-naturally occurring molecule, e.g., a recombinant DNA or RNA, an artificial chromosome, an engineered genome, or fragment thereof, or a synthetic DNA, RNA, DNA/RNA hybrid, or including non-naturally occurring nucleotides or nucleosides. Furthermore, the terms “nucleic acid,” “DNA,” “RNA,” and/or similar terms include nucleic acid analogs, e.g., analogs having other than a phosphodiester backbone. Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, and backbone modifications. A nucleic acid sequence is presented in the 5′ to 3′ direction unless otherwise indicated. In some embodiments, a nucleic acid is or comprises natural nucleosides (e.g. adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine); nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, O(6)-methylguanine, and 2-thiocytidine); chemically modified bases; biologically modified bases (e.g., methylated bases); intercalated bases; modified sugars (e.g., 2′-fluororibose, ribose, 2′-deoxyribose, arabinose, and hexose); and/or modified phosphate groups (e.g., phosphorothioates and 5′-N-phosphoramidite linkages).


The terms “protein,” “peptide,” and “polypeptide” are used interchangeably herein, and refer to a polymer of amino acid residues linked together by peptide (amide) bonds. The terms refer to a protein, peptide, or polypeptide of any size, structure, or function. Typically, a protein, peptide, or polypeptide will be at least three amino acids long. A protein, peptide, or polypeptide may refer to an individual protein or a collection of proteins. One or more of the amino acids in a protein, peptide, or polypeptide may be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modification, etc. A protein, peptide, or polypeptide may also be a single molecule or may be a multi-molecular complex. A protein, peptide, or polypeptide may be just a fragment of a naturally occurring protein or peptide. A protein, peptide, or polypeptide may be naturally occurring, recombinant, or synthetic, or any combination thereof. The term “fusion protein” as used herein refers to a hybrid polypeptide which comprises protein domains from at least two different proteins. One protein may be located at the amino-terminal (N-terminal) portion of the fusion protein or at the carboxy-terminal (C-terminal) protein thus forming an “amino-terminal fusion protein” or a “carboxy-terminal fusion protein,” respectively. A protein may comprise different domains, for example, a nucleic acid binding domain (e.g., the gRNA binding domain of Cas9 that directs the binding of the protein to a target site) and a nucleic acid cleavage domain or a catalytic domain of a nucleic-acid editing protein. In some embodiments, a protein comprises a proteinaceous part, e.g., an amino acid sequence constituting a nucleic acid binding domain, and an organic compound, e.g., a compound that can act as a nucleic acid cleavage agent. In some embodiments, a protein is in a complex with, or is in association with, a nucleic acid, e.g., RNA. Any of the proteins provided herein may be produced by any method known in the art. For example, the proteins provided herein may be produced via recombinant protein expression and purification, which is especially suited for fusion proteins comprising a peptide linker. Methods for recombinant protein expression and purification are well known, and include those described by Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)), the entire contents of which are incorporated herein by reference.


The term “subject,” as used herein, refers to an individual organism, for example, an individual mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal. In some embodiments, the subject is a non-human primate. In some embodiments, the subject is a rodent. In some embodiments, the subject is a sheep, a goat, a cattle, a cat, or a dog. In some embodiments, the subject is a vertebrate, an amphibian, a reptile, a fish, an insect, a fly, or a nematode. In some embodiments, the subject is a research animal. In some embodiments, the subject is genetically engineered, e.g., a genetically engineered non-human subject. The subject may be of either sex and at any stage of development.


The term “recombinant” as used herein in the context of proteins or nucleic acids refers to proteins or nucleic acids that do not occur in nature, but are the product of human engineering. For example, in some embodiments, a recombinant protein or nucleic acid molecule comprises an amino acid or nucleotide sequence that comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations as compared to any naturally occurring sequence.


DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS

Described herein are systems, methods, and compositions for incorporating amino acids into a protein in vitro or in vivo. In some embodiments, the system enables high-throughput incorporation of unnatural amino acids into any protein in a living cell, enabling proteome-wide interrogation of protein function. Systems and methods to treat live cells with libraries of guide-RNAs complexed with nucleobase editors to transform amino acid codons in a guide nucleotide sequence-programmable manner are described. Further disclosed herein are methods of incorporating unnatural amino acids into proteins, which introduces new functional groups into proteins for a myriad of research applications and for therapeutic target discovery.


The methods disclosed herein require unique tools for the introduction of a codon suitable for the introduction of unnatural amino acids (e.g., a stop codon or a rare codon). The methods described herein enables incorporation of an unnatural amino acid into virtually any protein in living cells in a programmable manner. In some embodiments, one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more) unnatural amino acids may be introduced into one protein. In some embodiments, unnatural amino acids may be introduced into more than one proteins (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more) in the proteome. In some embodiments, unnatural amino acids may be incorporated proteome-wide in a high throughput manner.


Accordingly, some aspects of the present disclosure provide methods and compositions for the conversion of a target amino acid codon to a stop codon or a rare codon. Other aspects of the present disclosure provide compositions and methods that may be used to decode the newly introduced stop codon or rare codon, thereby incorporating an unnatural amino acid into the protein of interest. Other aspects of the present disclosure provide nucleotide base editors that may be used for the conversion of a target codon to a stop codon or a rare codon. Such nucleotide base editors are programmable with a guide nucleotide sequence that targets it to the target codon to be changed. Yet other aspects of the present disclosure provide kits for the incorporation of unnatural amino acids into proteins, and various applications that are enabled by the systems, methods, and compositions described herein.


Codon Conversion


The 20 naturally occurring amino acids are encoded by 61 amino acid codons (Table 1). A codon that encodes an amino acid is referred to herein as a “sense codon.” The overabundance in the number of codons allows many amino acids to be encoded by more than one codon. The genetic codes of different organisms are often biased towards using one of the several codons that encode the same amino acid over the others. Amino acid codons are decoded by transfer RNAs (tRNAs). A tRNA is a type of RNA molecule that helps decode a messenger RNA (mRNA) sequence into a protein. tRNAs function at specific sites in the ribosome during translation, which is a process by which a protein is synthesized from an mRNA molecule. tRNAs that decode the more frequently used amino acid codons tend to be more abundant, while the tRNAs that decode the less frequently used amino acid codons are less abundant. In some embodiments, these less frequently used amino acid codons are termed “rare codons.” In an organism, tRNAs that decode rare codons are typically expressed at a very low level, if expressed at all. Consequently, the presence of a rare codon in a messenger RNA (mRNA) often limits the rate of translation or stalls translation. Such stalling in translation in some cases leads to cleavage of the rare-codon containing mRNA and production of truncated proteins (Hayes et al., PNAS, Mar. 19, 2002, vol. 99, 3440-3445, the contents of which is incorporated herein by reference). By supplying the cell with exogenous tRNAs (e.g., a naturally occurring tRNA or a mutated tRNA that can decode the rare codon), it is possible to decode the rare codon at a rate high enough to avoid the translation stalling at rare codons. Consequently, the amino acid that is charged on the rare-codon recognizing tRNA is incorporated into the protein being translated. Such a process may herein be referred to as “rare codon suppression.” Examples of rare codons and the amino acids they encode include, without limitation, AGG (R), ATA (I), AGT (S), TTT (F), and TTC (F).


Codons that cannot be decoded into an amino acid are termed “nonsense codons.” Translation terminates at such nonsense codons. Thus, a nonsense codon is also termed a “stop codon” or a “termination codon.” There are three types of stop codons: TAG (amber), TAA (ochre), and TGA (opal). However, translation termination doesn't always occur when a stop codon is present, i.e., the stop codons may be suppressed and translational read-through may occur when a stop codon is interpreted as a sense codon, that is, when a (standard or unnatural) amino acid is ‘encoded’ by the stop codon. Mutated tRNAs may be one cause of translational read-through. Translational read-through is very common in viruses and bacteria, and has also been found in humans as a gene regulatory principle. The process of a translational read-through event, where an amino acid is encoded by a stop codon and incorporated into the protein, may also be referred to as “nonsense suppression.”









TABLE 1







Amino Acid Codons










Amino Acids


Codons





Alanine
Ala
A
GCA, GCG, GCC, GCU


Cysteine
Cys
C
UGC, UGU


Aspartic Acid
Asp
D
GAC, GAU


Glutamic Acid
Glu
E
GAA, GAG


Phenylalanine
Phe
F
UUC, UUU


Glycine
Gly
G
GGA, GGC, GGG, GGU


Histidine
His
H
CAC, CAU


Isoleucine
Ile
I
AUA, AUC, AUU


Lysine
Lys
K
AAA, AAG


Leucine
Leu
L
UUA, UUG, CUA, CUC, CUG, CUU


Methionine
Met
M
AUG


Asparagin
Asn
N
AAC, AAU


Proline
Pro
P
CCA, CCC, CCG, CCU


Glutamine
Gln
Q
CAA, CAG


Arginine
Arg
R
AGA, AGG, CGA, CGC, CGG, CGU


Serine
Ser
S
AGC, AGU, UCA, UCC, UCG, UCU


Threonine
Thr
T
ACA, ACC, ACG, ACU


Valine
Val
V
GUA, GUC, GUG, GUU


Tryptophan
Trp
W
UGG


Tyrosine
Tyr
Y
UAC, UAU









To incorporate an unnatural amino acid in a protein at one or more desired locations, the existing sense codons at the target location may be altered to introduce a nonsense codon or a rare codon. Traditional methods of changing sense codons in a protein coding sequence include site-directed mutagenesis and other techniques that rely on the DNA repair pathway or homologous recombination pathways of the cell. Such methods are inefficient and laborious, and are not feasible in high-throughput formats.


Provided herein are systems, compositions, and methods for converting sense codons (that are not rare codons) to nonsense codons or rare codons via the deamination of a target base. In some embodiments, the target base is a C base that is convert it to a T base by the nucleobase editors described herein. In some embodiments, the nucleobase editors are fusion proteins comprising: (i) a programmable DNA binding protein domain (e.g., a nuclease inactive Cas9 or a Cas9 nickase); and (ii) a deaminase domain. In some embodiments, the deaminase domain is a cytosine deaminase, e.g., an APOBEC1. Nucleobase editors comprising a cytosine deaminase domain and methods of using them for genome editing have been described in the art, e.g., in U.S. Pat. No. 9,068,179, US Patent Application Publications US20150166980, US20150166981, US20150166982, US20150166984, and US20150165054, and U.S. Provisional Applications, 62/245,828, 62/279,346, 62/311,763, 62/322,178, and 62/357,352, and 62/370,700, 62/398,490, 62/498,686, PCT Application NO. PCT/US2016/058344, U.S. patent application Ser. No. 15/331,852, and in Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage, Nature, 533(7603):420-4, 2016, the entire contents of each of which are incorporated herein by reference.


Cytosine deaminases are capable of converting a cytosine (C) base to a thymine (T) base via deamination. Thus, it is envisioned that, for sense codons containing a C base, the C base may be directly converted to T. For example, a CAG (Gln/Q) codon may be changed to a TAG (amber) codon via the deamination of the first C on the coding strand. For sense codons that contains a guanine (G) base, a C base is present on the complementary strand; and the G base may be converted to an adenosine (A) via the deamination of the C on the complementary strand. For example, a TGG (Trp/W) codon may be converted to a TAG (amber) codon via the deamination of the second C on the complementary strand. In some embodiments, two C to T changes are required to convert a codon to a nonsense codon or a rare codon. For example, a CGG (R) codon is converted to a TAG (amber) codon via the deamination of the first C on the coding strand and the deamination of the second C on the complementary strand. In some embodiments, a nonsense codon may be changed to a different nonsense codon, e.g., TGA to TAA, or TAG to TAA. Similarly, a sense codon can also be converted to a rare codon, e.g., ACA (Thr/T) to ATA (rare Ile/I).


Using the base editors described herein, at least 17 out of the 64 possible codons (>25%) may be converted to a nonsense codon or a rare codon via C to T conversion using a cytosine deaminase, allowing for the efficient incorporation of nonsense codons or rare codons into the coding sequence of a protein. Out of the target codons listed in Table 2, many of them encode polar amino acids, like arginine and glutamine. The polar amino acids are statistically enriched in surface-exposed regions of proteins. Additionally, tryptophan is statistically over-represented in protein-protein interaction regions (also termed hot spots). Thus, access to codons encoding these polar amino acids may be particularly useful because replacement of these amino acids with unnatural amino acids on the surface of the protein enables functional analysis of the protein, e.g., probing of protein structure-function correlation and interaction with other proteins.









TABLE 2







Examples of codon changes









Target codon
Base-editing process
Edited codon






CAG (Gln/Q)

1st base C to T on coding strand

TAG (amber)



TGG (Trp/W)
2nd base C to T on complementary
TAG (amber)



strand




CGA (Arg/R)

1st base C to T on coding strand

TGA (opal)




CAA (Gln/Q)

1st base C to T on coding strand

TAA (ochre)



TGG (Trp/W)
3rd base C to T on complementary strand
TGA (opal)


CGG (Arg/R)
1st base C to T on coding strand and 2nd
TAG (amber)



base C to T on complementary strand



CGA (Arg/R)
1st base C to T on coding strand and 2nd
TAA (orchre)



base C to T on complementary strand



TGA (opal)
2nd base C to T on complementary
TAA (ochre)



strand



TAG (amber)
3rd base C to T on complementary strand
TAA (ochre)



GGG (Gly/G)

1st base C to T on complementary strand

AGG (rare Arg/R)



ATG (Met/M)
3rd base C to T on complementary strand
ATA (rare Ile/I)



GGT (Gly/G)

1st base C to T on complementary strand

AGT (rare Ser/S)



ACA (Thr/T)
2nd base C to T on coding strand
ATA (rare Ile/I)



CTC (Leu/L)

1st base C to T on coding strand

TTC (rare Phe/F)



TCT (Ser/S)
2nd base C to T on coding strand
TTT (rare Phe/F)


TCC (Ser/S)
2nd base C to T on coding strand
TTC (rare Phe/F)



CTT (Leu/L)

1st base C to T on coding strand

TTT (rare Phe/F)




CTC (Leu/L)

1st base C to T on coding strand and 3rd

TTT (rare Phe/F)




base C to T on coding strand



TCC (Ser/S)
2nd base C to T on coding strand and 3rd
TTT (rare Phe/F)



base C to T on coding strand




GGC (Gly/G)

1st base C to T on complementary strand

AGT (rare Ser/S)




and 3rd base C to T on coding strand




G
CA (Ala/A)

1st base C to T on complementary strand

A
TA (rare Ile/I)




and 2nd base C to T on coding strand





* single underline: changes on the coding stranded


double underline: changes on the complementary strand






It is to be understood that other types of based editors that covert other bases (e.g., A to G) may be used. Base editors that can convert an adenosine to a guanine are described in U.S. Provisional Application NOs” 62/370,684; 62/454,035; 62/473,714; and PCT Application No. PCT/US2017/045381, incorporated herein by reference.


Incorporation of Unnatural Amino Acids Via Nonsense Suppression or Rare Codon Suppression


To incorporate unnatural amino acids at the nonsense codon or rare codon introduced by the base editors, a translation system is designed to enable the decoding of the stop codon or the rare codon and the incorporation of the unnatural amino acids without interfering with the translation of the rest of the protein. Such translation systems have been described and used in the art, for example, in Edwards et al., Molecular and Cellular Biology, 1990; Edwards et al., PNAS 1991; Kiga et al., PNAS, 2002; Dumas et al., Cell, 2015; Liu et al., PNAS, 1997; Wang et al., Annu. Rev. Biophys. Biomol. Struct., 2006, Bholke et al., FEMS Microbiol. Lett., 2014, 351, 133; Bock et al., Mol. Microbiol., 1991, 5, 515; Johansson et al., Biochim. Biophys. Acta, 2005, 1726, 1; Takimoto et al., ACS Chem Biol. 2011 July 15; 6(7):733-43; Stadtman et al., Annu Rev Biochem. 1996; 65:83-100; Ma et al., Biochemistry, 32:7939 (1993); Kowal et al., Nucl. Acid. Res., 25:4685 (1997); US Patent Application Publication US 2003/0108885; PCT Application Publication WO 2002/085923; and PCT Application Publication WO 2005/019415 the entire contents of each of which are incorporated herein by reference.


Components of a translation system can include, e.g., ribosomes, tRNAs, synthetases, mRNAs, and the like. The components of the present disclosure can be added to a translation system in vivo or in vitro. In some embodiments, the translation system comprises an orthogonal tRNA (OtRNA) and an orthogonal aminoacyl tRNA synthetase (ORS). Typically, the ORS preferentially aminoacylates the OtRNA with at least one unnatural amino acid in the translation system, and the OtRNA recognizes at least one nonsense or rare codon. The translation system thus inserts the unnatural amino acid into a protein produced in the system at an encoded nonsense codon or rare codon. Typical translation systems include cells, such as bacterial cells (e.g., Escherichia coli), archeaebacterial cells, eukaryotic cells (e.g., yeast cells, mammalian cells, plant cells, insect cells), or the like.


Translation systems may be cellular or cell-free, and may be prokaryotic or eukaryotic. Cellular translation systems include, but are not limited to, whole cell preparations such as permeabilized cells or cell cultures wherein a desired nucleic acid sequence can be transcribed to mRNA, and the mRNA translated. Cell-free translation systems are commercially available and many different types and systems are known. Examples of cell-free systems include, but are not limited to, prokaryotic lysates such as Escherichia coli lysates, and eukaryotic lysates such as wheat germ extracts, insect cell lysates, rabbit reticulocyte lysates, rabbit oocyte lysates, and human cell lysates. Eukaryotic extracts or lysates may be preferred when the resulting protein is glycosylated, phosphorylated, or otherwise modified because many such modifications are only possible in eukaryotic systems. Some of these extracts and lysates are available commercially (Promega; Madison, Wis.; Stratagene; La Jolla, Calif.; Amersham; Arlington Heights, Ill.; GIBCO/BRL; Grand Island, N.Y.). Membranous extracts, such as the canine pancreatic extracts containing microsomal membranes, are also available which are useful for translating secretory proteins.


Reconstituted translation systems may also be used. Mixtures of purified translation factors have also been used successfully to translate mRNA into protein as well as combinations of lysates or lysates supplemented with purified translation factors such as initiation factor-1 (IF-1), IF-2, IF-3 (α or β), elongation factor T (EF-Tu), or termination factors. Cell-free systems may also be coupled transcription/translation systems wherein DNA is introduced into the system, transcribed into mRNA, and the mRNA translated as described in Current Protocols in Molecular Biology (F. M. Ausubel et al. editors, Wiley Interscience, 1993), the entire contents of which is incorporated herein by reference. RNA transcribed in a eukaryotic transcription system may be in the form of heteronuclear RNA (hnRNA) or 5′-end caps (7-methyl guanosine) and 3′-end poly A tailed mature mRNA, which can be an advantage in certain translation systems. For example, capped mRNAs are translated with high efficiency in the reticulocyte lysate system.


In some embodiments, the translation system comprises RNA polymerases, translation initiation factor, ribosomes, release factor-1, release factor-2, release factor-3, ATPs, GTPs, CTPs, UTPs, elongation factor-Tu, natural aminoacyl-tRNA synthetases, natural tRNAs, and/or natural amino acids. In some embodiments, the translation system further comprises components for transcription, e.g., a T7 RNA polymerase. In vitro translation systems are commercially available, e.g., from Termo Fisher Scientific or New England Biolabs.


A variety of exemplary translation systems are useful in the present disclosure, including e.g., an Escherichia coli cell comprising a mtRNACUA Tyr and a mutant TyrRS (LWJ16), where the mutant TyrRS (LWJ16) preferentially aminoacylates the mtRNACUA Tyr with O-methyl-L-tyrosine in the cell, and the cell uses the mtRNACUA Tyr to recognize an amber codon. In another example, an Escherichia coli cell comprising a mtRNACUA Tyr and an SS12-TyrRS is provided, where the SS 12-TyrRS preferentially aminoacylates the mtRNACUa Tyr with L-3-(2-naphthyl)alanine in the cell, and the cell uses the mtRNACUA Tyr to recognize an amber codon.


In some embodiments, the success of the technology described herein depends on the recognition of the unnatural amino acid by aminoacyl-tRNA synthetases, which, in general, requires high selectivity to insure fidelity of protein translation. For instance, although thiaproline can be incorporated quantitatively into proteins, oxaproline and selenoproline cannot. See N. Budisa, C. Minks, F. J. Medrano, J. Lutz, R. Huber and L. Moroder, Proc. Natl. Acad. Sci. USA, 95:455 (1998). One way to expand the scope of this method is to relax the substrate specificity of aminoacyl-tRNA synthetases, which has been achieved in a limited number of cases. For example, it was found that replacement of Ala294 by Gly in Escherichia coli phenylalanyl-tRNA synthetase (PheRS) increases the size of the substrate binding pocket and results in the acylation of tRNAPhe by p-Cl-phenylalanine (p-Cl-Phe). See, M. Ibba, P. Kast and H. Hennecke, Biochemistry, 33:7107 (1994). An Escherichia coli strain harboring this mutant PheRS allows the incorporation of p-Cl-phenylalanine or p-Br-phenylalanine in place of phenylalanine. See, e.g., M. Ibba and H. Hennecke, FEBS Lett., 364:272 (1995); and, N. Sharma, R. Furter, P. Kast and D. A. Tirrell, FEBS Lett., 467:37 (2000). Similarly, a point mutation Phe130Ser near the amino acid binding site of Escherichia coli tyrosyl-tRNA synthetase was shown to allow azatyrosine to be incorporated more efficiently than tyrosine. See F. Hamano-Takaku, T. Iwama, S. Saito-Yano, K. Takaku, Y. Monden, M. Kitabatake, D. Soll and S. Nishimura, J. Biol. Chem., 275:40324 (2000).


The fidelity of aminoacylation is maintained both at the level of substrate discrimination and proofreading of non-cognate intermediates and products. Therefore, an alternative strategy to incorporate unnatural amino acids into proteins in vivo is to modify synthetases that have proofreading mechanisms. These synthetases cannot discriminate and therefore activate amino acids that are structurally similar to the cognate natural amino acids. This error is corrected at a separate site, which deacylates the mischarged amino acid from the tRNA to maintain the fidelity of protein translation. If the proof-reading activity of the synthetase is disabled, structural analogs that are misactivated may escape the editing function and be incorporated. This approach has been demonstrated recently with the valyl-tRNA synthetase (ValRS). ValRS can misaminoacylate tRNAVal with Cys, Thr, or aminobutyrate (Abu); these noncognate amino acids are subsequently hydrolyzed by the editing domain. After random mutagenesis of the Escherichia coli chromosome, a mutant Escherichia coli strain was selected that has a mutation in the editing site of ValRS. This edit-defective ValRS incorrectly charges tRNAVal with Cys. Because Abu sterically resembles Cys (—SH group of Cys is replaced with —CH3 in Abu), the mutant ValRS also incorporates Abu into proteins when this mutant Escherichia coli strain is grown in the presence of Abu. Mass spectrometric analysis shows that about 24% of valines are replaced by Abu at each valine position in the native protein. See V. Doring, H. D. Mootz, L. A. Nangle, T. L. Hendrickson, V. de Crecy-Lagard, P. Schimmel and P. Marliere, Science, 292:501 (2001), the entire contents of which is incorporated herein by reference.


In some embodiments, OtRNA and ORS pairs are provided, e.g., where the OtRNA and the ORS are complementary. In some embodiments, an OtRNA and ORS pair comprises e.g., a mutRNATyr-mutTyrRS pair, such as mutRNATyr-SS12TyrRS pair, a mutRNALeu-mutLeuRS pair, a mutRNAThr-mutThrRS pair, a mutRNAGlu-mutGluRS pair, or the like. In some embodiments, the pair is other than a mutRNAGln-mutGlnRS derived from Escherichia coli, a mutRNAAsp-mutAspRS derived from yeast or a mutRNAPheCUA-mutphenlalanineRS from yeast.


In some embodiments, the OtRNA and the ORS can be derived by mutation of a naturally occurring tRNA and RS from a variety of organisms. In some embodiments, the OtRNA and ORS are derived from a prokaryotic organism, e.g., Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium, Escherichia coli, A. fulgidus, P. furiosus, P. horikoshii, A. pernix, T. thermophilus, or the like. The organism may also be a eukaryotic organism, e.g., plants (e.g., complex plants such as monocots, or dicots), algea, fungi (e.g., yeast, etc.), animals (e.g., mammals, insects, arthropods, etc.), insects, protists, or the like. Optionally, the OtRNA is created by mutation of a naturally occurring tRNA from a first organism, and the ORS is created by mutation of a naturally occurring RS from a second organism. In one embodiment, the OtRNA and ORS are derived from a mutated tRNA and mutated RS.


In some embodiments, the OtRNA and/or the ORS are isolated from a variety of organisms. In some embodiments, the OtRNA and/or ORS are isolated from at least one organism, where the organism is a prokaryotic organism, e.g., Methanococcus jannaschii, Methanobacterium thermoautotrophicum, Halobacterium, Escherichia coli, A. fulgidus, P. furiosus, P. horikoshii, A. pernix, T. thermophilus, or the like. In other embodiments, the organism is a eukaryotic organism, e.g., plants (e.g., complex plants such as monocots, or dicots), algea, fungi (e.g., yeast, etc), animals (e.g., mammals, insects, arthropods, etc.), insects, protists, or the like. Optionally, the OtRNA is isolated from a naturally occurring tRNA from a first organism, and the ORS is isolated from a naturally occurring RS from a second organism.


OtRNAs that may be used in accordance with the present disclosure may be a naturally occurring tRNA, or a modified tRNA. For example, OtRNAs may be derived from Tyr-tRNA, Glu-tRNA, Trp-tRNA, Leu-tRNA, Pyl-tRNA, amber-tRNA, etc. In some embodiments, the OtRNA is derived from a Tyr-tRNA of a Methanococcus jannaschii cell, referred to herein as mtRNA TyrA. In another embodiment, the OtRNA comprises a nucleic acid sequence of any one of SEQ ID NOs: 5-7, or a complementary polynucleotide sequence thereof. In some embodiments, the OtRNA comprises a nucleic acid sequence that is at least 85% identical to any one of SEQ ID NOs: 5-7. For example, the OtRNA may comprise a nucleic acid sequence that is at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.9% identical to any one of SEQ ID NOs: 5-7. In some embodiments, the OtRNA comprises a nucleic acid sequence that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 985, 99%, or 99.9% identical to any one of SEQ ID NOs: 5-7. In some embodiments, the OtRNA consists of the nucleic acid sequence of any one of SEQ ID NOs: 5-7.


In some embodiments, the ORS is derived from TyrRS from Methanococcus jannaschii. In some embodiment, the ORS is referred to herein as mutant TyrRS (LWJ16) or SS12-TyrRS. In some embodiments, the ORS comprises an amino acid sequence of any one of SEQ ID NO: 330-361 or a polypeptide encoded by a nucleic acid sequence selected from any one of SEQ ID NOs: 330-361 or a complementary polynucleotide sequence thereof. In some embodiments, the ORS comprises an amino acid sequence that is at least 85% identical to any one of SEQ ID NOs: 330-361. For example, the ORS may comprise an amino acid sequence that is at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.9% identical to any one of SEQ ID NOs: 330-361. In some embodiments, the ORS comprises an amino acid sequence that is 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 985, 99%, or 99.9% identical to any one of SEQ ID NOs: 330-361. In some embodiments, the ORS consists of the amino acid sequence of any one of SEQ ID NOs: 330-361. Non-limiting, exemplary ORS and OtRNA sequences are provided in Table 3 in Example 2.


In some embodiments, the translation system of the present disclosure is an Escherichia coli cell comprising a mtRNACUA Tyr and a mutant TyrRS (LWJ16), wherein the mutant TyrRS (LWJ16) preferentially aminoacylates the mtRNACUA Tyr with O-methyl-L-tyrosine in the cell, and the cell uses the mtRNACUA Tyr to recognize an amber codon.


In some embodiments, the translation system of the present disclosure is an Escherichia coli cell comprising a mtRNACUA Tyr and an SS12-TyrRS, wherein the SS12-TyrRS preferentially aminoacylates the mtRNACUA Tyr with L-3-(2-naphthyl)alanine in the cell, and the cell uses the mtRNACUA Tyr to recognize an amber codon.


The term “preferentially aminoacylates” refers to an efficiency of, e.g., about 70% efficient, about 75% efficient, about 85% efficient, about 90% efficient, about 95% efficient, or about 99% or more efficient, at which an ORS aminoacylates an OtRNA with an unnatural amino acid compared to a naturally occurring tRNA or starting material used to generate the OtRNA. The unnatural amino acid is then incorporated into a growing polypeptide chain with high fidelity, e.g., at greater than about 75% efficiency for a given nonsense codon or rare codon, at greater than about 80% efficiency for a given nonsense codon or rare codon, at greater than about 90% efficiency for a given nonsense codon or rare codon, at greater than about 95% efficiency for a given nonsense codon or rare codon, or at greater than about 99% or more efficiency for a given nonsense codon or rare codon.


Using the compositions and methods provided herein, in some embodiments, more than one type of unnatural amino acids (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14, 15 or more) may be incorporated. For the sole purpose of illustration, in one example, two different types of unnatural amino acids (e.g., O-methyl-L-tyrosine and L-3-(2-naphthyl)alanine) may be incorporated by providing the cell with two pairs of OtRNA and ORS pairs, each ORS preferentially aminoacylates the OtRNA with one of the two unnatural amino acids, and each OtRNA preferentially decodes one edited codon (e.g., a nonsense codon or a rare codon). Thus, at least two different types of edited codons are introduced to the cell. In some embodiments, the two different edited codons decoded by the two OtRNAs are introduced into one protein, thereby incorporating two different types of unnatural amino acids into one protein. In some embodiments, the two different edited codons recognized by the two OtRNAs are introduced into two proteins, thereby incorporating one type of unnatural amino acid into one protein and the other type of unnatural amino acid into the other protein. Thus, it is also contemplated herein that, in some embodiments, different types of unnatural amino acids are incorporated into one or more proteins (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14, 15 or more proteins). Where the unnatural amino acids are incorporated are determined by where the nonsense codon or rare codon is introduced in a protein, which is in turn determined by the guide nucleotide sequence.


In some embodiments, the unnatural amino acids are incorporated proteome-wide (e.g., proteome-wide incorporation of one type of unnatural amino acid, or proteome-wide incorporation of 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 12, 13, 14, 15 or more types of unnatural amino acids). Proteome-wide incorporation of unnatural amino acids is enabled by the versatile nature of the RNA-programmable based editors described herein. By providing the base editors with a library of guide nucleotide sequences (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, or more sgRNAs each targeting a different target codon), nonsense or rare codons may be introduced proteome-wide.


Non-limiting examples of unnatural amino acids that may be incorporated into proteins using the compositions and methods of the present disclosure include analogs or derivatives of natural amino acids. In some embodiments, the unnatural amino acid is selected from the group consisting of unnatural analogues of tyrosine, unnatural analogues of glutamine, unnatural analogues of phenylalanine, unnatural analogues of serine, unnatural analogues of threonine, unnatural analogues of alanine, unnatural analogues of cysteine, unnatural analogues of aspartic acid, unnatural analogues of glutamic acid, unnatural analogues of glycine, unnatural analogues of histidine, unnatural analogues of isoleucine, unnatural analogues of lysine, unnatural analogues of leucine, unnatural analogues of methionine, unnatural analogues of asparagine, unnatural analogues of proline, unnatural analogues of arginine, unnatural analogues of valine, and unnatural analogues of tryptophan. In some embodiments, the unnatural amino acid is selected from the group consisting of: O-methyl-L-tyrosine, L-3-(2-naphthyl)alanine, 3-methyl-phenylalanine, O-4-allyl-L-tyrosine, 4-propyl-L-tyrosine, tri-O-acetyl-GlcNAcβ-serine, L-dopa, fluorinated phenylalanine, isopropyl-L-phenylalanine, p-azido-L-phenylalanine, p-acyl-L-phenylalanine, p-benzoyl-L-phenylalanine, L-phosphoserine, phosphonoserine, phosphonotyrosine, p-iodo-phenylalanine, p-bromophenylalanine, p-amino-L-phenylalanine, and isopropyl-L-phenylalanine. In some embodiments, the unnatural amino acid is selected from the group consisting of: alkyl, aryl, acyl, azido, cyano, halo, hydrazine, hydrazide, hydroxyl, alkenyl, alkynl, ether, thiol, sulfonyl, seleno, ester, thioacid, borate, boronate, phospho, phosphono, phosphine, heterocyclic, enone, imine, aldehyde, hydroxylamine, keto, and amino-substituted amino acids, and any combinations thereof. In some embodiments, the unnatural amino acid is selected from the group consisting of amino acids with a photoactivatable cross-linker; spin-labeled amino acids; fluorescent amino acids; amino acids with a novel functional group; amino acids that covalently or noncovalently interacts with another molecule; metal binding amino acids; metal-containing amino acids; radioactive amino acids; photocaged and/or photoisomerizable amino acids; biotin or biotin-analogue containing amino acids; glycosylated or carbohydrate modified amino acids; keto containing amino acids; amino acids comprising polyethylene glycol or polyether; heavy atom substituted amino acids; chemically cleavable or photocleavable amino acids; amino acids with an elongated side chain; amino acids containing a toxic group; sugar substituted amino acids; carbon-linked sugar-containing amino acids; redox-active amino acid; a-hydroxy-containing acids; amino thio acid containing amino acid; α,α di-substituted amino acids; β-amino acids; and cyclic amino acids other than proline. In some embodiments, the unnatural amino acid is any unnatural amino acid described in FIG. 3.


The incorporation of unnatural amino acid into a protein may be in vivo or in vitro. In in vitro incorporation, in some embodiments, the unnatural amino acid may be supplied as a component of the translation system. In some embodiments, the unnatural amino acid may be added or supplemented to the translation system as an independent component. In in vivo incorporation (e.g., in a culture cell such as Hela), the unnatural amino acid may be supplemented into the media of a cultured cell. In some embodiments, biosynthetic pathways that can synthesize the unnatural amino acids may be engineered into the cell (e.g., integrated into the genomic DNA of the cell, or provided via any recombinant DNA technique for expression of exogenous proteins, e.g., AVAL or lentiviral vectors). Such biosynthetic pathways are described in US Patent Application Publication, US 20030082575, the entire contents of which is incorporated herein by reference.


When the unnatural amino acid is supplied in the media of a cultured cell, the cell needs to uptake the unnatural amino acid before it can be incorporated into a protein. Unnatural amino acid uptake is one issue that is typically considered when designing and selecting unnatural amino acids, e.g., for incorporation into a protein. For example, the high charge density of a-amino acids suggests that these compounds are unlikely to be cell permeable. Natural amino acids are taken up into bacteria via a collection of protein-based transport systems displaying varying degrees of amino acid specificity. Methods of biosynthesizing or uptaking an unnatural amino acid are described in US Patent Application Publication, US 20030082575, the entire contents of which are incorporated herein by reference.


Further provided herein are general methods for delivering unnatural amino acids, which is independent of all amino acid uptake pathways. This general method relies on uptake via peptide permeases, which transport dipeptides and tripeptides across the cytoplasmic membrane. Peptide permeases are not very side-chain specific, and the KD values for their substrates are comparable to KD values of amino acid permeases, e.g., about 0.1 mM to about 10 mM). See, e.g., Nickitenko et al., Biochemistry 34, 16585-16595 (1995) and Dunten et al., Protein Science 4, 2327-34 (1995). The unnatural amino acids are then taken up as conjugates of natural amino acids, such as lysine, and released into the cytoplasm upon hydrolysis of the dipeptide by one of endogenous Escherichia coli peptidases.


The methods described herein provide the ability to synthesize proteins that comprise unnatural amino acids in useful quantities. For example, proteins comprising at least one unnatural amino acid can be produced at a concentration of at least about 10, 50, 100, or more micrograms per liter, e.g., in a composition comprising a cell extract, a buffer, a pharmaceutically acceptable excipient, and/or the like.


When an unnatural amino acid is incorporated into a newly synthesized protein, a protein comprising the unnatural amino acid is produced. Accordingly, other aspects of the present disclosure provide for the production of proteins. Virtually any protein in the cell may be made using the methods described herein. In some embodiments, proteins that are homologous to any available protein but including one or more unnatural amino acids are made. Thus, non-limiting examples of proteins, or homologous thereof, that may be synthesized using the methods and systems described herein, include: alpha-1 antitrypsin, angiostatin, antihemolytic factor, antibodies, apolipoprotein, apoprotein, atrial natriuretic factors, atrial natriuretic polypeptide, atrial peptides, C-X-C chemokine, T39765, NAP-2, ENA-78, Gro-a, Gro-b, Gro-c, IP-10, GCP-2, NAP-4, SDF-1, PF4, MIG, calcitonin, c-kit ligand, cytokines, CC chemokines, monocyte chemoattractant protein-1, monocyte chemoattractant protein-2, monocyte chemoattractant protein-3, monocyte inflammatory protein-1 alpha, monocyte inflammatory protein-i beta, RANTES, 1309, R83915, R91733, HCC1, T58847, D31065, T64262, CD40, CD40 ligand, hyalurin/CD44, C-kit Ligand, collagen, colony stimulating factor (CSF), complement factor 5a, complement inhibitor, complement receptor 1, cytokine, epithelial neutrophil activating peptide-78, GROa/MGSA, GROG, GROy, MIP-la, MIP-16, MCP-1, epidermal growth factor (EGF), epithelial neutrophil activating peptide, erythropoietin (EPO), transcriptional activators, transcriptional suppressors, exfoliating toxin, factor IX, factor VII, factor VIII, factor X, fibroblast growth factor (FGF), fibrinogen, fibronectin, G-CSF, GM-CSF, glucocerebrosidase, gonadotropin, growth factors, growth factor receptors, hedgehog protein, hemoglobin, hepatocyte growth factor (HGF), signal transduction molecules, Hirudin, human serum albumin, ICAM-1, ICAM-1 receptors, LFA-1, LFA-1 receptors, insulin, insulin-like growth factors (IGF), IGF-I, IGF-II, interferons, IFN-α, IFN-β, IFN-γ, interleukin, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, keratinocyte growth factor (KGF), lactoferrin, leukemia inhibitory factor, luciferase, neurturin, neutrophil inhibitory factors (NIF), oncostatin M, osteogenic proteins, oncogene products, parathyroid hormone, PD-ECSF, PDGF, peptide hormones, human growth hormone, pleiotropin, protein A, protein G, pyrogenic exotoxins A, B, or C, relaxin, renin, SCF, soluble complement receptor I, soluble I-CAM 1, soluble interleukin receptors, TNF, soluble TNF receptors, somatomedin, somatostatin, somatotropin, streptokinase, superantigens, staphylococcal enterotoxins, SEA, SEB, SEC1, SEC2, SEC3, SED, SEE, steroid hormone receptors, superoxide dismutase, toxic shock syndrome toxins, thymosin alpha 1, tissue plasminogen activators, tumor growth factors (TGF), TGF-α, TGF-β, tumor necrosis factors, tumor necrosis factor alpha, tumor necrosis factor beta, tumor necrosis factor receptor (TNFR), VLA-4 proteins, VCAM-1 protein, vascular endothelial growth factor (VEGEF), urokinase, Mos, Ras, Raf, Met, p53, Tat, Fos, Myc, Jun, Myb, Rel, estrogen receptors, progesterone receptors, testosterone receptors, aldosterone receptors, LDL receptors, BRD4, PRSS2, and fragments thereof. In some embodiments, the protein is BRD4. In some embodiments, the protein is PRSS2. The proteins produced herein that contain the unnatural amino acid sequence may in some embodiments be used for research purposes. In other embodiments, the protein may be a therapeutic protein that may be used for therapeutic purpose. Thus, also contemplated herein are compositions comprising a protein comprising an unnatural amino acid and a pharmaceutically acceptable excipient, e.g., any of the proteins noted above and a pharmaceutically acceptable excipient.


Homology to the polypeptide can be inferred by performing a sequence alignment, e.g., using BLASTN or BLASTP, e.g., set to default parameters. For example, in one embodiment, the protein is at least about 50%, at least about 75%, at least about 80%, at least about 90%, or at least about 95% identical to a known therapeutic protein (e.g., a protein present in Genebank or other databases.


The protein synthesized as described herein may contain 1, 2, 3, 4, 5, 6, 7, 6, 9, 10, 11, 12, 13, 14, 15, or more unnatural amino acids. The unnatural amino acids can be the same or different, e.g., there can be 1, 2, 3, 4, 5, 6, 7, 6, 9, 10, 11, 12, 13, 14, 15, or more different sites in the protein wherein unnatural amino acids are incorporated, and the protein may comprise 1, 2, 3, 4, 5, 6, 7, 6, 9, 10, 11, 12, 13, 14, 15, or more different types of unnatural amino acids.


The proteins, e.g., polypeptides, peptides, etc., of the present disclosure (e.g., comprising one or more unnatural amino acid) may be employed for therapeutic uses, e.g., in combination with a suitable pharmaceutical carrier. Such compositions, e.g., comprise a therapeutically effective amount of the compound and a pharmaceutically acceptable carrier or excipient. Such a carrier or excipient includes, but is not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol, and/or combinations thereof. The formulation is made to suit the mode of administration. In general, methods of administering proteins are well known in the art and can be applied to administration of the polypeptides of the disclosure.


Therapeutic compositions comprising one or more polypeptide of the present disclosure are optionally tested in one or more appropriate in vitro and/or in vivo animal models of disease, to confirm efficacy, tissue metabolism, and to estimate dosages, according to methods well known in the art. In particular, dosages can be initially determined by activity, stability, or other suitable measures of unnatural herein to natural amino acid homologues (e.g., comparison of an EPO modified to include one or more unnatural amino acids to a natural amino acid EPO), i.e., in a relevant assay.


Administration is by any of the routes normally used for introducing a molecule into ultimate contact with blood or tissue cells. The unnatural amino acid polypeptides of the present disclosure are administered in any suitable manner, optionally with one or more pharmaceutically acceptable carriers. Suitable methods of administering such polypeptides in the context of the present disclosure to a patient are available, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective action or reaction than another route.


Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions of the present disclosure.


Polypeptide compositions can be administered by a number of routes including, but not limited to: oral, intravenous, intraperitoneal, intramuscular, transdermal, subcutaneous, topical, sublingual, or rectal means. Unnatural amino acid polypeptide compositions can also be administered via liposomes. Such administration routes and appropriate formulations are generally known to those of skill in the art.


The unnatural amino acid polypeptide, alone or in combination with other suitable components, can also be made into aerosol formulations (i.e., they can be “nebulized”) to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.


Formulations suitable for parenteral administration, such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intradermal, intraperitoneal, and subcutaneous routes, include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. The formulations of packaged nucleic acid can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials.


Parenteral administration and intravenous administration are preferred methods of administration. In particular, the routes of administration already in use for natural amino acid homologue therapeutics (e.g., those typically used for EPO, GCSF, GMCSF, IFNs, interleukins, antibodies, and/or any other pharmaceutically delivered protein), along with formulations in current use, provide preferred routes of administration and formulation for the unnatural amino acids of the disclosure.


The dose administered to a patient, in the context of the present disclosure, is sufficient to effect a beneficial therapeutic response in the patient over time, or, e.g., to inhibit infection by a pathogen, or other appropriate activity, depending on the application. The dose is determined by the efficacy of the particular vector, or formulation, and the activity, stability, or serum half-life of the unnatural amino acid polypeptide employed and the condition of the patient, as well as the body weight or surface area of the patient to be treated. The size of the dose is also determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of a particular vector, formulation, or the like in a particular patient.


In determining the effective amount of the vector or formulation to be administered in the treatment or prophylaxis of disease (e.g., cancers, inherited diseases, diabetes, AIDS, or the like), the physician evaluates circulating plasma levels, formulation toxicities, progression of the disease, and/or where relevant, the production of anti-unnatural amino acid polypeptide antibodies.


Applications


The ability to study cellular systems and the mechanisms that drive disease-relevant and fundamental biological processes relies on a suite of chemical and genetic perturbagens to interrogate these complex systems in situ using experimental paradigms as cloase to the native state as possible. Described herein are compositions and methods that enable high-throughput incorporation of unnatural amino acids into proteins in a living cell, allowing proteome-wide interrogation and profiling of protein structures and functions. Thus, other aspects of the present disclosure provide applications that are enabled by the technology described herein.


For example, the unnatural amino acid incorporated into a protein may contain functionalized chemical moieties. A “functionalized chemical moiety” or a “functional group,” or a “reactive chemical group/handle” refers to specific groups (moieties) of atoms or bonds within molecules that are responsible for the characteristic chemical reactions of those molecules. These terms are used interchangeably herein. One example of such functionalized chemical moiety is a “click chemistry handle.” Click chemistry is a chemical approach introduced by Sharpless in 2001 and describes chemistry tailored to generate substances quickly and reliably by joining small units together. See, e.g., Kolb, Finn and Sharpless Angewandte Chemie International Edition (2001) 40: 2004-2021; Evans, Australian Journal of Chemistry (2007) 60: 384-395). Exemplary coupling reactions (some of which may be classified as “Click chemistry”) include, but are not limited to, formation of esters, thioesters, amides (e.g., such as peptide coupling) from activated acids or acyl halides; nucleophilic displacement reactions (e.g., such as nucleophilic displacement of a halide or ring opening of strained ring systems); azide-alkyne Huisgon cycloaddition; thiol-yne addition; imine formation; and Michael additions (e.g., maleimide addition). A “click chemistry handle” refers to a functional group that is able to undergo a click chemistry coupling reaction. Non-limiting examples of a click chemistry handle include an azide handle, an alkyne handle, or an aziridine handle. Azide is the anion with the formula N3−. It is the conjugate base of hydrazoic acid (HN3). N3− is a linear anion that is isoelectronic with CO2, NCO—, N2O, NO2+ and NCF. Azide can be described by several resonance structures, an important one being N═N+═N. An alkyne is an unsaturated hydrocarbon containing at least one carbon-carbon triple bond. The simplest acyclic alkynes with only one triple bond and no other functional groups form a homologous series with the general chemical formula CnH2n-2. Alkynes are traditionally known as acetylenes, although the name acetylene also refers specifically to C2H2, known formally as ethyne using IUPAC nomenclature. Like other hydrocarbons, alkynes are generally hydrophobic but tend to be more reactive. Aziridines are organic compounds containing the aziridine functional group, a three-membered heterocycle with one amine group (—NH—) and two methylene bridges (—CH2-). The parent compound is aziridine (or ethylene imine), with molecular formula C2H5N.


Probes containing reactive chemical groups that can react with azide handles may be synthesized. A “probe,” as used herein, is a reagent that allow the user to probe into mechanistic and phenotypic questions about their molecular targets, e.g., a protein. Non-limiting examples of the reactive chemical groups that may be used as a probe in the present disclosure include: azide, alkyne, aziridine, norbornene, triazine, cyclooctyne, and dibenzocyclooctyne. In some embodiments, an alkyne probe may be synthesized as described in published PCT application, WO 2013/152359, the entire contents of which is incorporated herein by reference.


Unatural amino acids comprising these reactive chemical groups may be designed and synthesized (Dumas et al., Chemical Science, 6, 50-60, 2015, The entire contents of which is incorporated herein by reference). Non-limiting examples of functionalized unnatural amino acids are provided in FIG. 3. The incorporation of unnatural amino acids containing reactive chemical groups, e.g., click chemistry handles, into a protein enables the probing of protein structure and/or function in a wide range of applications. The ability of incorporating unnatural amino acids proteome-wide is the unique feature of the compositions and methods described herein, and is particularly advantageous. The ability to introduce orthogonal sets of suppressors allows the skilled artisan to study the interactions of complex protein networks simultaneously in a living cell. In some embodiments, multiple probes could be used to label multiple proteins in the same cell. In some embodiments, multiple proteins are endowed with different chemical functionalities. In some embodiments, altered protein-protein interactions, altered subcellular localization for another target, targeted degradation of a third target, and more cellular events, may be programmed simultaneously.


Accordingly, the present disclosure provides non-limiting examples of how the high-throughput and programmable incorporation of chemical functionalities into proteins can be applied to a variety of unbiased large-scale interrogation of proteins in its native cellular context.


In some embodiments, unnatural amino acids containing reactive chemical handles may be incorporated into proteins to study protein degradation. The ability to study protein degradation in a high-throughput and quantifiable manner has been difficult to do to date. Genome-wide genetic perturbation of all proteins using existing technologies (e.g., siRNA or CRISPR/Cas9) may not be well tolerated by cells when essential genes are modified. Currently, to study protein degradation, proteins of interest can be targeted for degradation if a small molecule ligand exists that binds to the target. This approach relies on ligand discovery, which can be time intensive and is inherently limited in throughput. An alternative strategy leads to protein degradation by tagging the target of interest with degradation-inducing tags. Such systems, like the auxin degradation system, could be generated using a number of different protein tags. However, these approaches are limited because there is no efficient way to introduce such a tag onto the protein of interest in a high throughput manner. Further, protein tagging may alter the native function of the protein.


Using the nucleobase editors and the guide nucleotide sequences (e.g., gRNAs) described herein, stop codons or rare codons can be introduced into the coding sequences of proteins proteome-wide, and suppression of the stop codons or rare codons using the translation system described herein can introduce chemical handles into proteins. In some embodiments, 0-17% of natural codons may be targeted. For example, 1%, 2%, 3%, 4%, 5%, 65, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, or 17% of natural codons may be targeted. In some embodiments, the targeted amino acids are polar amino acids, e.g., glutamine or arginine. In some embodiments, the targeted polar amino acids are on the surface of a protein and are readily accessible. In some embodiments, more than one amino acid (e.g., 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more) are targeted in one protein. In some embodiments, unnatural amino acids are incorporated proteome-wide in a cell. Integration of chemical handles (e.g., click chemistry handles described herein) into multiple proteins or multiple tags within one protein at a time is desirable and is possible using the OtRNA-ORS pairs described herein.


In a non-limiting example, azide handles or other click chemistry handles described herein may be incorporated into proteins and used to conduct a proteome-wide degradation screen. For example, in the context of protein degradation, the probe may be a small molecule that targets the protein for degradation, e.g., by the proteasome. In some embodiments, the probe comprises a small molecule that targets the protein for degradation by the proteasome. Such small molecules are described in the art, e.g., thalidomide or pathalimide (Winter et al., Science, 348, 1376-1381, 2015, the entire contents of which are incorporated herein by reference), PROTACs (Bondeson et al., Nature Chemical Biology, 11, 611-617, 2015, the entire contents of which are incorporated herein by reference), and lenalidomide (Lu et al., Science, 343, 305-309, 2014; Krönke et al., Science, 17;343(6168):301-5, 2014, the entire contents of each of which are incorporated herein by reference). In some embodiments, these small molecules target a protein for degradation by the proteasome via the recruitment of ubiquitin ligases. The probes may also include reactive chemical groups that react with the azide handles in the protein, e.g., alkyne handle. Methods and processes of synthesizing the probes are known to those skilled in the art, e.g., in Winter et al., Science, 348, 1376-1381, 2015, the entire contents of which are incorporated herein by reference. Non-limiting examples of how to synthesize probes for protein degradation are illustrated in FIG. 4. By generating an alkyne-tagged probe such as thalidomide, each protein in a cell could be directed to the proteasome via cereblon (CRBN)-dependent ubiquitination. The programmable proteome-wide degradation screen may be employed to study proteins where genetic perturbation leads to lethality to a cell, e.g., perturbation of essential genes. Such a screen can also be used to evaluate components of a complex where genetic knockout of important components leads to malfunctions and failures of the complex to assemble. Further, the screen can be used to identify drug targets in a high throughput and multiplex-able way. Multiple proteins can be degraded at once or complimentary activities can be encoded using this system where one protein is degraded while another is modified in another manner.


In some embodiments, the incorporation of azide, alkyne, or other click chemistry handles into a protein may enable the incorporation of signaling moieties into the protein. For example, localization signals can be attached to any and all proteins in the cell in a consistent manner to study the effects of localization on the entire proteome. As such, the localization signals are in the form of a localization probe, e.g., they may include reactive chemical groups that react with the reactive chemical handles in the protein.


A “localization signal,” as used herein, is a short (about 3-70 amino acids long) peptide chain that directs the transport of a protein to a specific region in the cell, including the nucleus, mitochondria, endoplasmic reticulum (ER), chloroplast, apoplast, peroxisome, periplasm and plasma membrane. In some embodiments, the localization signal is cleaved from the protein by signal peptidases after the proteins are transported. Typically, nuclear localization signal (NLS) contains one or more short sequences of positively charged lysines or arginines exposed on the protein surface. Non-limiting examples of NLS-probes that may be synthesized are illustrated in FIG. 6. See also, Wang et al., J. Control Release 2011 Oct. 10; 155(1):26-33, the entire contents of which is incorporated herein by reference. In some embodiments, a membrane localization signal is a “signal peptide” or a “leader peptide.” A signal peptide comprises a short (about 5-30 amino acids long) peptide present at the N-terminus of the majority of newly synthesized proteins that are destined towards the secretory pathway. In some embodiments, a membrane localization signal is a lipid moiety, e.g., a myristoyl moiety. Non-limiting examples of myristoyl probes that may be synthesized are illustrated in FIG. 5. The “mitochondrial localization signal” or “mitochondrial transport signal (MTS)” comprises a 10-70 amino acid long peptide that directs a newly synthesized proteins to the mitochondria. It is found at the N-terminus and consists of an alternating pattern of hydrophobic and positively charged amino acids to form what is called an amphipathic helix. An MTS can contain additional signals that subsequently target the protein to different regions of the mitochondria, such as the mitochondrial matrix. An MTS is cleaved once targeting is complete. Non-limiting examples of MTS-probes that may be synthesized are illustrated in FIG. 6. See also, Lin et al., Bioconjug Chem. 2015 Jan. 21;26(1):71-7, the entire contents of which is incorporated herein by reference. In some embodiments, the localization signal of the present disclosure may be about 3-70 amino acids long. For example, the localization signal may be 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 56, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, or more amino acids long.


In some embodiments, a variety of ligands can be appended to a protein using the click chemistry handles (e.g., azide handles) incorporated into the protein using the compositions and methods described herein, enabling the elucidation of the effects of such modification to the protein. The ligands that may be appended to a protein may be any of the known post-translational modifications, e.g., glycosylation, lipidation, phosphorylation, ubiquitination, acetylation, methylation, etc.


In some embodiments, a small molecule (e.g., a metabolite) is appended to a protein, which may be used to recruit various proteins and modifying enzymes to the protein. As such, protein complexes are formed and the formation of the complex and/or co-localization of proteins may be observed, or the protein complex may be isolated, e.g., by fluorescent labeling, or affinity tagging. In some embodiments, it is envisioned that one protein comprises unnatural amino acids containing, for example, an azide handle; and a second protein comprises a chemical moiety for labeling with a detection reagent, e.g., a fluorescent label. Chemical moieties that allow conjugation or attachment of a fluorescent label include, without limitation, a Halo-tag, a SNAP-tag, a CLIP tag, a FK-506 tag, and rapamycin. Those skilled in the art are familiar with the use of these tags for functional protein analysis. As illustrated in FIG. 7, a Halo-probe, and similarly a SNAP-probe or a CLIP-probe, for use in accordance with the presence disclosure may be synthesized. Using the methods described herein, protein-protein interactions, co-localization, trafficking, or other cellular events may be interrogated in a high throughput manner. In some embodiments, multiple cellular components may be interrogated simultaneous using multiple sets of OtRNA-ORS pairs.


In some embodiments, an aziridine handle is used to track protein complex formation. Amino acids containing an aziridine group bind adjacent protein surfaces in a covalent manner. Thus, integration of such tags into proteins could help discern direct protein contacts made between various proteins in a cell. In some embodiments, multiple sites per protein may be targeted for incorporation of unnatural amino acids to generate full coverage of the interactome. In some embodiments, the methods described herein may be integrated with small molecule screening platforms, RNAi screens, or CRIPSR gene knockout screening to identify small molecules that can perturb protein-protein interactions. In some embodiments, bulky residues that prevent protein binding, e.g., tryptophan, phenylalanine, can be used to identify interactions that drive biological phenomena.


The proteins, e.g., polypeptides, peptides, etc., of the present disclosure (e.g., comprising one or more unnatural amino acid) may be employed for therapeutic uses, e.g., in combination with a suitable pharmaceutical carrier. Such compositions, e.g., comprise a therapeutically effective amount of the compound and a pharmaceutically acceptable carrier or excipient. Such a carrier or excipient includes, but is not limited to, saline, buffered saline, dextrose, water, glycerol, ethanol, and/or combinations thereof. The formulation is made to suit the mode of administration. In general, methods of administering proteins are well known in the art and can be applied to administration of the polypeptides of the disclosure.


Therapeutic compositions comprising one or more polypeptide of the present disclosure are optionally tested in one or more appropriate in vitro and/or in vivo animal models of disease, to confirm efficacy, tissue metabolism, and to estimate dosages, according to methods well known in the art. In particular, dosages can be initially determined by activity, stability, or other suitable measures of unnatural herein to natural amino acid homologues (e.g., comparison of an EPO modified to include one or more unnatural amino acids to a natural amino acid EPO), i.e., in a relevant assay.


Administration is by any of the routes normally used for introducing a molecule into ultimate contact with blood or tissue cells. The unnatural amino acid polypeptides of the present disclosure are administered in any suitable manner, optionally with one or more pharmaceutically acceptable carriers. Suitable methods of administering such polypeptides in the context of the present disclosure to a patient are available, and, although more than one route can be used to administer a particular composition, a particular route can often provide a more immediate and more effective action or reaction than another route.


Pharmaceutically acceptable carriers are determined in part by the particular composition being administered, as well as by the particular method used to administer the composition. Accordingly, there is a wide variety of suitable formulations of pharmaceutical compositions of the present disclosure.


Polypeptide compositions can be administered by a number of routes including, but not limited to: oral, intravenous, intraperitoneal, intramuscular, transdermal, subcutaneous, topical, sublingual, or rectal means. Unnatural amino acid polypeptide compositions can also be administered via liposomes. Such administration routes and appropriate formulations are generally known to those of skill in the art.


The unnatural amino acid polypeptide, alone or in combination with other suitable components, can also be made into aerosol formulations (i.e., they can be “nebulized”) to be administered via inhalation. Aerosol formulations can be placed into pressurized acceptable propellants, such as dichlorodifluoromethane, propane, nitrogen, and the like.


Formulations suitable for parenteral administration, such as, for example, by intraarticular (in the joints), intravenous, intramuscular, intradermal, intraperitoneal, and subcutaneous routes, include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. The formulations of packaged nucleic acid can be presented in unit-dose or multi-dose sealed containers, such as ampules and vials.


Parenteral administration and intravenous administration are preferred methods of administration. In particular, the routes of administration already in use for natural amino acid homologue therapeutics (e.g., those typically used for EPO, GCSF, GMCSF, IFNs, interleukins, antibodies, and/or any other pharmaceutically delivered protein), along with formulations in current use, provide preferred routes of administration and formulation for the unnatural amino acids of the disclosure.


The dose administered to a patient, in the context of the present disclosure, is sufficient to effect a beneficial therapeutic response in the patient over time, or, e.g., to inhibit infection by a pathogen, or other appropriate activity, depending on the application. The dose is determined by the efficacy of the particular vector, or formulation, and the activity, stability, or serum half-life of the unnatural amino acid polypeptide employed and the condition of the patient, as well as the body weight or surface area of the patient to be treated. The size of the dose is also determined by the existence, nature, and extent of any adverse side-effects that accompany the administration of a particular vector, formulation, or the like in a particular patient.


In determining the effective amount of the vector or formulation to be administered in the treatment or prophylaxis of disease (e.g., cancers, inherited diseases, diabetes, AIDS, or the like), the physician evaluates circulating plasma levels, formulation toxicities, progression of the disease, and/or where relevant, the production of anti-unnatural amino acid polypeptide antibodies.


The dose administered, e.g., to a 70 kilogram patient are typically in the range equivalent to dosages of currently-used therapeutic proteins, adjusted for the altered activity or serum half-life of the relevant composition. The vectors of the present disclosure can supplement treatment conditions by any known conventional therapy, including antibody administration, vaccine administration, administration of cytotoxic agents, natural amino acid polypeptides, nucleic acids, nucleotide analogues, biologic response modifiers, and the like.


Nucleobase Editors


The methods of incorporating unnatural amino acids into a protein described herein, are enabled by the use of the nucleobase editors. As described herein, a nucleobase editor is a fusion protein comprising: (i) a programmable DNA binding protein domain; and (ii) a deaminase domain. It is to be understood that any programmable DNA binding domain may be used in the based editors of the present disclosure.


In some embodiments, the programmable DNA binding protein domain comprises the DNA binding domain of a zinc finger nuclease (ZFN) or a transcription activator-like effector domain (TALE). In some embodiments, the programmable DNA binding protein domain may be programmed by a guide nucleotide sequence, and is thus referred as a “guide nucleotide sequence-programmable DNA binding-protein domain.” In some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a nuclease inactive Cas9, or dCas9. A dCas9 as used herein, encompasses a Cas9 that is completely inactive in its nuclease activity, or partially inactive in its nuclease activity (e.g., a Cas9 nickase). Thus, in some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a Cas9 nickase. In some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a nuclease inactive Cpf1. In some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a nuclease inactive Argonaute.


In some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a dCas9 domain. In some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a Cas9 nickase. In some embodiments, the dCas9 domain comprises an amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 3. In some embodiments, the dCas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 domains provided herein (e.g., SEQ ID NOs: 1-3, and 11-260), and comprises mutations corresponding to D10X (X is any amino acid except for D) and/or H840X (X is any amino acid except for H) in SEQ ID NO: 1. In some embodiments, the dCas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 domains provided herein (e.g., SEQ ID NOs: 1-3, and 11-260), and comprises mutations corresponding to D10A and/or H840A in SEQ ID NO: 1. In some embodiments, the Cas9 nickase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 domains provided herein (e.g., 1-3, and 11-260), and comprises a mutation corresponding to D10X (X is any amino acid except for D) in SEQ ID NO: 1 and a histidine at a position correspond to position 840 in SEQ ID NO: 1. In some embodiments, the Cas9 nickase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 domains provided herein (e.g., 1-3, and 11-260), and comprises mutations corresponding to D10A in SEQ ID NO: 1 and a histidine at a position correspond to position 840 in SEQ ID NO: 1. In some embodiments, variants or homologues of dCas9 or Cas9 nickase (e.g., variants of SEQ ID NO: 2 or SEQ ID NO: 3, respectively) are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to SEQ ID NO: 2 or SEQ ID NO: 3, respectively, and comprises mutations corresponding to D10A and/or H840A in SEQ ID NO: 1. In some embodiments, variants of Cas9 (e.g., variants of SEQ ID NO: 2) are provided having amino acid sequences which are shorter, or longer than SEQ ID NO: 2, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids, or more, provided that the dCas9 variants comprise mutations corresponding to D10A and/or H840A in SEQ ID NO: 1. In some embodiments, variants of Cas9 nickase (e.g., variants of SEQ ID NO: 3) are provided having amino acid sequences which are shorter, or longer than SEQ ID NO: 3, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids, or more, provided that the dCas9 variants comprise mutations corresponding to D10A and comprises a histidine at a position corresponding to position 840 in SEQ ID NO: 1.


Additional suitable nuclease-inactive dCas9 domains will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure. Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A/H840A, D10A/D839A/H840A, D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant et al., Nature Biotechnology. 2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference), or K603R (See, e.g., Chavez et al., Nature Methods 12, 326-328, 2015, the entire contents of which is incorporated herein by reference.


Cas9 recognizes a short motif (PAM motif) in the CRISPR repeat sequences in the target DNA sequence. A “PAM motif,” or “protospacer adjacent motif,” as used herein, refers a DNA sequence immediately following the DNA sequence targeted by the Cas9 nuclease in the CRISPR bacterial adaptive immune system. PAM is a component of the invading virus or plasmid, but is not a component of the bacterial CRISPR locus. Naturally, Cas9 will not successfully bind to or cleave the target DNA sequence if it is not followed by the PAM sequence. PAM is an essential targeting component (not found in the bacterial genome) which distinguishes bacterial self from non-self DNA, thereby preventing the CRISPR locus from being targeted and destroyed by nuclease.


Wild-type Streptococcus pyogenes Cas9 recognizes a canonical PAM sequence (5′-NGG-3′). Other Cas9 nucleases (e.g., Cas9 from Streptococcus thermophiles, Staphylococcus aureus, Neisseria meningitidis, or Treponema denticolaor) and Cas9 variants thereof have been described in the art to have different, or more relaxed PAM requirements. For example, in Kleinstiver et al., Nature 523, 481-485, 2015; Klenstiver et al., Nature 529, 490-495, 2016; Ran et al., Nature, April 9; 520(7546): 186-191, 2015; Kleinstiver et al., Nat Biotechnol, 33(12):1293-1298, 2015; Hou et al., Proc Natl Acad Sci USA, 110(39):15644-9, 2014; Prykhozhij et al., PLoS One, 10(3): e0119372, 2015; Zetsche et al., Cell 163, 759-771, 2015; Gao et al., Nature Biotechnology, doi:10.1038/nbt.3547, 2016; Want et al., Nature 461, 754-761, 2009; Chavez et al., doi: dx.doi.org/10.1101/058974; Fagerlund et al., Genome Biol. 2015; 16: 25, 2015; Zetsche et al., Cell, 163, 759-771, 2015; and Swarts et al., Nat Struct Mol Biol, 21(9):743-53, 2014, the entire contents of each of which is incorporated herein by reference.


Thus, the guide nucleotide sequence-programmable DNA-binding protein of the present disclosure may recognize a variety of PAM sequences including, without limitation: NGG, NGAN, NGNG, NGAG, NGCG, NNGRRT, NGRRN, NNNRRT, NNNGATT, NNAGAAW, NAAAC, TTN, TTTN, and YTN, wherein Y is a pyrimidine, and N is any nucleobase.


One example of an RNA-programmable DNA-binding protein that has different PAM specificity is Clustered Regularly Interspaced Short Palindromic Repeats from Prevotella and Francisella 1 (Cpf1). Similar to Cas9, Cpf1 is also a class 2 CRISPR effector. It has been shown that Cpf1 mediates robust DNA interference with features distinct from Cas9. Cpf1 is a single RNA-guided endonuclease lacking tracrRNA, and it utilizes a T-rich protospacer-adjacent motif (TTN, TTTN, or YTN). Moreover, Cpf1 cleaves DNA via a staggered DNA double-stranded break. Out of 16 Cpf1-family proteins, two enzymes from Acidaminococcus and Lachnospiraceae are shown to have efficient genome-editing activity in human cells.


Also provided herein are nuclease-inactive Cpf1 (dCpf1) variants that may be used as a guide nucleotide sequence-programmable DNA-binding protein domain. The Cpf1 protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9 but does not have a HNH endonuclease domain, and the N-terminal of Cpf1 does not have the alfa-helical recognition lobe of Cas9. It was shown in Zetsche et al., Cell, 163, 759-771, 2015 (the entire contents of which is incorporated herein by reference) that, the RuvC-like domain of Cpf1 is responsible for cleaving both DNA strands and inactivation of the RuvC-like domain inactivates Cpf1 nuclease activity. For example, mutations corresponding to D917A, E1006A, or D1255A in Francisella novicida Cpf1 (SEQ ID NO: 261) inactivates Cpf1 nuclease activity. In some embodiments, the dCpf1 of the present disclosure comprises mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or D917A/E1006A/D1255A in SEQ ID NO: 261. It is to be understood that any mutations, e.g., substitution mutations, deletions, or insertions that inactivates the RuvC domain of Cpf1 may be used in accordance with the present disclosure.


Thus, in some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a nuclease inactive Cpf1 (dCpf1). In some embodiments, the dCpf1 comprises an amino acid sequence of any one SEQ ID NOs: 262-268. In some embodiments, the dCpf1 comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any one of SEQ ID NOs: 262-268, and comprises mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or D917A/E1006A/D1255A in SEQ ID NO: 261.










Wild type Francisella novicida Cpf1



(D917, E1006, and D1255 are bolded and underlined)


(SEQ ID NO: 261)



MSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDYKKAKQIIDKYH






QFFIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQISEYIKDSE 





KFKNLFNQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFKGWT 





TYFKGFHENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIK 





KDLAEELTFDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKFNTIIGGKFVNGEN





TKRKGINEYINLYSQQINDKTLKKYKMSVLFKQILSDTESKSFVIDKLEDDSDVVTTM 





QSFYEQIAAFKTVEEKSIKETLSLLFDDLKAQKLDLSKIYFKNDKSLTDLSQQVFDDY 





SVIGTAVLEYITQQIAPKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDI





DKQCRFEEILANFAAIPMIFDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIK 





DLLDQTNNLLHKLKIFHISQSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYI





TQKPYSDEKFKLNFENSTLANGWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFD 





DKAIKENKGEGYKKIVYKLLPGANKMLPKVFFSAKSIKFYNPSEDILRIRNHSTHTKN





GSPQKGYEKFEFNIEDCRKFIDFYKQSISKHPEWKDFGFRFSDTQRYNSIDEFYREVE 





NQGYKLTFENISESYIDSVVNQGKLYLFQIYNKDFSAYSKGRPNLHTLYWKALFDER 





NLQDVVYKLNGEAELFYRKQSIPKKITHPAKEAIANKNKDNPKKESVFEYDLIKDKR 





FTEDKFFFHCPITINFKSSGANKFNDEINLLLKEKANDVHILSIDRGERHLAYYTLVDG 





KGNIIKQDTFNIIGNDRMKTNYHDKLAAIEKDRDSARKDWKKINNIKEMKEGYLSQV





VHEIAKLVIEYNAIVVFEDLNFGFKRGRFKVEKQVYQKLEKMLIEKLNYLVFKDNEF 





DKTGGVLRAYQLTAPFETFKKMGKQTGIIYYVPAGFTSKICPVTGFVNQLYPKYESV





SKSQEFFSKFDKICYNLDKGYFEFSFDYKNFGDKAAKGKWTIASFGSRLINFRNSDKN





HNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAICGESDKKFFAKLTSVLNTILQM 





RNSKTGTELDYLISPVADVNGNFFDSRQAPKNMPQDADANGAYHIGLKGLMLLGRI





KNNQEGKKLNLVIKNEEYFEFVQNRNN






Francisella novicida Cpf1 D917A 



(A917, E1006, and D1255 are bolded and underlined)


(SEQ ID NO: 262)



MSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDYKKAKQIIDKYH






QFFIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQISEYIKDSE 





KFKNLFNQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFKGWT 





TYFKGFHENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIK 





KDLAEELTFDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKFNTIIGGKFVNGEN





TKRKGINEYINLYSQQINDKTLKKYKMSVLFKQILSDTESKSFVIDKLEDDSDVVTTM 





QSFYEQIAAFKTVEEKSIKETLSLLFDDLKAQKLDLSKIYFKNDKSLTDLSQQVFDDY 





SVIGTAVLEYITQQIAPKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDI





DKQCRFEEILANFAAIPMEDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIK 





DLLDQTNNLLHKLKIFHISQSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYI





TQKPYSDEKFKLNFENSTLANGWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFD 





DKAIKENKGEGYKKIVYKLLPGANKMLPKVFFSAKSIKFYNPSEDILRIRNHSTHTKN





GSPQKGYEKFEFNIEDCRKFIDFYKQSISKHPEWKDFGFRFSDTQRYNSIDEFYREVE 





NQGYKLTFENISESYIDSVVNQGKLYLFQIYNKDFSAYSKGRPNLHTLYWKALFDER 





NLQDVVYKLNGEAELFYRKQSIPKKITHPAKEAIANKNKDNPKKESVFEYDLIKDKR 





FTEDKFFFHCPITINFKSSGANKFNDEINLLLKEKANDVHILSIARGERHLAYYTLVDG 





KGNIIKQDTFNIIGNDRMKTNYHDKLAAIEKDRDSARKDWKKINNIKEMKEGYLSQV





VHEIAKLVIEYNAIVVFEDLNFGFKRGRFKVEKQVYQKLEKMLIEKLNYLVFKDNEF 





DKTGGVLRAYQLTAPFETFKKMGKQTGIIYYVPAGFTSKICPVTGFVNQLYPKYESV





SKSQEFFSKFDKICYNLDKGYFEFSFDYKNFGDKAAKGKWTIASFGSRLINFRNSDKN





HNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAICGESDKKFFAKLTSVLNTILQM 





RNSKTGTELDYLISPVADVNGNFFDSRQAPKNMPQDADANGAYHIGLKGLMLLGRI





KNNQEGKKLNLVIKNEEYFEFVQNRNN






Francisella novicida Cpf1 E1006A 



(D917, A1006, and D1255 are bolded and underlined)


(SEQ ID NO: 263)



MSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDYKKAKQIIDKYH






QFFIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQISEYIKDSE 





KFKNLFNQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFKGWT 





TYFKGFHENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIK 





KDLAEELTFDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKFNTIIGGKFVNGEN





TKRKGINEYINLYSQQINDKTLKKYKMSVLFKQILSDTESKSFVIDKLEDDSDVVTTM 





QSFYEQIAAFKTVEEKSIKETLSLLFDDLKAQKLDLSKIYFKNDKSLTDLSQQVFDDY 





SVIGTAVLEYITQQIAPKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDI





DKQCRFEEILANFAAIPMIFDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIK 





DLLDQTNNLLHKLKIFHISQSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYI





TQKPYSDEKFKLNFENSTLANGWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFD 





DKAIKENKGEGYKKIVYKLLPGANKMLPKVFFSAKSIKFYNPSEDILRIRNHSTHTKN





GSPQKGYEKFEFNIEDCRKFIDFYKQSISKHPEWKDFGFRFSDTQRYNSIDEFYREVE 





NQGYKLTFENISESYIDSVVNQGKLYLFQIYNKDFSAYSKGRPNLHTLYWKALFDER 





NLQDVVYKLNGEAELFYRKQSIPKKITHPAKEAIANKNKDNPKKESVFEYDLIKDKR 





FTEDKFFFHCPITINFKSSGANKFNDEINLLLKEKANDVHILSIDRGERHLAYYTLVDG 





KGNIIKQDTFNIIGNDRMKTNYHDKLAAIEKDRDSARKDWKKINNIKEMKEGYLSQV





VHEIAKLVIEYNAIVVFADLNFGFKRGRFKVEKQVYQKLEKMLIEKLNYLVFKDNEF 





DKTGGVLRAYQLTAPFETFKKMGKQTGIIYYVPAGFTSKICPVTGFVNQLYPKYESV





SKSQEFFSKFDKICYNLDKGYFEFSFDYKNFGDKAAKGKWTIASFGSRLINFRNSDKN





HNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAICGESDKKFFAKLTSVLNTILQM 





RNSKTGTELDYLISPVADVNGNFFDSRQAPKNMPQDADANGAYHIGLKGLMLLGRI





KNNQEGKKLNLVIKNEEYFEFVQNRNN






Francisella novicida Cpf1 D1255A 



(D917, E1006, and A1255 are bolded and underlined)


(SEQ ID NO: 264)



MSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDYKKAKQIIDKYH






QFFIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQISEYIKDSE 





KFKNLFNQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFKGWT 





TYFKGFHENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIK 





KDLAEELTFDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKFNTIIGGKFVNGEN





TKRKGINEYINLYSQQINDKTLKKYKMSVLFKQILSDTESKSFVIDKLEDDSDVVTTM 





QSFYEQIAAFKTVEEKSIKETLSLLFDDLKAQKLDLSKIYFKNDKSLTDLSQQVFDDY 





SVIGTAVLEYITQQIAPKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDI





DKQCRFEEILANFAAIPMEDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIK 





DLLDQTNNLLHKLKIFHISQSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYI





TQKPYSDEKFKLNFENSTLANGWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFD 





DKAIKENKGEGYKKIVYKLLPGANKMLPKVFFSAKSIKFYNPSEDILRIRNHSTHTKN





GSPQKGYEKFEFNIEDCRKFIDFYKQSISKHPEWKDFGFRFSDTQRYNSlDEFYREVE 





NQGYKLTFENISESYIDSVVNQGKLYLFQIYNKDFSAYSKGRPNLHTLYWKALFDER 





NLQDVVYKLNGEAELFYRKQSIPKKITHPAKEAIANKNKDNPKKESVFEYDLIKDKR 





FTEDKFFFHCPITINFKSSGANKFNDEINLLLKEKANDVHILSIDRGERHLAYYTLVDG 





KGNIIKQDTFNIIGNDRMKTNYHDKLAAIEKDRDSARKDWKKINNIKEMKEGYLSQV





VHEIAKLVIEYNAIVVFEDLNFGFKRGRFKVEKQVYQKLEKMLIEKLNYLVFKDNEF 





DKTGGVLRAYQLTAPFETFKKMGKQTGIIYYVPAGFTSKICPVTGFVNQLYPKYESV





SKSQEFFSKFDKICYNLDKGYFEFSFDYKNFGDKAAKGKWTIASFGSRLINFRNSDKN





HNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAICGESDKKFFAKLTSVLNTILQM 





RNSKTGTELDYLISPVADVNGNFFDSRQAPKNMPQDAAANGAYHIGLKGLMLLGRI





KNNQEGKKLNLVIKNEEYFEFVQNRNN






Francisella novicida Cpf1 D917A/E1006A 



(A917, A1006, and D1255 are bolded and underlined)


(SEQ ID NO: 265)



MSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDYKKAKQIIDKYH






QFFIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQISEYIKDSE 





KFKNLFNQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFKGWT 





TYFKGFHENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIK 





KDLAEELTFDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKFNTIIGGKFVNGEN





TKRKGINEYINLYSQQINDKTLKKYKMSVLFKQILSDTESKSFVIDKLEDDSDVVTTM 





QSFYEQIAAFKTVEEKSIKETLSLLFDDLKAQKLDLSKIYFKNDKSLTDLSQQVFDDY 





SVIGTAVLEYITQQIAPKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDI





DKQCRFEEILANFAAIPMEDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIK 





DLLDQTNNLLHKLKIFHISQSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYI





TQKPYSDEKFKLNFENSTLANGWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFD 





DKAIKENKGEGYKKIVYKLLPGANKMLPKVFFSAKSIKFYNPSEDILRIRNHSTHTKN





GSPQKGYEKFEFNIEDCRKFIDFYKQSISKHPEWKDFGFRFSDTQRYNSlDEFYREVE 





NQGYKLTFENISESYIDSVVNQGKLYLFQIYNKDFSAYSKGRPNLHTLYWKALFDER 





NLQDVVYKLNGEAELFYRKQSIPKKITHPAKEAIANKNKDNPKKESVFEYDLIKDKR 





FTEDKFFFHCPITINFKSSGANKFNDEINLLLKEKANDVHILSIARGERHLAYYTLVDG 





KGNIIKQDTFNIIGNDRMKTNYHDKLAAIEKDRDSARKDWKKINNIKEMKEGYLSQV





VHEIAKLVIEYNAIVVFADLNFGFKRGRFKVEKQVYQKLEKMLIEKLNYLVFKDNEF 





DKTGGVLRAYQLTAPFETFKKMGKQTGIIYYVPAGFTSKICPVTGFVNQLYPKYESV





SKSQEFFSKFDKICYNLDKGYFEFSFDYKNFGDKAAKGKWTIASFGSRLINFRNSDKN





HNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAICGESDKKFFAKLTSVLNTILQM 





RNSKTGTELDYLISPVADVNGNFFDSRQAPKNMPQDADANGAYHIGLKGLMLLGRI





KNNQEGKKLNLVIKNEEYFEFVQNRNN






Francisella novicida Cpf1 D917A/D1255A 



(A917, E1006, and A1255 are bolded and underlined)


(SEQ ID NO: 266)



MSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDYKKAKQIIDKYH






QFFIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQISEYIKDSE 





KFKNLFNQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFKGWT 





TYFKGFHENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIK 





KDLAEELTFDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKFNTIIGGKFVNGEN





TKRKGINEYINLYSQQINDKTLKKYKMSVLFKQILSDTESKSFVIDKLEDDSDVVTTM 





QSFYEQIAAFKTVEEKSIKETLSLLFDDLKAQKLDLSKIYFKNDKSLTDLSQQVFDDY 





SVIGTAVLEYITQQIAPKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDI





DKQCRFEEILANFAAIPMEDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIK 





DLLDQTNNLLHKLKIFHISQSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYI





TQKPYSDEKFKLNFENSTLANGWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFD 





DKAIKENKGEGYKKIVYKLLPGANKMLPKVFFSAKSIKFYNPSEDILRIRNHSTHTKN





GSPQKGYEKFEFNIEDCRKFIDFYKQSISKHPEWKDFGFRFSDTQRYNSIDEFYREVE 





NQGYKLTFENISESYIDSVVNQGKLYLFQIYNKDFSAYSKGRPNLHTLYWKALFDER 





NLQDVVYKLNGEAELFYRKQSIPKKITHPAKEAIANKNKDNPKKESVFEYDLIKDKR 





FTEDKFFFHCPITINFKSSGANKFNDEINLLLKEKANDVHILSIARGERHLAYYTLVDG 





KGNIIKQDTFNIIGNDRMKTNYHDKLAAIEKDRDSARKDWKKINNIKEMKEGYLSQV





VHEIAKLVIEYNAIVVFEDLNFGFKRGRFKVEKQVYQKLEKMLIEKLNYLVFKDNEF 





DKTGGVLRAYQLTAPFETFKKMGKQTGIIYYVPAGFTSKICPVTGFVNQLYPKYESV





SKSQEFFSKFDKICYNLDKGYFEFSFDYKNFGDKAAKGKWTIASFGSRLINFRNSDKN





HNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAICGESDKKFFAKLTSVLNTILQM 





RNSKTGTELDYLISPVADVNGNFFDSRQAPKNMPQDAAANGAYHIGLKGLMLLGRI





KNNQEGKKLNLVIKNEEYFEFVQNRNN






Francisella novicida Cpf1 E1006A/D1255A 



(D917, A1006, and A1255 are bolded and underlined)


(SEQ ID NO: 267)



MSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDYKKAKQIIDKYH






QFFIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQISEYIKDSE 





KFKNLFNQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFKGWT 





TYFKGFHENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIK 





KDLAEELTFDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKFNTIIGGKFVNGEN





TKRKGINEYINLYSQQINDKTLKKYKMSVLFKQILSDTESKSFVIDKLEDDSDVVTTM 





QSFYEQIAAFKTVEEKSIKETLSLLFDDLKAQKLDLSKIYFKNDKSLTDLSQQVFDDY 





SVIGTAVLEYITQQIAPKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDI





DKQCRFEEILANFAAIPMIFDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIK 





DLLDQTNNLLHKLKIFHISQSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYI





TQKPYSDEKFKLNFENSTLANGWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFD 





DKAIKENKGEGYKKIVYKLLPGANKMLPKVFFSAKSIKFYNPSEDILRIRNHSTHTKN





GSPQKGYEKFEFNIEDCRKFIDFYKQSISKHPEWKDFGFRFSDTQRYNSIDEFYREVE 





NQGYKLTFENISESYIDSVVNQGKLYLFQIYNKDFSAYSKGRPNLHTLYWKALFDER 





NLQDVVYKLNGEAELFYRKQSIPKKITHPAKEAIANKNKDNPKKESVFEYDLIKDKR 





FTEDKFFFHCPITINFKSSGANKFNDEINLLLKEKANDVHILSIDRGERHLAYYTLVDG 





KGNIIKQDTFNIIGNDRMKTNYHDKLAAIEKDRDSARKDWKKINNIKEMKEGYLSQV





VHEIAKLVIEYNAIVVFADLNFGFKRGRFKVEKQVYQKLEKMLIEKLNYLVFKDNEF 





DKTGGVLRAYQLTAPFETFKKMGKQTGIIYYVPAGFTSKICPVTGFVNQLYPKYESV





SKSQEFFSKFDKICYNLDKGYFEFSFDYKNFGDKAAKGKWTIASFGSRLINFRNSDKN





HNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAICGESDKKFFAKLTSVLNTILQM 





RNSKTGTELDYLISPVADVNGNFFDSRQAPKNMPQDAAANGAYHIGLKGLMLLGRI





KNNQEGKKLNLVIKNEEYFEFVQNRNN






Francisella novicida Cpf1 D917A/E1006A/D1255A 



(A917, A1006, and A1255 are bolded and underlined)


(SEQ ID NO: 268)



MSIYQEFVNKYSLSKTLRFELIPQGKTLENIKARGLILDDEKRAKDYKKAKQIIDKYH






QFFIEEILSSVCISEDLLQNYSDVYFKLKKSDDDNLQKDFKSAKDTIKKQISEYIKDSE 





KFKNLFNQNLIDAKKGQESDLILWLKQSKDNGIELFKANSDITDIDEALEIIKSFKGWT 





TYFKGFHENRKNVYSSNDIPTSIIYRIVDDNLPKFLENKAKYESLKDKAPEAINYEQIK 





KDLAEELTFDIDYKTSEVNQRVFSLDEVFEIANFNNYLNQSGITKFNTIIGGKFVNGEN





TKRKGINEYINLYSQQINDKTLKKYKMSVLFKQILSDTESKSFVIDKLEDDSDVVTTM 





QSFYEQIAAFKTVEEKSIKETLSLLFDDLKAQKLDLSKIYFKNDKSLTDLSQQVFDDY 





SVIGTAVLEYITQQIAPKNLDNPSKKEQELIAKKTEKAKYLSLETIKLALEEFNKHRDI





DKQCRFEEILANFAAIPMWDEIAQNKDNLAQISIKYQNQGKKDLLQASAEDDVKAIK 





DLLDQTNNLLHKLKIFHISQSEDKANILDKDEHFYLVFEECYFELANIVPLYNKIRNYI





TQKPYSDEKFKLNFENSTLANGWDKNKEPDNTAILFIKDDKYYLGVMNKKNNKIFD 





DKAIKENKGEGYKKIVYKLLPGANKMLPKVFFSAKSIKFYNPSEDILRIRNHSTHTKN





GSPQKGYEKFEFNIEDCRKFIDFYKQSISKHPEWKDFGFRFSDTQRYNSIDEFYREVE 





NQGYKLTFENISESYIDSVVNQGKLYLFQIYNKDFSAYSKGRPNLHTLYWKALFDER 





NLQDVVYKLNGEAELFYRKQSIPKKITHPAKEAIANKNKDNPKKESVFEYDLIKDKR 





FTEDKFFFHCPITINFKSSGANKFNDEINLLLKEKANDVHILSIARGERHLAYYTLVDG 





KGNIIKQDTFNIIGNDRMKTNYHDKLAAIEKDRDSARKDWKKINNIKEMKEGYLSQV





VHEIAKLVIEYNAIVVFADLNFGFKRGRFKVEKQVYQKLEKMLIEKLNYLVFKDNEF 





DKTGGVLRAYQLTAPFETFKKMGKQTGIIYYVPAGFTSKICPVTGFVNQLYPKYESV





SKSQEFFSKFDKICYNLDKGYFEFSFDYKNFGDKAAKGKWTIASFGSRLINFRNSDKN





HNWDTREVYPTKELEKLLKDYSIEYGHGECIKAAICGESDKKFFAKLTSVLNTILQM 





RNSKTGTELDYLISPVADVNGNFFDSRQAPKNMPQDAAANGAYHIGLKGLMLLGRI





KNNQEGKKLNLVIKNEEYFEFVQNRNN






In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain of the present disclosure has no requirements for a PAM sequence. One example of such guide nucleotide sequence-programmable DNA-binding protein may be an Argonaute protein from Natronobacterium gregoryi (NgAgo). NgAgo is a ssDNA-guided endonuclease. NgAgo binds 5′ phosphorylated ssDNA of ˜24 nucleotides (gDNA) to guide it to its target site and will make DNA double-strand breaks at gDNA site. In contrast to Cas9, the NgAgo-gDNA system does not require a protospacer-adjacent motif (PAM). Using a nuclease inactive NgAgo (dNgAgo) can greatly expand the codons that may be targeted. The characterization and use of NgAgo have been described in Gao et al., Nat Biotechnol. Epub 2016 May 2. PubMed PMID: 27136078; Swarts et al., Nature. 507(7491) (2014):258-61; and Swarts et al., Nucleic Acids Res. 43(10) (2015):5120-9, the entire contents of each of which are incorporated herein by reference. The sequence of Natronobacterium gregoryi Argonaute is provided in SEQ ID NO: 269.









Wild type Natronobacterium gregoryi Argonaute 


(SEQ ID NO: 269)


MTVIDLDSTTTADELTSGHTYDISVTLTGVYDNTDEQHPRMSLAFEQDNG





ERRYITLWKNTTPKDVFTYDYATGSTYIFTNIDYEVKDGYENLTATYQTT





VENATAQEVGTTDEDETFAGGEPLDHHLDDALNETPDDAETESDSGHVMT





SFASRDQLPEWTLHTYTLTATDGAKTDTEYARRTLAYTVRQELYTDHDAA





PVATDGLMLLTPEPLGETPLDLDCGVRVEADETRTLDYTTAKDRLLAREL





VEEGLKRSLWDDYLVRGIDEVLSKEPVLTCDEFDLHERYDLSVEVGHSGR





AYLHINFRHRFVPKLTLADIDDDNIYPGLRVKTTYRPRRGHIVWGLRDEC





ATDSLNTLGNQSVVAYHRNNQTPINTDLLDAIEAADRRVVETRRQGHGDD





AVSFPQELLAVEPNTHQIKQFASDGFHQQARSKTRLSASRCSEKAQAFAE





RLDPVRLNGSTVEFSSEFFTGNNEQQLRLLYENGESVLTFRDGARGAHPD





ETFSKGIVNPPESFEVAVVLPEQQADTCKAQWDTMADLLNQAGAPPTRSE





TVQYDAFSSPESISLNVAGAIDPSEVDAAFVVLPPDQEGFADLASPTETY





DELKKALANMGIYSQMAYFDRFRDAKIFYTRNVALGLLAAAGGVAFTTEH





AMPGDADMFIGIDVSRSYPEDGASGQINIAATATAVYKDGTILGHSSTRP





QLGEKLQSTDVRDIMKNAILGYQQVTGESPTHIVIHRDGFMNEDLDPATE





FLNEQGVEYDIVEIRKQPQTRLLAVSDVQYDTPVKSIAAINQNEPRATVA





TFGAPEYLATRDGGGLPRPIQIERVAGETDIETLTRQVYLLSQSHIQVHN





STARLPITTAYADQASTHATKGYLVQTGAFESNVGFL 






Also provided herein are Cas9 variants that have relaxed PAM requirements (PAMless Cas9). PAMless Cas9 exhibits an increased activity on a target sequence that does not comprise a canonical PAM (NGG) at its 3′-end as compared to Streptococcus pyogenes Cas9 as provided by SEQ ID NO: 1, e.g., increased activity by at least 5-fold, at least 10-fold, at least 50-fold, at least 100-fold, at least 500-fold, at least 1,000-fold, at least 5,000-fold, at least 10,000-fold, at least 50,000-fold, at least 100,000-fold, at least 500,000-fold, or at least 1,000,000-fold. Such Cas9 variants that have relaxed PAM requirements are described in U.S. Provisional Applications 62/245,828, 62/279,346, 62/311,763, 62/322,178, and 62/357,332, the entire contents of each of which are incorporated herein by reference. In some embodiments, the dCas9 or Cas9 nickase of the present disclosure may further comprise mutations that relax the PAM requirements, e.g., mutations that correspond to A262T, K294R, S409I, E480K, E543D, M694I, or E1219V in SEQ ID NO: 1.


In some embodiments, the nucleobase editors of the present disclosure comprises: (i) a guide nucleotide sequence-programmable DNA-binding protein domain; and (ii) a deaminase domain. In certain embodiments, the deaminase domain of the fusion protein is a cytosine deaminase.


In some embodiments, the deaminase is an APOBEC1 deaminase. In some embodiments, the deaminase is a rat APOBEC1. In some embodiments, the deaminase is a human APOBEC1. In some embodiments, the deaminase is an APOBEC2 deaminase. In some embodiments, the deaminase is an APOBEC3A deaminase. In some embodiments, the deaminase is an APOBEC3B deaminase. In some embodiments, the deaminase is an APOBEC3C deaminase. In some embodiments, the deaminase is an APOBEC3D deaminase. In some embodiments, is an APOBEC3F deaminase. In some embodiments, the deaminase is an APOBEC3G deaminase. In some embodiments, the deaminase is an APOBEC3H deaminase. In some embodiments, the deaminase is an APOBEC4 deaminase. In some embodiments, the deaminase is an activation-induced deaminase (AID). In some embodiments, the deaminase is a Lamprey CDA1 (pmCDA1). In some embodiments, the deaminase is an APOBEC3G variant comprising the D316R_D317R mutations. Exemplary, non-limiting cytosine deaminase sequences that may be used in accordance with the methods of the present disclosure are provided in Example 1 of the present disclosure.


In some embodiments, the cytosine deaminase is a wild type deaminase or a deaminase as set forth in SEQ ID NOs: 270-288 and 378-381. In some embodiments, the cytosine deaminase domains of the fusion proteins provided herein include fragments of deaminases and proteins homologous to a deaminase or a deaminase fragment. For example, in some embodiments, a deaminase domain may comprise a fragment of the amino acid sequence set forth in any of SEQ ID NOs: 270-288 and 378-381. In some embodiments, a deaminase domain comprises an amino acid sequence homologous to the amino acid sequence set forth in any of SEQ ID NOs: 270-288 and 378-381 or an amino acid sequence homologous to a fragment of the amino acid sequence set forth in any of SEQ ID NOs: 270-288 and 378-381. In some embodiments, proteins comprising a deaminase or fragments of a deaminase or homologs of a deaminase or deaminase fragments are referred to as “deaminase variants.” A deaminase variant shares homology to a deaminase, or a fragment thereof. For example a deaminase variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to a wild type deaminase or a deaminase as set forth in any of SEQ ID NOs: 270-288 and 378-381. In some embodiments, the deaminase variant comprises a fragment of the deaminase, such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to the corresponding fragment of wild type deaminase or a deaminase as set forth in any of SEQ ID NOs: 270-288 and 378-381. In some embodiments, the cytosine deaminase is at least at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to an APOBEC3G variant as set forth in SEQ ID NO: 380 or SEQ ID NO: 381, and comprises mutations corresponding to the D316E_D317R mutations in SEQ ID NO: 380.


In some embodiments, the cytosine deaminase domain may be fused to the N-terminus of the guide nucleotide sequence-programmable DNA-binding protein domain. For example, the fusion protein may have an architecture of NH2-[cytosine deaminase]-[guide nucleotide sequence-programmable DNA-binding protein domain]-COOH. The “]-[” used in the general architecture above indicates the presence of an optional linker sequence. The term “linker,” as used herein, refers to a chemical group or a molecule linking two molecules or moieties, e.g., two domains of a fusion protein, such as, for example, a dCas9 domain and a cytosine deaminase domain. Typically, the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two. In some embodiments, the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein). In some embodiments, the linker is an organic molecule, group, polymer, or chemical moiety. In some embodiments, the linker is 5-100 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 30-35, 35-40, 40-45, 45-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-150, or 150-200 amino acids in length. Longer or shorter linkers are also contemplated.


In some embodiments, the cytosine deaminase domain and the Cas9 domain are fused to each other via a linker. Various linker lengths and flexibilities between the deaminase domain (e.g., APOBEC1) and the Cas9 domain can be employed (e.g., ranging from very flexible linkers of the form (GGGS)n (SEQ ID NO: 362), (GGGGS)n (SEQ ID NO: 363), (GGS)n, and (G)n to more rigid linkers of the form (EAAAK)n (SEQ ID NO: 364), SGSETPGTSESATPES (SEQ ID NO: 365) (see, e.g., Guilinger J P et, al., Nat. Biotechnol. 2014; 32(6): 577-82; the entire contents are incorporated herein by reference), (XP)n, or a combination of any of these, wherein X is any amino acid and n is independently an integer between 1 and 30, in order to achieve the optimal length for deaminase activity for the specific application. In some embodiments, n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30, or, if more than one linker or more than one linker motif is present, any combination thereof. In some embodiments, the linker comprises a (GGS)n motif, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15. In some embodiments, the linker comprises a (GGS)n motif, wherein n is 1, 3, or 7. In some embodiments, the linker comprises the amino acid sequence SGSETPGTSESATPES (SEQ ID NO: 365), also referred to as the XTEN linker. In some embodiments, the linker comprises an amino acid sequence chosen from the group including, but not limited to, AGVF, GFLG, FK, AL, ALAL, or ALALA. Additional suitable linker motifs and linker configurations will be apparent to those of skill in the art. In some embodiments, suitable linker motifs and configurations include those described in Chen et al., Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. 2013; 65(10):1357-69, the entire contents of which are incorporated herein by reference. In some embodiments, the linker may comprise any of the following amino acid sequences: VPFLLEPDNINGKTC (SEQ ID NO: 387), GSAGSAAGSGEF (SEQ ID NO: 388), SIVAQLSRPDPA (SEQ ID NO: 389), MKIIEQLPSA (SEQ ID NO: 390), VRHKLKRVGS (SEQ ID NO: 391), GHGTGSTGSGSS (SEQ ID NO: 392), MSRPDPA (SEQ ID NO: 393), GSAGSAAGSGEF (SEQ ID NO: 394), SGSETPGTSESA (SEQ ID NO: 395), SGSETPGTSESATPEGGSGGS (SEQ ID NO: 396), or GGSM (SEQ ID NO: 397). Additional suitable linker sequences will be apparent to those of skill in the art based on the instant disclosure.


To successfully edit the targeted C base, linker length is important, as described in Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage, Nature, 533(7603):420-4, 2016, the entire contents of which are incorporated herein by reference. A 3-aa linker gives a 3-base editing window relative to the PAM sequence. A 9-aa linker gives a 4-base editing window relative to the PAM sequence. A 16-aa linker (e.g., the SGSETPGTSESATPES linker; SEQ ID NO: 365) gives a 5-base window relative to the PAM sequence with unusually strong activity. A 21-aa linker gives a ˜6-base editing window relative to the PAM sequence. Each of these windows can be useful for editing different targeted C bases. For example, the targeted C bases may be at different distances from the adjacent PAM sequence, and by varying the linker length, the precise editing of the desired C base is ensured. One skilled in the art, based on the teachings of CRISPR/Cas9 technology, in particular the teachings of U.S. Pat. No. 9,068,179, US Patent Application Publications US20150166980, US20150166981, US20150166982, US20150166984, and US20150165054, and U.S. Provisional Applications, 62/245,828, 62/279,346, 62/311,763, 62/322,178, and 62/357,352, and 62/370,700, 62/398,490, 62/498,686, PCT Application NO. PCT/US2016/058344, U.S. patent application Ser. No. 15/331,852, and in Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage, Nature, 533(7603):420-4, 2016, the entire contents of each of which are incorporated herein by reference.


, will be able to determine the window of editing for his/her purpose, and properly design the linker of the cytosine deaminase-dCas9 protein for the precise targeting of the desired C base.


In some embodiments, the fusion protein useful in the present disclosure further comprises a uracil glycosylase inhibitor (UGI) domain. A “uracil glycosylase inhibitor” refers to a protein or polypeptide that inhibits the activity of uracil-DNA glycosylase. The C to T base change induced by deamination results in a U:G heteroduplex, which triggers cellular DNA-repair response. For example, uracil DNA glycosylase (UDG) catalyzes removal of U from DNA in cells and initiates base excision repair, with reversion of the U:G pair to a C:G pair as the most common outcome. Thus, such cellular DNA-repair response may be responsible for the decrease in nucleobase editing efficiency in cells. Uracil DNA Glycosylase Inhibitor (UGI) is known in the art to potently blocks human UDG activity. As also described in Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage, Nature, 533(7603):420-4, 2016, fusing a UGI domain to the cytidine deaminase-dCas9 fusion protein efficiently reduced the activity of UDG and significantly enhanced editing efficiency.


Suitable UGI protein and nucleotide sequences are provided herein and additional suitable UGI sequences are known to those in the art, and include, for example, those published in Wang et al., Uracil-DNA glycosylase inhibitor gene of bacteriophage PBS2 encodes a binding protein specific for uracil-DNA glycosylase. J. Biol. Chem. 264:1163-1171(1989); Lundquist et al., Site-directed mutagenesis and characterization of uracil-DNA glycosylase inhibitor protein. Role of specific carboxylic amino acids in complex formation with Escherichia coli uracil-DNA glycosylase. J. Biol. Chem. 272:21408-21419(1997); Ravishankar et al., X-ray analysis of a complex of Escherichia coli uracil DNA glycosylase (EcUDG) with a proteinaceous inhibitor. The structure elucidation of a prokaryotic UDG. Nucleic Acids Res. 26:4880-4887(1998); and Putnam et al., Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase. J. Mol. Biol. 287:331-346(1999), the entire contents of which are incorporated herein by reference. In some embodiments, the UGI comprises the following amino acid sequence: Uracil-DNA glycosylase inhibitor MTNLSDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWAL VIQDSNGENKIKML (SEQ ID NO: 290)


In some embodiments, the UGI comprises a wild type UGI or a UGI as set forth inSEQ ID NO: 290. In some embodiments, the UGI proteins provided herein include fragments of UGI and proteins homologous to a UGI or a UGI fragment. For example, in some embodiments, a UGI comprises a fragment of the amino acid sequence set forth in SEQ ID NO: 290. In some embodiments, a UGI comprises an amino acid sequence homologous to the amino acid sequence set forth in SEQ ID NO: 290 or an amino acid sequence homologous to a fragment of the amino acid sequence set forth in SEQ ID NO: 290. In some embodiments, proteins comprising UGI or fragments of UGI or homologs of UGI or UGI fragments are referred to as “UGI variants.” A UGI variant shares homology to UGI, or a fragment thereof. For example a UGI variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to a wild type UGI or a UGI as set forth in SEQ ID NO: 290. In some embodiments, the UGI variant comprises a fragment of UGI, such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to the corresponding fragment of wild type UGI or a UGI as set forth in SEQ ID NO: 290.


In some embodiments, the UGI domain is fused to the C-terminus of the dCas9 domain in the fusion protein. Thus, the fusion protein would have an architecture of NH2-[cytosine deaminase]-[guide nucleotide sequence-programmable DNA-binding protein domain]-[UGI]-COOH. In some embodiments, the UGI domain is fused to the N-terminus of the cytosine deaminase domain. As such, the fusion protein would have an architecture of NH2-[UGI]-[cytosine deaminase]-[guide nucleotide sequence-programmable DNA-binding protein domain]-COOH. In some embodiments, the UGI domain is fused between the guide nucleotide sequence-programmable DNA-binding protein domain and the cytosine deaminase domain. As such, the fusion protein would have an architecture of NH2-[cytosine deaminase]-[UGI]-[guide nucleotide sequence-programmable DNA-binding protein domain]-COOH. The linker sequences described herein may also be used for the fusion of the UGI domain to the cytosine deaminase-dCas9 fusion proteins.


In some embodiments, the fusion protein comprises the structure: [cytosine deaminase]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA binding protein]-[optional linker sequence]-[UGI]; [cytosine deaminase]-[optional linker sequence]-[UGI]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA binding protein]; [UGI]-[optional linker sequence]-[cytosine deaminase]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA binding protein]; [UGI]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA binding protein]-[optional linker sequence]-[cytosine deaminase]; [guide nucleotide sequence-programmable DNA binding protein]-[optional linker sequence]-[cytosine deaminase]-[optional linker sequence]-[UGI]; or [guide nucleotide sequence-programmable DNA binding protein]-[optional linker sequence]-[UGI]-[optional linker sequence]-[cytosine deaminase].


In some embodiments, the fusion protein comprises the structure: [cytosine deaminase]-[optional linker sequence]-[Cas9 nickase]-[optional linker sequence]-[UGI]; [cytosine deaminase]-[optional linker sequence]-[UGI]-[optional linker sequence]-[Cas9 nickase]; [UGI]-[optional linker sequence]-[cytosine deaminase]-[optional linker sequence]-[Cas9 nickase]; [UGI]-[optional linker sequence]-[Cas9 nickase]-[optional linker sequence]-[cytosine deaminase]; [Cas9 nickase]-[optional linker sequence]-[cytosine deaminase]-[optional linker sequence]-[UGI]; or [Cas9 nickase]-[optional linker sequence]-[UGI]-[optional linker sequence]-[cytosine deaminase].


In some embodiments, fusion proteins provided herein further comprise a nuclear localization sequence (NLS). In some embodiments, the NLS is fused to the N-terminus of the fusion protein. In some embodiments, the NLS is fused to the C-terminus of the fusion protein. In some embodiments, the NLS is fused to the N-terminus of the UGI protein. In some embodiments, the NLS is fused to the C-terminus of the UGI protein. In some embodiments, the NLS is fused to the N-terminus of the guide nucleotide sequence-programmable DNA-binding protein domain. In some embodiments, the NLS is fused to the C-terminus of the guide nucleotide sequence-programmable DNA-binding protein domain. In some embodiments, the NLS is fused to the N-terminus of the cytosine deaminase. In some embodiments, the NLS is fused to the C-terminus of the deaminase. In some embodiments, the NLS is fused to the fusion protein via one or more linkers. In some embodiments, the NLS is fused to the fusion protein without a linker. Non-limiting, exemplary NLS sequences may be PKKKRKV (SEQ ID NO: 296) or MDSLLMNRRKFLYQFKNVRWAKGRRETYLC (SEQ ID NO: 297).


Some aspects of the present disclosure provide nucleobase editors that are capable of editing target C bases and convert the C bases to T bases. As such, a base editor may be a cytosine deaminase-dCas9 fusion protein. In some embodiments, the base editor may be a deaminase-dCas9-UGI fusion protein. In some embodiments, the base editor may be a APOBEC1-dCas9-UGI fusion protein. In some embodiments, the base editor may be APOBEC1-Cas9 nickase-UGI fusion protein. In some embodiments, the base editor may be APOBEC1-dCpf1-UGI fusion protein. In some embodiments, the base editor may be APOBEC1-dNgAgo-UGI fusion protein. In some embodiments, the base editor may be a pmCDA1-Cas9 nickase-UGI fusion protein. In some embodiments, the base editor may be a human APOBEC3G-Cas9 nickase UGI fusion protein. Non-limiting exemplary sequences of the nucleobase editors described herein are provided in Example 1, SEQ ID NOs: 291-295 and 382-386. Such nucleobase editors and methods of using them for genome editing have been described in the art, e.g., in U.S. Pat. No. 9,068,179, US Patent Application Publications US20150166980, US20150166981, US20150166982, US20150166984, and US20150165054, and U.S. Provisional Applications, 62/245,828, 62/279,346, 62/311,763, 62/322,178, and 62/357,352, and 62/370,700, 62/398,490, 62/498,686, PCT Application NO. PCT/US2016/058344, U.S. patent application Ser. No. 15/331,852, and in Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage, Nature, 533(7603):420-4, 2016, the entire contents of each of which are incorporated herein by reference.


In some embodiments, the nucleobase editor comprises the amino acid sequence of any one of SEQ ID NOs: 291-295 and 382-386. In some embodiments, the nucleobase editor comprises an amino acid sequence that is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to any one of SEQ ID NOs: 291-295 and 382-386. In some embodiments, the nucleobase editor consists of the amino acid sequence of any one of SEQ ID NO: 291-295 and 382-386.


Some aspects of the present disclosure provide nucleobase editors described herein associated with a guide nucleotide sequence (e.g., a guide RNA or gRNA). gRNAs can exist as a complex of two or more RNAs, or as a single RNA molecule. gRNAs that exist as a single RNA molecule may be referred to as single-guide RNAs (sgRNAs), though “gRNA” is used interchangeably to refer to guide RNAs that exist as either single molecules or as a complex of two or more molecules. Typically, gRNAs that exist as single RNA species comprise two domains: (1) a domain that shares homology to a target nucleic acid (e.g., and directs binding of a Cas9 complex to the target); and (2) a domain that binds a Cas9 protein. In some embodiments, domain (2) corresponds to a sequence known as a tracrRNA, and comprises a stem-loop structure. For example, in some embodiments, domain (2) is identical or homologous to a tracrRNA as provided in Jinek et al., Science 337:816-821(2012), the entire contents of which is incorporated herein by reference. Other examples of gRNAs (e.g., those including domain 2) can be found in U.S. Provisional Patent Application, U.S. Ser. No. 61/874,682, filed Sep. 6, 2013, entitled “Switchable Cas9 Nucleases And Uses Thereof,” and U.S. Provisional Patent Application, U.S. Ser. No. 61/874,746, filed Sep. 6, 2013, entitled “Delivery System For Functional Nucleases,” the entire contents of each are hereby incorporated by reference in their entirety. In some embodiments, a gRNA comprises two or more of domains (1) and (2), and may be referred to as an “extended gRNA.” For example, an extended gRNA will, e.g., bind two or more RNA guided-programmable DNA-binding proteins and bind a target nucleic acid at two or more distinct regions, as described herein. The gRNA comprises a nucleotide sequence that complements a target site, which mediates binding of the nuclease/RNA complex to said target site, providing the sequence specificity of the nuclease:RNA complex. These proteins are able to be targeted, in principle, to any sequence specified by the guide RNA. Methods of using RNA-programmable nucleases, such as Cas9, for site-specific cleavage (e.g., to modify a genome) are known in the art (see e.g., Cong, L. et al. Science 339, 819-823 (2013); Mali, P. et al. Science 339, 823-826 (2013); Hwang, W. Y. et al. Nature biotechnology 31, 227-229 (2013); Jinek, M. et al. eLife 2, e00471 (2013); Dicarlo, J. E. et al. Nucleic acids research (2013); Jiang, W. et al. Nature biotechnology 31, 233-239 (2013); the entire contents of each of which are incorporated herein by reference). In particular, examples of guide nucleotide sequences (e.g., sgRNAs) that may be used to target the nucleobase editors of the present disclosure to its target sequence to deaminate the targeted C bases are described in Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage, Nature, 533(7603):420-4, 2016, the entire contents of which are incorporated herein by reference. It is to be understood that co-expression of the nucleobase editors with an sgRNA results in targeting of the nucleobase editor to the target sequence.


The specific structure of the guide nucleotide sequences depends on its target sequence and the relative distance of a PAM sequence downstream of the target sequence. One skilled in the art will understand, that no unifying guide nucleotide sequence structure may be given, for that the target sequences are not the same for each and every C targeted to be deaminated.


The present disclosure further provides guidance in how to design the guide nucleotide sequence (e.g., an sgRNA) so that one skilled in the art may use such teaching to a target sequence of interest. A guide RNA typically comprises a tracrRNA framework allowing for Cas9 binding, and a guide sequence, which confers sequence specificity to fusion proteins disclosed herein. In some embodiments, the guide RNA comprises a structure 5′-[guide sequence]-guuuuagagcuagaaauagcaaguuaaaauaaaggcuaguccguuaucaacuugaaaaaguggcaccgagucggugcuu uuu-3′ (SEQ ID NO: 366), wherein the guide sequence comprises a sequence that is complementary to the target sequence. The guide sequence is typically 20 nucleotides long. Such suitable guide RNA sequences typically comprise guide sequences that are complementary to a nucleic sequence within 50 nucleotides upstream or downstream of the target nucleotide to be edited.


In some embodiments, the guide RNA is about 15-100 nucleotides long and comprises a sequence of at least 10 contiguous nucleotides that is complementary to a target sequence. In some embodiments, the guide RNA is 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 nucleotides long. In some embodiments, the guide RNA comprises a sequence of 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, or 40 contiguous nucleotides that is complementary to a target sequence. Non-limiting, exemplary gRNA sequences used for introducing nonsense codons into the coding sequence of BRD5 are provided in Example 4, SEQ ID NOs: 367-370. Non-limiting, exemplary gRNA sequences used for introducing nonsense codons into the coding sequence PRSS2 are provided in Example 4, SEQ ID NOs: 371-373.


Host Cells and Organisms


Other aspects of the present disclosure provide host cells and organisms for the in vivo incorporation of an unnatural amino acid via orthogonal tRNA/RS pairs. Host cells are genetically engineered to express the nucleobase editors and components of the translation system described herein. In some embodiments, host cells comprise vectors encoding the nucleobase editors and components of the translation system (e.g., transformed, transduced, or transfected), which can be, for example, a cloning vector or an expression vector. The vector can be, for example, in the form of a plasmid, a bacterium, a virus, a naked polynucleotide, or a conjugated polynucleotide. The vectors are introduced into cells and/or microorganisms by standard methods including electroporation, infection by viral vectors, high velocity ballistic penetration by small particles with the nucleic acid either within the matrix of small beads or particles, or on the surface (Klein et al., Nature 327, 70-73 (1987)). In some embodiments, the host cell is a prokaryotic cell. In some embodiments, the host cell is a eukaryotic cell. In some embodiments, the host cell is a bacterial cell. In some embodiments, the host cell is a yeast cell. In some embodiments, the host cell is a mammalian cell. In some embodiments, the host cell is a human cell. In some embodiments, the host cell is a cultured cell. In some embodiments, the host cell is within a tissue or an organism.


The engineered host cells can be cultured in conventional nutrient media modified as appropriate for such activities as, for example, screening steps, activating promoters or selecting transformants. These cells can optionally be cultured into transgenic organisms.


Several well-known methods of introducing target nucleic acids into bacterial cells are available, any of which can be used in the present disclosure. These include: fusion of the recipient cells with bacterial protoplasts containing the DNA, electroporation, projectile bombardment, and infection with viral vectors (discussed further, below), etc. Bacterial cells can be used to amplify the number of plasmids containing DNA constructs of the present disclosure. The bacteria are grown to log phase and the plasmids within the bacteria can be isolated by a variety of methods known in the art (see, for instance, Sambrook). In addition, a plethora of kits are commercially available for the purification of plasmids from bacteria, (see, e.g., EasyPrep™, FlexiPrep™, both from Pharmacia Biotech; StrataClean™, from Stratagene; and, QIAprep™ from Qiagen). The isolated and purified plasmids are then further manipulated to produce other plasmids, used to transfect cells or incorporated into related vectors to infect organisms. Typical vectors contain transcription and translation terminators, transcription and translation initiation sequences, and promoters useful for regulation of the expression of the particular target nucleic acid. The vectors optionally comprise generic expression cassettes containing at least one independent terminator sequence, sequences permitting replication of the cassette in eukaryotes, or prokaryotes, or both, (e.g., shuttle vectors) and selection markers for both prokaryotic and eukaryotic systems. Vectors are suitable for replication and integration in prokaryotes, eukaryotes, or preferably both. See, Giliman & Smith, Gene 8:81 (1979); Roberts, et al., Nature, 328:731 (1987); and Schneider, B., et al., Protein Expr. Purifi 6435:10 (1995)).


Bacteriophages useful for cloning is provided, e.g., by the ATCC, e.g., The ATCC Catalogue of Bacteria and Bacteriophage (1992) Gherna et al. (eds) published by the ATCC. Additional basic procedures for sequencing, cloning and other aspects of molecular biology and underlying theoretical considerations are also found in Watson et al. (1992) Recombinant DNA Second Edition Scientific American Books, NY.


Other useful references, e.g. for cell isolation and culture (e.g., for subsequent nucleic acid isolation) include Freshney (1994) Culture of Animal Cells, a Manual of Basic Technique, third edition, Wiley-Liss, New York and the references cited therein; Payne et al. (1992) Plant Cell and Tissue Culture in Liquid Systems John Wiley & Sons, Inc. New York, N.Y.; Gamborg and Phillips (eds) (1995) Plant Cell. Tissue and Organ Culture; Fundamental Methods Springer Lab Manual, Springer-Verlag (Berlin Heidelberg New York) and Atlas and Parks (eds) The Handbook of Microbiological Media (1993) CRC Press, Boca Raton, Fla.


In addition, essentially any nucleic acid (and virtually any labeled nucleic acid, whether standard or non-standard) can be custom or standard ordered from any of a variety of commercial sources, such as The Midland Certified Reagent Company (mcrc@oligos.com), The Great American Gene Company (www.genco.com), ExpressGen Inc. (www.expressgen.com), Operon Technologies Inc. (Alameda, Calif.), and many others.


Kits


Further provided herein are kits for the incorporation of unnatural amino acids into proteins using the systems, compositions, and methods described herein. In some embodiments, the kit comprises nucleic acid vectors for the expression of the nucleobase editors described herein. In some embodiments, the kit further comprises appropriate guide nucleotide sequences (e.g., gRNAs) or nucleic acid vectors for the expression of such guide nucleotide sequences, to target the nucleobase editors to the target sequences. In some embodiments, the kit further comprises nucleic acid vectors expressing the translation system described herein. In some embodiments, the kit comprises nucleic acid vectors expressing the OtRNA or the ORS described herein. In some embodiments, the kit is suitable for in vitro incorporation of unnatural amino acids into a protein. As such, the kit further comprises components of the translation machinery as described herein. In some embodiments, the protein components in an in vitro translation system are in the form of isolated proteins. In some embodiments, the components of translation machinery for an in vitro translation system are provided in a cell extract/cell lysate. In some embodiments, the components for an in vitro translation system comprises at least isolated RNA polymerases, isolated translation initiation factor, isolated ribosomes, isolated release factor-1, isolated release factor-2, isolated release factor-3, ATPs, GTPs, CTPs, UTPs, isolated elongation factor-Tu, natural aminoacyl-tRNA synthetases, natural tRNAs, or natural amino acids. In some embodiments, the kit further comprises one or more unnatural amino acids (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more).


The kit described herein may include one or more containers housing components for performing the methods described herein and optionally instructions of uses. Any of the kit described herein may further comprise components needed for performing the assay methods. Each component of the kits, where applicable, may be provided in liquid form (e.g., in solution), or in solid form, (e.g., a dry powder). In certain cases, some of the components may be reconstitutable or otherwise processible (e.g., to an active form), for example, by the addition of a suitable solvent or other species (for example, water or certain organic solvents), which may or may not be provided with the kit.


In some embodiments, the kits may optionally include instructions and/or promotion for use of the components provided. As used herein, “instructions” can define a component of instruction and/or promotion, and typically involve written instructions on or associated with packaging of the disclosure. Instructions also can include any oral or electronic instructions provided in any manner such that a user will clearly recognize that the instructions are to be associated with the kit, for example, audiovisual (e.g., videotape, DVD, etc.), Internet, and/or web-based communications, etc. The written instructions may be in a form prescribed by a governmental agency regulating the manufacture, use, or sale of pharmaceuticals or biological products, which can also reflect approval by the agency of manufacture, use or sale for animal administration. As used herein, “promoted” includes all methods of doing business including methods of education, hospital and other clinical instruction, scientific inquiry, drug discovery or development, academic research, pharmaceutical industry activity including pharmaceutical sales, and any advertising or other promotional activity including written, oral and electronic communication of any form, associated with the disclosure. Additionally, the kits may include other components depending on the specific application, as described herein.


The kits may contain any one or more of the components described herein in one or more containers. The components may be prepared sterilely, packaged in a syringe and shipped refrigerated. Alternatively it may be housed in a vial or other container for storage. A second container may have other components prepared sterilely. Alternatively the kits may include the active agents premixed and shipped in a vial, tube, or other container.


The kits may have a variety of forms, such as a blister pouch, a shrink wrapped pouch, a vacuum sealable pouch, a sealable thermoformed tray, or a similar pouch or tray form, with the accessories loosely packed within the pouch, one or more tubes, containers, a box or a bag. The kits may be sterilized after the accessories are added, thereby allowing the individual accessories in the container to be otherwise unwrapped. The kits can be sterilized using any appropriate sterilization techniques, such as radiation sterilization, heat sterilization, or other sterilization methods known in the art. The kits may also include other components, depending on the specific application, for example, containers, cell media, salts, buffers, reagents, syringes, needles, a fabric, such as gauze, for applying or removing a disinfecting agent, disposable gloves, a support for the agents prior to administration, etc.


Without further elaboration, it is believed that one skilled in the art can, based on the above description, utilize the present disclosure to its fullest extent. The following specific embodiments are, therefore, to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. All publications cited herein are incorporated by reference for the purposes or subject matter referenced herein.


EXAMPLES

In order that the disclosure described herein may be more fully understood, the following examples are set forth. The synthetic examples described in this application are offered to illustrate the compounds and methods provided herein and are not to be construed in any way as limiting their scope.


Example 1: Guide Nucleotide Sequence Programmable DNA-Binding Protein Domains, Deaminases, and Base Editors

Non-limiting examples of suitable guide nucleotide sequence-programmable DNA-binding protein domain s are provided. The disclosure provides Cas9 variants, for example, Cas9 proteins from one or more organisms, which may comprise one or more mutations (e.g., to generate dCas9 or Cas9 nickase). In some embodiments, one or more of the amino acid residues, identified below by an asterek, of a Cas9 protein may be mutated. In some embodiments, the D10 and/or H840 residues of the amino acid sequence provided in SEQ ID NO: 1, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 11-260, are mutated. In some embodiments, the D10 residue of the amino acid sequence provided in SEQ ID NO: 1, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 11-260, is mutated to any amino acid residue, except for D. In some embodiments, the D10 residue of the amino acid sequence provided in SEQ ID NO: 1, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 11-260, is mutated to an A. In some embodiments, the H840 residue of the amino acid sequence provided in SEQ ID NO: 1, or a corresponding residue in any of the amino acid sequences provided in SEQ ID NOs: 11-260, is an H. In some embodiments, the H840 residue of the amino acid sequence provided in SEQ ID NO: 1, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 11-260, is mutated to any amino acid residue, except for H. In some embodiments, the H840 residue of the amino acid sequence provided in SEQ ID NO: 1, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 11-260, is mutated to an A. In some embodiments, the D10 residue of the amino acid sequence provided in SEQ ID NO: 1, or a corresponding residue in any of the amino acid sequences provided in SEQ ID NOs: 11-260, is mutated to A, and the H840 residue of the amino acid sequence provided in SEQ ID NO: 1, or a corresponding residue in any of the amino acid sequences provided in SEQ ID NOs: 11-260, is an H.


A number of Cas9 sequences from various species were aligned to determine whether corresponding homologous amino acid residues of D10 and H840 of SEQ ID NO: 1 can be identified in other Cas9 proteins, allowing the generation of Cas9 variants with corresponding mutations of the homologous amino acid residues. The alignment was carried out using the NCBI Constraint-based Multiple Alignment Tool (COBALT (accessible at st-va.ncbi.nlm.nih.gov/tools/cobalt), with the following parameters. Alignment parameters: Gap penalties −11, −1; End-Gap penalties −5, −1. CDD Parameters: Use RPS BLAST on; Blast E-value 0.003; Find Conserved columns and Recompute on. Query Clustering Parameters: Use query clusters on; Word Size 4; Max cluster distance 0.8; Alphabet Regular.


An exemplary alignment of four Cas9 sequences is provided below. The Cas9 sequences in the alignment are: Sequence 1 (S1): SEQ ID NO: 111WP 0109222511 gi 499224711|type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes]; Sequence 2 (S2): SEQ ID NO: 121WP 039695303 I gi 746743737|type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus gallolyticus]; Sequence 3 (S3): SEQ ID NO: 13|WP_045635197|gi 782887988|type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mitis]; Sequence 4 (S4): SEQ ID NO: 1415AXW_A|gi 924443546|Staphylococcus Aureus Cas9. The HNH domain (bold and underlined) and the RuvC domain (boxed) are identified for each of the four sequences. Amino acid residues 10 and 840 in S1 and the homologous amino acids in the aligned sequences are identified with an asterisk following the respective amino acid residue.

















S1
1
--MDKK-YSIGLD*IGTNSVGWAVITDEYKVESKKFKVLGNTDRHSIKKNLI--GALLFDSG--ETAEATRLKRTARRRYT
73





S2
1
--MTKKNYSIGLD*IGTNSVGWAVITDDYKVPAKKMKVLGNTDKKYIKKNLL--GALLFDSG--ETAEATRLKRTARRRYT
74





S3
1
--M-KKGYSIGLD*IGTNSVGFAVITDDYKVPSKKMKVLGNTDKRFIKKNLI--GALLFDEG--TTAEARRLKRTARRRYT
73





S4
1
GSHMKRNYILGLD*IGITSVGYGII--DYET-----------------RDVIDAGVRLFKEANVENNEGRRSKRGARRLKR
61





S1
74
RRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRL
153





S2
75
RRKNRLRYLQEIFANEIAKVDESFFQRLDESFLTDDDKTFDSHPIFGNKAEEDAYHQKFPTIYHLRKHLADSSEKADLRL
154





S3
74
RRKNRLRYLQEIFSEEMSKVDSSFFHRLDDSFLIPEDKRESKYPIFATLTEEKEYHKQFPTIYHLRKQLADSKEKTDLRL
153





S4
62
RRRHRIQRVKKLL--------------FDYNLLTD--------------------HSELSGINPYEARVKGLSQKLSEEE
107





S1
154
IYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEK
233





S2
155
VYLALAHMIKFRGHFLIEGELNAENTDVQKIFADFVGVYNRTFDDSHLSEITVDVASILTEKISKSRRLENLIKYYPTEK
234





S3
154
IYLALAHMIKYRGHFLYEEAFDIKNNDIQKIFNEFISIYDNTFEGSSLSGQNAQVEAIFTDKISKSAKRERVLKLFPDEK
233





S4
108
FSAALLHLAKRRG----------------------VHNVNEVEEDT----------------------------------
131





S1
234
KNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEIT
313





S2
235
KNTLFGNLIALALGLQPNFKTNFKLSEDAKLQFSKDTYEEDLEELLGKIGDDYADLFTSAKNLYDAILLSGILTVDDNST
314





S3
234
STGLFSEFLKLIVGNQADFKKHFDLEDKAPLQFSKDTYDEDLENLLGQIGDDFTDLFVSAKKLYDAILLSGILTVTDPST
313





S4
132
-----GNELS------------------TKEQISRN--------------------------------------------
144





S1
314
KAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKM--DGTEELLV
391





S2
315
KAPLSASMIKRYVEHHEDLEKLKEFIKANKSELYHDIFKDKNKNGYAGYIENGVKQDEFYKYLKNILSKIKIDGSDYFLD
394





S3
314
KAPLSASMIERYENHQNDLAALKQFIKNNLPEKYDEVFSDQSKDGYAGYIDGKTTQETFYKYIKNLLSKF--EGTDYFLD
391





S4
145
----SKALEEKYVAELQ-------------------------------------------------LERLKKDG------
165





S1
392
KLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEE
471





S2
395
KIEREDFLRKQRTFDNGSIPHQIHLQEMHAILRRQGDYYPFLKEKQDRIEKILTFRIPYYVGPLVRKDSRFAWAEYRSDE
474





S3
392
KIEREDFLRKQRTFDNGSIPHQIHLQEMNAILRRQGEYYPFLKDNKEKIEKILTFRIPYYVGPLARGNRDFAWLTRNSDE
471





S4
166
--EVRGSINRFKTSD--------YVKEAKQLLKVQKAYHQLDQSFIDTYIDLLETRRTYYEGP--GEGSPFGW------K
227





S1
472
TITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDL
551





S2
475
KITPWNFDKVIDKEKSAEKFITRMTLNDLYLPEEKVLPKHSHVYETYAVYNELTKIKYVNEQGKE-SFFDSNMKQEIFDH
553





S3
472
AIRPWNFEEIVDKASSAEDFINKMTNYDLYLPEEKVLPKHSLLYETFAVYNELTKVKFIAEGLRDYQFLDSGQKKQIVNQ
551





S4
228
DIKEW---------------YEMLMGHCTYFPEELRSVKYAYNADLYNALNDLNNLVITRDENEK---LEYYEKFQIIEN
289





S1
552
LFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDR---FNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFED
628





S2
554
VFKENRKVTKEKLLNYLNKEFPEYRIKDLIGLDKENKSFNASLGTYHDLKKIL-DKAFLDDKVNEEVIEDIIKTLTLFED
632





S3
552
LFKENRKVTEKDIIHYLHN-VDGYDGIELKGIEKQ---FNASLSTYHDLLKIIKDKEFMDDAKNEAILENIVHTLTIFED
627





S4
290
VFKQKKKPTLKQIAKEILVNEEDIKGYRVTSTGKPEF---TNLKVYHDIKDITARKEII---ENAELLDQIAKILTIYQS
363





S1
629
REMIEERLKTYAHLFDDKVMKQLKR-RRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKED
707





S2
633
KDMIHERLQKYSDIFTANQLKKLER-RHYTGWGRLSYKLINGIRNKENNKTILDYLIDDGSANRNFMQLINDDTLPFKQI
711





S3
628
REMIKQRLAQYDSLFDEKVIKALTR-RHYTGWGKLSAKLINGICDKQTGNTILDYLIDDGKINRNFMQLINDDGLSFKEI
706





S4
364
SEDIQEELTNLNSELTQEEIEQISNLKGYTGTHNLSLKAINLILDE------LWHTNDNQIAIFNRLKLVP---------
428





S1
708


embedded image


781





S2
712


embedded image


784





S3
707


embedded image


779





S4
429


embedded image


505





S1
782


KRIEEGIKELGSQIL-------KEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSD----YDVDH*IVPQSFLKDD


850





S2
785


KKLQNSLKELGSNILNEEKPSYIEDKVENSHLQNDQLFLYYIQNGKDMYTGDELDIDHLSD----YDIDH*IIPQAFIKDD


860





S3
780


KRIEDSLKILASGL---DSNILKENPTDNNQLQNDRLFLYYLQNGKDMYTGEALDINQLSS----YDIDH*IIPQAFIKDD


852





S4
506


ERIEEIIRTTGK---------------ENAKYLIEKIKLHDMQEGKCLYSLEAIPLEDLLNNPFNYEVDH*IIPRSVSFDN


570





S1
851


embedded image


922





S2
861


embedded image


932





S3
853


embedded image


924





S4
571


embedded image


650





S1
923


embedded image


1002





S2
933


embedded image


1012





S3
925


embedded image


1004





S4
651


embedded image


712





S1
1003


embedded image


1077





S2
1013


embedded image


1083





S3
1005


embedded image


1081





S4
713


embedded image


764





S1
1078


embedded image


1149





S2
1084


embedded image


1158





S3
1082


embedded image


1156





S4
765


embedded image


835





S1
1150
EKGKSKKLKSVKELLGITIMERSSFEKNPI-DFLEAKG-----YKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKG
1223





S2
1159
EKGKAKKLKTVKELVGISIMERSFFEENPV-EFLENKG-----YHNIREDKLIKLPKYSLFEFEGGRRRLLASASELQKG
1232





S3
1157
EKGKAKKLKTVKTLVGITIMEKAAFEENPI-TFLENKG-----YHNVRKENILCLPKYSLFELENGRRRLLASAKELQKG
1230





S4
836
DPQTYQKLK--------LIMEQYGDEKNPLYKYYEETGNYLTKYSKKDNGPVIKKIKYYGNKLNAHLDITDDYPNSRNKV
907





S1
1224
NELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEITEQISEFSKRVILADANLDKVLSAYNKH------
1297





S2
1233
NEMVLPGYLVELLYHAHRADNF-----NSTEYLNYVSEHKKEFEKVLSCVEDFANLYVDVEKNLSKIRAVADSM------
1301





S3
1231
NEIVLPVYLTTLLYHSKNVHKL-----DEPGHLEYIQKHRNEFKDLLNLVSEFSQKYVLADANLEKIKSLYADN------
1299





S4
908
VKLSLKPYRFD-VYLDNGVYKFV-----TVKNLDVIK--KENYYEVNSKAYEEAKKLKKISNQAEFIASFYNNDLIKING
979





S1
1298
RDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSIT--------GLYETRI----DLSQL
1365





S2
1302
DNFSIEEISNSFINLLTLTALGAPADFNFLGEKIPRKRYTSTKECLNATLIHQSIT--------GLYETRI----DLSKL
1369





S3
1300
EQADIEILANSFINLLTFTALGAPAAFKFFGKDIDRKRYTTVSEILNATLIHQSIT--------GLYETWI----DLSKL
1367





S4
980
ELYRVIGVNNDLLNRIEVNMIDITYR-EYLENMNDKRPPRIIKTIASKT---QSIKKYSTDILGNLYEVKSKKHPQIIKK
1055





S1
1366
GGD
1368





S2
1370
GEE
1372





S3
1368
GED
1370





S4
1056
G--
1056









The alignment demonstrates that amino acid sequences and amino acid residues that are homologous to a reference Cas9 amino acid sequence or amino acid residue can be identified across Cas9 sequence variants, including, but not limited to Cas9 sequences from different species, by identifying the amino acid sequence or residue that aligns with the reference sequence or the reference residue using alignment programs and algorithms known in the art. This disclosure provides Cas9 variants in which one or more of the amino acid residues identified by an asterisk in SEQ ID NOs: 11-14 (e.g., 51, S2, S3, and S4, respectively) are mutated as described herein. The residues D10 and H840 in Cas9 of SEQ ID NO: 1 that correspond to the residues identified in SEQ ID NOs: 11-14 by an asterisk are referred to herein as “homologous” or “corresponding” residues. Such homologous residues can be identified by sequence alignment, e.g., as described above, and by identifying the sequence or residue that aligns with the reference sequence or residue. Similarly, mutations in Cas9 sequences that correspond to mutations identified in SEQ ID NO: 1 herein, e.g., mutations of residues 10, and 840 in SEQ ID NO: 11-14, are referred to herein as “homologous” or “corresponding” mutations. For example, the mutations corresponding to the D10A mutation in SEQ ID NO: 1 or 51 (SEQ ID NO: 11) for the four aligned sequences above are D11A for S2, D10A for S3, and D13A for S4; the corresponding mutations for H840A in SEQ ID NO: 1 or 51 (SEQ ID NO: 11) are H850A for S2, H842A for S3, and H560A for S4.


A total of 250 Cas9 sequences (SEQ ID NOs: 11-260) from different species are provided. Amino acid residues homologous to residues 10, and 840 of SEQ ID NO: 1 may be identified in the same manner as outlined above. All of these Cas9 sequences may be used in accordance with the present disclosure.

  • WP_010922251.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 11
  • WP_039695303.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus gallolyticus] SEQ ID NO: 12
  • WP_045635197.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mitis] SEQ ID NO: 13
  • 5AXW_A Cas9, Chain A, Crystal Structure [Staphylococcus Aureus] SEQ ID NO: 14
  • WP_009880683.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 15
  • WP_010922251.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 16
  • WP_011054416.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 17
  • WP_011284745.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 18
  • WP_011285506.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 19
  • WP_011527619.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 20
  • WP_012560673.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 21
  • WP_014407541.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 22
  • WP_020905136.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 23
  • WP_023080005.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 24
  • WP_023610282.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 25
  • WP_030125963.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 26
  • WP_030126706.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 27
  • WP_031488318.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 28
  • WP_032460140.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 29
  • WP_032461047.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 30
  • WP_032462016.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 31
  • WP_032462936.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 32
  • WP_032464890.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 33
  • WP_033888930.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 34
  • WP_038431314.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 35
  • WP_038432938.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 36
  • WP_038434062.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pyogenes] SEQ ID NO: 37
  • BAQ51233.1 CRISPR-associated protein, Csn1 family [Streptococcus pyogenes] SEQ ID NO: 38
  • KGE60162.1 hypothetical protein MGAS2111_0903 [Streptococcus pyogenes MGAS2111] SEQ ID NO: 39
  • KGE60856.1 CRISPR-associated endonuclease protein [Streptococcus pyogenes SS1447] SEQ ID NO: 40
  • WP_002989955.1 MULTISPECIES: type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus] SEQ ID NO: 41
  • WP_003030002.1 MULTISPECIES: type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus] SEQ ID NO: 42
  • WP_003065552.1 MULTISPECIES: type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus] SEQ ID NO: 43
  • WP_001040076.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 44
  • WP_001040078.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 45
  • WP_001040080.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 46
  • WP_001040081.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 47
  • WP_001040083.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 48
  • WP_001040085.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 49
  • WP_001040087.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 50
  • WP_001040088.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 51
  • WP_001040089.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 52
  • WP_001040090.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 53
  • WP_001040091.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 54
  • WP_001040092.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 55
  • WP_001040094.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 56
  • WP_001040095.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 57
  • WP_001040096.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 58
  • WP_001040097.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 59
  • WP_001040098.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 60
  • WP_001040099.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 61
  • WP_001040100.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 62
  • WP_001040104.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 63
  • WP_001040105.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 64
  • WP_001040106.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 65
  • WP_001040107.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 66
  • WP_001040108.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 67
  • WP_001040109.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 68
  • WP_001040110.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 69
  • WP_015058523.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 70
  • WP_017643650.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 71
  • WP_017647151.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 72
  • WP_017648376.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 73
  • WP_017649527.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 74
  • WP_017771611.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 75
  • WP_017771984.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 76
  • CFQ25032.1 CRISPR-associated protein [Streptococcus agalactiae] SEQ ID NO: 77
  • CFV16040.1 CRISPR-associated protein [Streptococcus agalactiae] SEQ ID NO: 78
  • KLJ37842.1 CRISPR-associated protein Csn1 [Streptococcus agalactiae] SEQ ID NO: 79
  • KLJ72361.1 CRISPR-associated protein Csn1 [Streptococcus agalactiae] SEQ ID NO: 80
  • KLL20707.1 CRISPR-associated protein Csn1 [Streptococcus agalactiae] SEQ ID NO: 81
  • KLL42645.1 CRISPR-associated protein Csn1 [Streptococcus agalactiae] SEQ ID NO: 82
  • WP_047207273.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 83
  • WP_047209694.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 84
  • WP_050198062.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 85
  • WP_050201642.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 86
  • WP_050204027.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 87
  • WP_050881965.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 88
  • WP_050886065.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus agalactiae] SEQ ID NO: 89
  • AHN30376.1 CRISPR-associated protein Csn1 [Streptococcus agalactiae 138P] SEQ ID NO: 90
  • EA078426.1 reticulocyte binding protein [Streptococcus agalactiae H36B] SEQ ID NO: 91
  • CCW42055.1 CRISPR-associated protein, SAG0894 family [Streptococcus agalactiae ILRI112] SEQ ID NO:92
  • WP_003041502.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus anginosus] SEQ ID NO: 93
  • WP_037593752.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus anginosus] SEQ ID NO: 94
  • WP_049516684.1 CRISPR-associated protein Csn1 [Streptococcus anginosus] SEQ ID NO: 95
  • GAD46167.1 hypothetical protein ANG6_0662 [Streptococcus anginosus T5] SEQ ID NO: 96
  • WP_018363470.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus caballi] SEQ ID NO: 97
  • WP_003043819.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus can's] SEQ ID NO: 98
  • WP_006269658.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus constellatus] SEQ ID NO: 99
  • WP_048800889.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus constellatus] SEQ ID NO: 100
  • WP_012767106.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus dysgalactiae] SEQ ID NO: 101
  • WP_014612333.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus dysgalactiae] SEQ ID NO: 102
  • WP_015017095.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus dysgalactiae] SEQ ID NO: 103
  • WP_015057649.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus dysgalactiae] SEQ ID NO: 104
  • WP_048327215.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus dysgalactiae] SEQ ID NO: 105
  • WP_049519324.1 CRISPR-associated protein Csn1 [Streptococcus dysgalactiae] SEQ ID NO: 106
  • WP_012515931.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus equi] SEQ ID NO: 107
  • WP_021320964.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus equi] SEQ ID NO: 108
  • WP_037581760.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus equi] SEQ ID NO: 109
  • WP_004232481.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus equinus] SEQ ID NO: 110
  • WP_009854540.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus gallolyticus] SEQ ID NO: 111
  • WP_012962174.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus gallolyticus] SEQ ID NO: 112
  • WP_039695303.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus gallolyticus] SEQ ID NO: 113
  • WP_014334983.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus infantarius] SEQ ID NO: 114
  • WP_003099269.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus iniae] SEQ ID NO: 115
  • AHY15608.1 CRISPR-associated protein Csn1 [Streptococcus iniae] SEQ ID NO: 116
  • AHY17476.1 CRISPR-associated protein Csn1 [Streptococcus iniae] SEQ ID NO: 117
  • ESR09100.1 hypothetical protein IUSA1 08595 [Streptococcus iniae IUSA1] SEQ ID NO: 118
  • AGM98575.1 CRISPR-associated protein Cas9/Csn1, subtype II/NMEMI [Streptococcus iniae SF1] SEQ ID NO: 119
  • ALF27331.1 CRISPR-associated protein Csn1 [Streptococcus intermedius] SEQ ID NO: 120
  • WP_018372492.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus massiliensis] SEQ ID NO: 121
  • WP_045618028.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mitis] SEQ ID NO: 122
  • WP_045635197.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mitis] SEQ ID NO: 123
  • WP_002263549.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 124
  • WP_002263887.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 125
  • WP_002264920.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 126
  • WP_002269043.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 127
  • WP_002269448.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 128
  • WP_002271977.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 129
  • WP_002272766.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 130
  • WP_002273241.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 131
  • WP_002275430.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 132
  • WP_002276448.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 133
  • WP_002277050.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 134
  • WP_002277364.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 135
  • WP_002279025.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 136
  • WP_002279859.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 137
  • WP_002280230.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 138
  • WP_002281696.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 139
  • WP_002282247.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 140
  • WP_002282906.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 141
  • WP_002283846.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 142
  • WP_002287255.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 143
  • WP_002288990.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 144
  • WP_002289641.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 145
  • WP_002290427.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 146
  • WP_002295753.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 147
  • WP_002296423.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 148
  • WP_002304487.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 149
  • WP_002305844.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 150
  • WP_002307203.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 151
  • WP_002310390.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 152
  • WP_002352408.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 153
  • WP_012997688.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 154
  • WP_014677909.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 155
  • WP_019312892.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 156
  • WP_019313659.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 157
  • WP_019314093.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 158
  • WP_019315370.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 159
  • WP_019803776.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 160
  • WP_019805234.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 161
  • WP_024783594.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 162
  • WP_024784288.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 163
  • WP_024784666.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 164
  • WP_024784894.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 165
  • WP_024786433.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus mutans] SEQ ID NO: 166
  • WP_049473442.1 CRISPR-associated protein Csn1 [Streptococcus mutans] SEQ ID NO: 167
  • WP_049474547.1 CRISPR-associated protein Csn1 [Streptococcus mutans] SEQ ID NO: 168
  • EMC03581.1 hypothetical protein SMU69_09359 [Streptococcus mutans NLML4] SEQ ID NO: 169
  • WP_000428612.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus oral's] SEQ ID NO: 170
  • WP_000428613.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus oral's] SEQ ID NO: 171
  • WP_049523028.1 CRISPR-associated protein Csn1 [Streptococcus parasanguinis] SEQ ID NO: 172
  • WP_003107102.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus parauberis] SEQ ID NO: 173
  • WP_054279288.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus phocae] SEQ ID NO: 174
  • WP_049531101.1 CRISPR-associated protein Csn1 [Streptococcus pseudopneumoniae] SEQ ID NO: 175
  • WP_049538452.1 CRISPR-associated protein Csn1 [Streptococcus pseudopneumoniae] SEQ ID NO: 176
  • WP_049549711.1 CRISPR-associated protein Csn1 [Streptococcus pseudopneumoniae] SEQ ID NO: 177
  • WP_007896501.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus pseudoporcinus] SEQ ID NO: 178
  • EFR44625.1 CRISPR-associated protein, Csn1 family [Streptococcus pseudoporcinus SPIN 20026] SEQ ID NO: 179
  • WP_002897477.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus sanguinis] SEQ ID NO: 180
  • WP_002906454.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus sanguinis] SEQ ID NO: 181
  • WP_009729476.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus sp. F0441] SEQ ID NO: 182
  • CQR24647.1 CRISPR-associated protein [Streptococcus sp. FF10] SEQ ID NO: 183
  • WP_000066813.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus sp. M334] SEQ ID NO: 184
  • WP_009754323.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus sp. taxon 056] SEQ ID NO: 185
  • WP_044674937.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus suis] SEQ ID NO: 186
  • WP_044676715.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus suis] SEQ ID NO: 187
  • WP_044680361.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus suis] SEQ ID NO: 188
  • WP_044681799.1 type II CRISPR RNA-guided endonuclease Cas9 [Streptococcus suis] SEQ ID NO: 189
  • WP_049533112.1 CRISPR-associated protein Csn1 [Streptococcus suis] SEQ ID NO: 190
  • WP_029090905.1 type II CRISPR RNA-guided endonuclease Cas9 [Brochothrix thermosphacta] SEQ ID NO: 191
  • WP_006506696.1 type II CRISPR RNA-guided endonuclease Cas9 [Catenibacterium mitsuokai] SEQ ID NO: 192
  • AIT42264.1 Cas9hc:NLS:HA [Cloning vector pYB196] SEQ ID NO: 193
  • WP_034440723.1 type II CRISPR endonuclease Cas9 [Clostridiales bacterium S5-All] SEQ ID NO: 194
  • AKQ21048.1 Cas9 [CRISPR-mediated gene targeting vector p(bhsp68-Cas9)] SEQ ID NO: 195
  • WP_004636532.1 type II CRISPR RNA-guided endonuclease Cas9 [Dolosigranulum pigrum] SEQ ID NO: 196
  • WP_002364836.1 MULTISPECIES: type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus] SEQ ID NO: 197
  • WP_016631044.1 MULTISPECIES: type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus] SEQ ID NO: 198
  • EMS75795.1 hypothetical protein H318_06676 [Enterococcus durans IPLA SEQ ID NO: 199
  • WP_002373311.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecalis] SEQ ID NO: 200
  • WP_002378009.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecalis] SEQ ID NO: 201
  • WP_002407324.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecalis] SEQ ID NO: 202
  • WP_002413717.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecalis] SEQ ID NO: 203
  • WP_010775580.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecalis] SEQ ID NO: 204
  • WP_010818269.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecalis] SEQ ID NO: 205
  • WP_010824395.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecalis] SEQ ID NO: 206
  • WP_016622645.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecalis] SEQ ID NO: 207
  • WP_033624816.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecalis] SEQ ID NO: 208
  • WP_033625576.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecalis] SEQ ID NO: 209
  • WP_033789179.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecalis] SEQ ID NO: 210
  • WP_002310644.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecium] SEQ ID NO: 211
  • WP_002312694.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecium] SEQ ID NO: 212
  • WP_002314015.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecium] SEQ ID NO: 213
  • WP_002320716.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecium] SEQ ID NO: 214
  • WP_002330729.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecium] SEQ ID NO: 215
  • WP_002335161.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecium] SEQ ID NO: 216
  • WP_002345439.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecium] SEQ ID NO: 217
  • WP_034867970.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecium] SEQ ID NO: 218
  • WP_047937432.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus faecium] SEQ ID NO: 219
  • WP_010720994.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus hirae] SEQ ID NO: 220
  • WP_010737004.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus hirae] SEQ ID NO: 221
  • WP_034700478.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus hirae] SEQ ID NO: 222
  • WP_007209003.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus italicus] SEQ ID NO: 223
  • WP_023519017.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus mundtii] SEQ ID NO: 224
  • WP_010770040.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus phoeniculicola] SEQ ID NO: 225
  • WP_048604708.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus sp. AM1] SEQ ID NO: 226
  • WP_010750235.1 type II CRISPR RNA-guided endonuclease Cas9 [Enterococcus villorum] SEQ ID NO: 227
  • AII16583.1 Cas9 endonuclease [Expression vector pCas9] SEQ ID NO: 228
  • WP_029073316.1 type II CRISPR RNA-guided endonuclease Cas9 [Kandleria vitulina] SEQ ID NO: 229
  • WP_031589969.1 type II CRISPR RNA-guided endonuclease Cas9 [Kandleria vitulina] SEQ ID NO: 230
  • KDA45870.1 CRISPR-associated protein Cas9/Csn1, subtype II/NMEMI [Lactobacillus animalis] SEQ ID NO: 231
  • WP_039099354.1 type II CRISPR RNA-guided endonuclease Cas9 [Lactobacillus curvatus] SEQ ID NO: 232
  • AKP02966.1 hypothetical protein ABB45_04605 [Lactobacillus farciminis] SEQ ID NO: 233
  • WP_010991369.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria innocual SEQ ID NO: 234
  • WP_033838504.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria innocual SEQ ID NO: 235
  • EHN60060.1 CRISPR-associated protein, Csn1 family [Listeria innocua ATCC 33091] SEQ ID NO: 236
  • EFR89594.1 crispr-associated protein, Csn1 family [Listeria innocua FSL S4-378] SEQ ID NO: 237
  • WP_038409211.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria ivanovii] SEQ ID NO: 238
  • EFR95520.1 crispr-associated protein Csn1 [Listeria ivanovii FSL F6-SEQ ID NO: 239
  • WP_003723650.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria monocytogenes] SEQ ID NO: 240
  • WP_003727705.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria monocytogenes] SEQ ID NO: 241
  • WP_003730785.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria monocytogenes] SEQ ID NO: 242
  • WP_003733029.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria monocytogenes] SEQ ID NO: 243
  • WP_003739838.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria monocytogenes] SEQ ID NO: 244
  • WP_014601172.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria monocytogenes] SEQ ID NO: 245
  • WP_023548323.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria monocytogenes] SEQ ID NO: 246
  • WP_031665337.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria monocytogenes] SEQ ID NO: 247
  • WP_031669209.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria monocytogenes] SEQ ID NO: 248
  • WP_033920898.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria monocytogenes] SEQ ID NO: 249
  • AKI42028.1 CRISPR-associated protein [Listeria monocytogenes] SEQ ID NO: 250
  • AK150529.1 CRISPR-associated protein [Listeria monocytogenes] SEQ ID NO: 251
  • EFR83390.1 crispr-associated protein Csn1 [Listeria monocytogenes FSL F2-208] SEQ ID NO: 252
  • WP_046323366.1 type II CRISPR RNA-guided endonuclease Cas9 [Listeria seeligeri] SEQ ID NO: 253
  • AKE81011.1 Cas9 [Plant multiplex genome editing vector pYLCRISPR/Cas9Pubi-H] SEQ ID NO: 254
  • CUO82355.1 Uncharacterized protein conserved in bacteria [Roseburia hominis] SEQ ID NO: 255
  • WP_033162887.1 type II CRISPR RNA-guided endonuclease Cas9 [Sharpea azabuensis] SEQ ID NO: 256
  • AGZ01981.1 Cas9 endonuclease [synthetic construct] SEQ ID NO: 257
  • AKA60242.1 nuclease deficient Cas9 [synthetic construct] SEQ ID NO: 258
  • AKS40380.1 Cas9 [Synthetic plasmid pFC330] SEQ ID NO: 259
  • 4UN5_B Cas9, Chain B, Crystal Structure SEQ ID NO: 260


Non-limiting examples of suitable deaminase domains are provided.










Human AID 



(SEQ ID NO: 270)




MDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDW







DLDPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIAI





MTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRILLPLYEVDDLRDAFRTLGL


(underline: nuclear localization signal; double underline: nuclear 


export signal)





Mouse AID 


(SEQ ID NO: 271)




MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLRNKSGCHVELLFLRYISD 







WDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQI





GIMTFKDYFYCWNTFVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF


(underline: nuclear localization signal; double underline: nuclear 


export signal)





Dog AID 


(SEQ ID NO: 272)




MDSLLMKQRKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLRNKSGCHVELLFLRYISDW







DLDPGRCYRVTWFTSWSPCYDCARHVADFLRGYPNLSLRIFAARLYFCEDRKAEPEGLRRLHRAGVQIA 





IMTFKDYFYCWNTFVENREKTFKAWEGLHENSVRLSRQLRRILLPLYEVDDLRDAFRTLGL 


(underline: nuclear localization signal; double underline: nuclear 


export signal)





Bovine AID 


(SEQ ID NO: 273)




MDSLLKKQRQFLYQFKNVRWAKGRHETYLCYVVKRRDSPTSFSLDFGHLRNKAGCHVELLFLRYISDW







DLDPGRCYRVTWFTSWSPCYDCARHVADFLRGYPNLSLRIFTARLYFCDKERKAEPEGLRRLHRAGVQI





AIMTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRILLPLYEVDDLRDAFRTLGL


(underline: nuclear localization signal; double underline: nuclear 


export signal)





Mouse APOBEC-3 


(SEQ ID NO: 274)



MGPFCLGCSHRKCYSPIRNLISQETFKFHFKNLGYAKGRKDTFLCYEVTRKDCDSPVSLHHGVFKNKDNI







HAEICFLYWFHDKVLKVLSPREEFKITWYMSWSPCFECAEQIVRFLATHHNLSLDIFSSRLYNVQDPETQQN






LCRLVQEGAQVAAMDLYEFKKCWKKFVDNGGRRFRPWKRLLTNFRYQDSKLQEILRPCYIPVPSSSSST 





LSNICLTKGLPETRFCVEGRRMDPLSEEEFYSQFYNQRVKHLCYYHRMKPYLCYQLEQFNGQAPLKGCL 





LSEKGKQHAEILFLDKIRSMELSQVTITCYLTWSPCPNCAWQLAAFKRDRPDLILHIYTSRLYFHWKRPFQK 





GLCSLWQSGILVDVMDLPQFTDCWTNFVNPKRPFWPWKGLEIISRRTQRRLRRIKESWGLQDLVNDFGN





LQLGPPMS


(italic: nucleic acid editing domain)





Rat APOBEC-3 


(SEQ ID NO: 275)



MGPFCLGCSHRKCYSPIRNLISQETFKFHFKNLRYAIDRKDTFLCYEVTRKDCDSPVSLHHGVFKNKDNI







HAEICFLYWFHDKVLKVLSPREEFKITWYMSWSPCFECAEQVLRFLATHHNLSLDIFSSRLYNIRDPENQQN






LCRLVQEGAQVAAMDLYEFKKCWKKFVDNGGRRFRPWKKLLTNFRYQDSKLQEILRPCYIPVPSSSSST 





LSNICLTKGLPETRFCVERRRVHLLSEEEFYSQFYNQRVKHLCYYHGVKPYLCYQLEQFNGQAPLKGCLL 





SEKGKQHAEILFLDKIRSMELSQVIITCYLTWSPCPNCAWQLAAFKRDRPDLILHIYTSRLYFHWKRPFQKG 





LCSLWQSGILVDVMDLPQFTDCWTNFVNPKRPFWPWKGLEIISRRTQRRLHRIKESWGLQDLVNDFGNL 





QLGPPMS


(italic: nucleic acid editing domain)





Rhesus macaque APOBEC-3G 


(SEQ ID NO: 276)




MVEPMDPRTFVSNFNNRPILSGLNTVWLCCEVKTKDPSGPPLDAKIFQGKVYSKAKYHPEM
RFLRWFHK








WRQLHHDQEYKVTWYVSWSPCTRCANSVATFLAKDPKVTLTIFVARLYYFWKPDYQQALRILCQKRGGP 






HATMKIMNYNEFQDCWNKFVDGRGKPFKPRNNLPKHYTLLQATLGELLRHLMDPGTFTSNFNNKPWV





SGQHETYLCYKVERLHNDTWVPLNQHRGFLRNQAPNIHGFPKGRHAELCFLDLIPFWKLDGQQYRVTCFT






SWSPCFSCAQEMAKFISNNEHVSLCIFAARIYDDQGRYQEGLRALHRDGAKIAMMNYSEFEYCWDTFVD 






RQGRPFQPWDGLDEHSQALSGRLRAI


(italic: nucleic acid editing domain; underline: cytoplasmic 


localization signal)





Chimpanzee APOBEC-3G 


(SEQ ID NO: 277)




MKPHFRNPVERMYQDTFSDNFYNRPILSHRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYSKLKYHPEMR








FFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDVATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLC 






QKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPPTFTSNFNN





ELWVRGRHETYLCYEVERLHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLHQD






YRVTCFTSWSPCFSCAQEMAKFISNNKHVSLCIFAARIYDDQGRCQEGLRTLAKAGAKISIMTYSEFKHCW






DTFVDHQGCPFQPWDGLEEHSQALSGRLRAILQNQGN


(italic: nucleic acid editing domain; underline: cytoplasmic 


localization signal)





Green monkey APOBEC-3G 


(SEQ ID NO: 278X)




MNPQIRNMVEQMEPDIFVYYFNNRPILSGRNTVWLCYEVKTKDPSGPPLDANIFQGKLYPEAKDHPEMK








FLHWFRKWRQLHRDQEYEVTWYVSWSPCTRCANSVATFLAEDPKVTLTIFVARLYYFWKPDYQQALRILC 






QERGGPHATMKIMNYNEFQHCWNEFVDGQGKPFKPRKNLPKHYTLLHATLGELLRHVMDPGTFTSNFN





NKPWVSGQRETYLCYKVERSHNDTWVLLNQHRGFLRNQAPDRHGFPKGRHAELCFLDLIPFWKLDDQQ






YRVTCFTSWSPCFSCAQKMAKFISNNKHVSLCIFAARIYDDQGRCQEGLRTLHRDGAKIAVMNYSEPEYC 






WDTFVDRQGRPFQPWDGLDEHSQALSGRLRAI


(italic: nucleic acid editing domain; underline: cytoplasmic 


localization signal)





Human APOBEC-3G 


(SEQ ID NO: 279)




MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYSELKYHPEMR








FFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLC 






QKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPPTFTFNFNN





EPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQD






YRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCW






DTFVDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN


(italic: nucleic acid editing domain; underline: cytoplasmic 


localization signal)





Human APOBEC-3F 


(SEQ ID NO: 280)



MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHHAEMC







FLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQ 






AGARVKIMDDEEFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIFYFHFKNL 





RKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTS






WSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVY 






NDDEPFKPWKGLKYNFLFLDSKLQEILE 


(italic: nucleic acid editing domain)





Human APOBEC-3B 


(SEQ ID NO: 281)



MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVYFKPQYHAE







MCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYWERDYRRALCRL 






SQAGARVTIMDYEEFAYCWENFVYNEGQQFMPWYKFDENYAFLHRTLKEILRYLMDPDTFTFNFNNDP 





LVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRV






TWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYC 






WDTFVYRQGCPFQPWDGLEEHSQALSGRLRAILQNQGN


(italic: nucleic acid editing domain)





Human APOBEC-3C: 


(SEQ ID NO: 282)



MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAE







RCFLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLS






QEGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ 


(italic: nucleic acid editing domain)





Human APOBEC-3A: 


(SEQ ID NO: 283)



MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQHRGFLHNQAKNLLCGFYG 






RHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEAL 





QMLRDAGAQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN


(italic: nucleic acid editing domain)





Human APOBEC-3H: 


(SEQ ID NO: 284)



MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICHNEIKSMGLDET 







QCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPKF 






ADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKIPGVRAQGRYMDILCDAEV


(italic: nucleic acid editing domain)





Human APOBEC-3D 


(SEQ ID NO: 285)



MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHR 






QEVYFRFENHAEMCFLSWFCGNRLPANRRFQITWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYY 





RDRDWRWVLLRLHKAGARVKIMDYEDFAYCWENFVCNEGQPFMPWYKFDDNYASLHRTLKEILRNP 





MEAMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGVFRNQVDPETHCHAERCFLSWFC 






DDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKI






MGYKDFVSCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ 


(italic: nucleic acid editing domain)





Human APOBEC-1 


(SEQ ID NO: 286)



MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKF 






TSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGV





TIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLH





LQNCHYQTIPPHILLATGLIHPSVAWR 





Mouse APOBEC-1 


(SEQ ID NO: 287)



mSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSVWRHTSQNTSNHVEVNFLEKF 






TTERYFRPNTRCSITWFLSWSPCGECSRAITEFLSRHPYVTLFIYIARLYHHTDQRNRQGLRDLISSGVTIQI





MTEQEYCYCWRNFVNYPPSNEAYWPRYPHLWVKLYVLELYCIILGLPPCLKILRRKQPQLTFFTITLQTC 





HYQRIPPHLLWATGLK 





Rat APOBEC-1 


(SEQ ID NO: 288)



MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTNKHVEVNFIEKFT 






TERYFCPNTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHADPRNRQGLRDLISSGVTIQIM 





TEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILGLPPCLNILRRKQPQLTFFTIALQSCHY 





QRLPPHILWATGLK 






Petromyzon marinus CDA1 (pmCDA1)



(SEQ ID NO: 378)



MTDAEYVRIHEKLDIYTFKKQFFNNKKSVSHRCYVLFELKRRGERRACFWGYAVNKPQSGTERGIHAEI






FSIRKVEEYLRDNPGQFTINWYSSWSPCADCAEKILEWYNQELRGNGHTLKIWACKLYYEKNARNQIGL 





WNLRDNGVGLNVMVSEHYQCCRKIFIQSSHNQLNENRWLEKTLKRAEKRRSELSIMIQVKILHTTKSPAV





Human APOBEC3G D316R_D317R 


(SEQ ID NO: 379)



MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYSELKYHPEMR 






FFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRS





LCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPPTFTFNF 





NNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDL 





DQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYRRQGRCQEGLRTLAEAGAKISIMTYSEFK 





HCWDTFVDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN





Human APOBEC3G chain A 


(SEQ ID NO: 380)



MDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLD 






VIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAK 





ISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRLRAILQ 





Human APOBEC3G chain A D120R_D121R 


(SEQ ID NO: 381)



MDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLD 






VIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYRRQGRCQEGLRTLAEAGAK 





ISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRLRAILQ 





Non-limiting examples of fusion proteins/nucleobase editors are provided. 


His6-rAPOBEC1-XTEN-dCas9 for Escherichia coli expression 


(SEQ ID NO: 291)



MGSSHHHHHHMSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTN






KHVEVNFIEKFTTERYFCPNTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHADPRNRQGL 





RDLISSGVTIQIMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILGLPPCLNILRRKQPQ 





LTFFTIALQSCHYQRLPPHILWATGLKSGSETPGTSESATPESDKKYSIGLAIGTNSVGWAVITDEYKVPSK 





KFKVLGNTDRHSIKKNUGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRL 





EESFLVEEDK|KHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDL 





NPDNSDVDKLFQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSL 





GLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGOQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSA 





SMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKHKPILEKMDGTEELL 





VKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRF 





AWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTE 





GMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDK 





DFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQS





GKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDEL 





VKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQ 





NGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQL 





LNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLK 





SKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIG 





KATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQT 





GGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSS





FEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKL 





KGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNL 





GAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSGGSPKKKRKV





rAPOBEC1-XTEN-dCas9-NLS for Mammalian expression 


(SEQ ID NO: 292)



MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTNKHVEVNFIEKF 






TTERYFCPNTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHADPRNRQGLRDLISSGVTIQ 





IMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILGLPPCLNILRRKQPQLTFFTIALQSC 





HYQRLPPHILWATGLKSGSETPGTSESATPESDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDR 





HSIKKNLIGALLFDSGETAEAT|RLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFRHRLEESFLVEEDKK 





HERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMKFRGHFLIEGDLNPDNSDVDKLF 





IQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDL 





AEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAFLSASMIKRYDEHHQ





DLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQ 





RTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITP 





WNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQ 





KKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILE 





DIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRMYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFA 





NRNFMQLIHDDSLITKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVI





EMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDI





NRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNL 





TKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQF 





YKVREINNYHHAHDAYLNAVVGTALIKKYPKLESERNGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNNIM





NFFKTEITLANGEIRKRPLIETNGETGEIWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRN





SDKLIARKKWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKG 





YKEVKKLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQL 





FVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTI





DRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSGGSPKKKRKV





hAPOBEC1-XTEN-dCas9-NLS for Mammalian expression 


(SEQ ID NO: 293)



MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFT 






SERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTI





QIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHL 





QNCHYQTIPPHILLATGLIHPSVAWRSGSETPGTSESATPESDKKYSIGLAIGTNSVGWAVITDEYKVPSKKF 





KVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFL 





VEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNS





DVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFK 





SNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYD 





EHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLL 





RKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETI





TPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQ 





KKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDI





VLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANR 





NFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIE 





MARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINR 





LSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKA 





ERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVR 





EINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKT 





EITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIA 





RKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDL 





IIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLD 





EIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVL 





DATLIHQSITGLYETRIDLSQLGGDSGGSPKKKRKV





rAPOBEC1-XTEN-dCas9-UGI-NLS


(SEQ ID NO: 294)



MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYDNWGGRHSIWRHTSQNTNKHVEVNFIEKF 






TTERYFCPNTRCSMNFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHADPRNRQGLRDLISSGVTQ 





IMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIIGLPPCLNILRRKQPQLTFFTIALQSC 





HYQRLPPHILWATGLKSGSETPGTSESATPESDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDR 





HSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRKYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKK 





HERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLF 





IQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDL 





AEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQ 





DLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQ 





RTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITP 





WNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQ 





KKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILE 





DIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFA 





NRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVI





EMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDI





NRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYVVRQLLNAKLITQRKFDNL





TKAERGGLSELDKAGFIKRQLVETRQFIKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQF 





YKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIM 





NFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRN





SDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKG 





YKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQL 





FVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPREQAENIIHLFTLTNLGAPAAFKYFDTTI





DRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSGGSTNLSDIIEKETGKQLVIQESILMLPEEVEEVIG 





NKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKMLSGGSPKKKRKV





rAPOBEC1-XTEN-Cas9 nickase-UGI-NLS


(BE3, SEQ ID NO: 295)



MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTNKHVEVNFIEKF 






TTERYFCPNTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHADPRNRQGLRDLISSGVTIQ 





IMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILGLPPCLNILRRKQPQLTFFTIALQSC 





HYQRLPPHILWATGLKSGSETPGTSESATPESDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDR 





HSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRCYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKK 





HERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLF 





IQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDL 





AEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILSDILRVNTEITKAPLSASMIKRYDEHHQ 





DLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQ 





RTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITP 





WNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQ 





KKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILE 





DIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFA 





NRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVI





EMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDI





NRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNL 





TKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQF 





YKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIM 





NFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRN





SDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKG 





YKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQL 





FVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTI





DRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSGGSTNLSDIIEKETGKQLVIQESILMLPEEVEEVIG 





NKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKMLSGGSPKKKRKV





pmCDA1-XTEN-dCas9-UGI (bacteria)


(SEQ ID NO: 382)



MTDAEYVRIHEKLDIYTFKKQFFNNKKSVSHRCYVLFELKRRGERRACFWGYAVNKPQSGTERGIHAEIFSI






RKVEEYLRDNPGQFTINWYSSWSPCADCAEKILEWYNQELRGNGHTLKIWACKLYYEKNARNQIGLWNL 





RDNGVGLNVMVSEHYQCCRKIFIQSSHNQLNENRWLEKTLKRAEKRRSELSIMIQVKILHTTKSPAVSGSET 





PGTSESATPESDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRL 





KRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHL 





RKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAI





LSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGD 





QYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNG 





YAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPF 





LKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPN





EKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSV





EISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLK 





RRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEH





IANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQI 





LKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGK 





SDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDS





RMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVY 





GDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFAT 





VRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGK 





SKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELAL 





PSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPI





REQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSGGSMTNL 





SDIIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNG 





ENKIKML 





pmCDA1-XTEN-nCas9-UGI-NLS (mammalian construct) (SEQ ID NO: 383):


MTDAEYVRIHEKLDIYTFKKQFFNNKKSVSHRCYVLFELKRRGERRACFWGYAVNKPQSGTERGIHAEIFSI





RKVEEYLRDNPGQFTINWYSSWSPCADCAEKILEWYNQELRGNGHTLKIWACKLYYEKNARNQIGLWNL 





RDNGVGLNVMVSEHYQCCRKIFIQSSHNQLNENRWLEKTLKRAEKRRSELSIMIQVKILHTTKSPAVSGSET 





PGTSESATPESDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRL 





KRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHL 





RKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAI





LSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGD 





QYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNG 





YAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPF 





LKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPN





EKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSV





EISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLK 





RRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEH





IANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQ1 





LKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGK 





SDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDS





RMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVY 





GDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFAT 





VRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGK 





SKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELAL 





PSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPI





REQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSGGSTNLSD 





IIEKETGKQLVIQESILMLPEEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGEN





KIKMLSGGSPKKKRKV





huAPOBEC3G-XTEN-dCas9-UGI (bacteria)


(SEQ ID NO: 384)



MDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLD 






VIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKIS





IMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRLRAILQSGSETPGTSESATPESDKKYSIGLAIG 





TNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEI





FSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALA 





HMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGE 





KKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDIL 





RVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPIL 





EKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGP 





LARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELT 





KVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLL 





KIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRD 





KQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVV





DELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQLKEHPVENTQLQNEKLYLYY 





LQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWR 





QLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVIT 





LKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQE1 





GKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQ 





TGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFE 





KNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSP 





EDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAA 





FKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSGGSMTNLSDIIEKETGKQLVIQESILMLP 





EEVEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNG ENKIKML 





huAPOBEC3G-XTEN-nCas9-UGI-NLS (mammalian construct)


(SEQ ID NO: 385)



MDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLD 






VIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKIS





IMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRLRAILQSGSETPGTSESATPESDKKYSIGLAIG 





TNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEI





FSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALA 





HMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGE 





KKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDIL 





RVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPIL 





EKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGP 





LARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELT 





KVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLL 





KIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRD 





KQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVV





DELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYY 





LQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWR 





QLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVIT 





LKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEI 





GKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQ 





TGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFE 





KNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSP 





EDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAA 





FKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSGGSTNLSDIIEKETGKQLVIQESILMLPEE 





VEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKMLSGGSPKKKRKV





huAPOBEC3G (D316R_D317R)-XTEN-nCas9-UGI-NLS (mammalian construct)


(SEQ ID NO: 386)



MDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLD 






VIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYRRQGRCQEGLRTLAEAGAKISI





MTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRLRAILQSGSETPGTSESATPESDKKYSIGLAIGT 





NSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFS





NEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAH





MIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEK 





KNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILR 





VNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILE 





KMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPL 





ARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTK 





VKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLK 





IIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDK 





QSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVD 





ELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYL 





QNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWR 





QLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVIT 





LKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQE1 





GKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQ 





TGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFE 





KNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSP 





EDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAA 





FKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGDSGGSTNLSDIIEKETGKQLVIQESILMLPEE 





VEEVIGNKPESDILVHTAYDESTDENVMLLTSDAPEYKPWALVIQDSNGENKIKMLSGGSPKKKRKV






Example 2: OtRNAs and ORSes








TABLE 3 







Non-limiting Examples of OtRNA and ORS Sequences











SEQ



Sequence
ID NO













M. jannaschii

CCGGCGGTAGTTCAGCAGGGCAGAACGGCGGACTCTAAAT
5


mtRNATyr-CUA
CCGCATGGCGCTGGTTCAAATCCGGCCCGCCGGACCA






HLAD03, an
CCCAGGGTAGCCAAGCTCGGCCAACGGCGACGGACTCTAA
6


optimized amber
ATCCGTTCTCGTAGGAGTTCGAGGGTTCGAATCCCTTCCCT



suppressor tNRA
GGGACCA






HL325A, an
GCGAGGGTAGCCAAGCTCGGCCAACGGCGACGGACTTCCT
7


optimized AGGA
AATCCGTTCTCGTAGGAGTTCGAGGGTTCGAATCCCTCCCC



frameshift tRNA
TCGCACCA






mutant TryRS
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
299


(LWJ16)
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTCAGATAGGTTTTGAACCAAGTGGTAAA




ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA




TTTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTG




ATTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTACTTT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGAA




GTTATCTATCCAATAATGCAGGTTAATGCAATTCATTATCC




TGGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAA




ATACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGT




TTGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAG




GGAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGAT




GACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCAT




ACTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGA




GATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAA




GGCCAGAAAAATTTGGTGGAGATTTGACAGTTAGTAGCTAT




GAGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATC




CAATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAA




GATTTTAGAGCCAATTAGAAAGAGATTATAA






p-iPr-PheRS
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
300



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTGGGATAGGTTTTGAACCAAGTGGTAAA




ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA




TTTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTG




ATTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATGTGCTTATGGAAGTCCTTT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAG




TTATCTATCCAATAATGCAGGTTAATGGTTATCATTATCTTG




GCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAAT




ACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTTT




GTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGGA




AAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATGA




CTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATAC




TGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAGA




TAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAGG




CCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATGA




GGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCCA




ATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAGA




TTTTAGAGCCAATTAGAAAGAGATTA






p-NH2-PheRS(1)
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
301



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTCAGATAGGTTTTGAACCAAGTGGTAAA




ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA




TTTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTG




ATTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTCCTTT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAG




TTATCTATCCAATAATGCAGGTTAATTGTTCTCATTATTATG




GCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAAT




ACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTTT




GTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGGA




AAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATGA




CTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATAC




TGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAGA




TAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAGG




CCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATGA




GGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCCA




ATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAGA




TTTTAGAGCCAATTAGAAAGAGATTA






p-NH2-PheRS(2)
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
302



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTACTATAGGTTTTGAACCAAGTGGTAAAA




TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTACGTTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAGT




TATCTATCCAATAATGCAGGTTAATCCGTTGCATTATGCTG




GCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAAT




ACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTTT




GTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGGA




AAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATGA




CTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATAC




TGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAGA




TAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAGG




CCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATGA




GGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCCA




ATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAGA




TTTTAGAGCCAATTAGAAAGAGATTA






p-NH2-PheRS(3a)
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
303



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTCATATAGGTTTTGAACCAAGTGGTAAAA




TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTGAGTT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAG




TTATCTATCCAATAATGCAGGTTAATCGGCCGCATTATCCT




GGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTA






p-NH2-PheRS(3b)
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
304



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTTATATAGGTTTTGAACCAAGTGGTAAAA




TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTCCTTTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAGT




TATCTATCCAATAATGCAGGTTAATCAGAGTCATTATGATG




GCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAAT




ACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTTT




GTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGGA




AAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATGA




CTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATAC




TGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAGA




TAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAGG




CCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATGA




GGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCCA




ATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAGA




TTTTAGAGCCAATTAGAAAGAGATTA






O-Allyl-TyrRS(1)
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
305



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTTCGATAGGTTTTGAACCAAGTGGTAAAA




TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTACGTTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAGT




TATCTATCCAATAATGCAGGTTAATACGTATCATTATGCTG




GCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAAT




ACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTTT




GTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGGA




AAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATGA




CTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATAC




TGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAGA




TAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAGG




CCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATGA




GGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCCA




ATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAGA




TTTTAGAGCCAATTAGAAAGAGATTA






O-Allyl-TyrRS(3)
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
306



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTCCTATAGGTTTTGAACCAAGTGGTAAAA




TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTATGTTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAGT




TATCTATCCAATAATGCAGGTTAATAATACGCATTATGGGG




GCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAAT




ACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTTT




GTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGGA




AAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATGA




CTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATAC




TGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAGA




TAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAGG




CCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATGA




GGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCCA




ATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAGA




TTTTAGAGCCAATTAGAAAGAGATTA






O-Allyl-TyrRS(4)
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
307



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTACGATAGGTTTTGAACCAAGTGGTAAA




ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA




TTTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTG




ATTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTCATTT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAG




TTATCTATCCAATAATGCAGGTTAATCAGACTCATTATGAG




GGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTA






p-Br-PheRS
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
308



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTCATATAGGTTTTGAACCAAGTGGTAAAA




TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTAAGTT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAG




TTATCTATCCAATAATGCAGGTTAATCCGTGTCATTATCAT




GGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTA






p-Az-PheRS(1)
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
309



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTGCTATAGGTTTTGAACCAAGTGGTAAAA




TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTCGGTTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAGT




TATCTATCCAATAATGCAGGTTAATGTGATTCATTATGATG




GCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAAT




ACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTTT




GTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGGA




AAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATGA




CTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATAC




TGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAGA




TAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAGG




CCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATGA




GGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCCA




ATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAGA




TTTTAGAGCCAATTAGAAAGAGATTA






p-Az-PheRS(3)
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
310



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTGGGATAGGTTTTGAACCAAGTGGTAAA




ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA




TTTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTG




ATTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTACTTT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAG




TTATCTATCCAATAATGCAGGTTAATACGTATTATTATGCT




GGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTA






p-Az-PheRS(5)
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
311



TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA




TGAAAAATCTGCTCTGATAGGTTTTGAACCAAGTGGTAAAA




TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTCCGTTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAGT




TATCTATCCAATAATGCAGGTTAATCAGATTCATTCTAGTG




GCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAAT




ACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTTT




GTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGGA




AAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATGA




CTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATAC




TGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAGA




TAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAGG




CCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATGA




GGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCCA




ATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAGA




TTTTAGAGCCAATTAGAAAGAGATTA






mutant ORS to
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
312


incorporate m-acyl
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



phenylalanine into
TGAAAAATCTGCTGACATAGGTTTTGAACCAAGTGGTAAA



proteins (ketone 3-4)
ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA




TTTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTG




ATTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTGAAT




TCCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTG




GCTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGG




AACTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGA




AGTTATCTATCCAATAATGCAGGTTAATGGAATGCATTATC




AAGGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAA




AATACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTT




GTTTGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGA




AGGAAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTG




ATGACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGC




ATACTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATG




GAGATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAA




AAGGCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGC




TATGAGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGC




ATCCAATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATA




AAGATTTTAGAGCCAATTAGAAAGAGATTATAA






mutant ORS to
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
313


incorporate m-acyl
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



phenylalanine into
TGAAAAATCTGCTTACATAGGTTTTGAACCAAGTGGTAAAA



proteins (ketone 3-7)
TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTCTATTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGAAG




TTATCTATCCAATAATGCAGGTTAATGATATTCATTATACA




GGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTATAA






mutant ORS to
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
314


incorporate m-acyl
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



phenylalanine into
TGAAAAATCTGCTCTAATAGGTTTTGAACCAAGTGGTAAAA



proteins (ketone 4-1)
TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGACAGA




TTTAAACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTGAATT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGAA




GTTATCTATCCAATAATGCAGGTTAATGATATTCATTATTTA




GGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTATAA






mutant ORS to
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
315


incorporate m-acyl
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



phenylalanine into
TGAAAAATCTGCTCTAATAGGTTTTGAACCAAGTGGTAAAA



proteins (ketone 5-4)
TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGACAGA




TTTAAAAGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTGAATT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGAA




GTTATCTATCCAATAATGTCAGTTAATGTAATTCATTATTTA




GGCGTTGATGTTGTAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTATAA






mutant ORS to
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
316


incorporate m-acyl
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



phenylalanine into
TGAAAAATCTGCTCTAATAGGTTTTGAACCAAGTGGTAAAA



proteins (ketone 6-8)
TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGCCAGA




TTTATCAGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTGAATT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGAA




GTTATCTATCCAATAATGCAGGTTAATGATATTCATTATTTA




GGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTATAA






mutant ORS to
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
317


incorporate m-
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



methoxy
TGAAAAATCTGCTACAATAGGTTTTGAACCAAGTGGTAAA



phenylalanine into
ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA



proteins (OMe 1-6)
TTTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTG




ATTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTGAAT




TCCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTG




GCTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGG




AACTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGA




AGTTATCTATCCAATAATGCAGGTTAATGATATTCATTATG




CAGGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAA




AATACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTT




GTTTGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGA




AGGAAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTG




ATGACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGC




ATACTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATG




GAGATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAA




AAGGCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGC




TATGAGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGC




ATCCAATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATA




AAGATTTTAGAGCCAATTAGAAAGAGATTATAA






mutant ORS to
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
318


incorporate m-
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



methoxy
TGAAAAATCTGCTACAATAGGTTTTGAACCAAGTGGTAAA



phenylalanine into
ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA



proteins (OMe 1-8)
TTTACAAAATGCTGGATTTGATATAATTATATTGTTGTCCG




ATTTACCAGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTGAAT




TCCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTG




GCTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGG




AACTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGA




AGTTATCTATCCAATAATGCAGGTTAATGATATTCATTATTT




AGGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAA




ATACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGT




TTGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAG




GAAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGAT




GACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCAT




ACTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGA




GATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAA




GGCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTAT




GAGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATC




CAATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAA




GATTTTAGAGCCAATTAGAAAGAGATTATAA






mutant ORS to
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
319


incorporate m-
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



methoxy
TGAAAAATCTGCTACAATAGGTTTTGAACCAAGTGGTAAA



phenylalanine into
ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA



proteins (OMe 2-7)
TTTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTG




ATTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTATGTT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGAA




GTTATCTATCCAATAATGCAGGTTAATTCATCACATTATGA




CGGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAA




ATACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGT




TTGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAG




GAAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGAT




GACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCAT




ACTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGA




GATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAA




GGCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTAT




GAGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATC




CAATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAA




GATTTTAGAGCCAATTAGAAAGAGATTATAA






mutant ORS to
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
320


incorporate m-
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



methoxy
TGAAAAATCTGCTCAAATAGGTTTTGAACCAAGTGGTAAA



phenylalanine into
ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA



proteins (OMe 4-1)
TTTACAAAATGCTGGATTTGATATAATTATATTGTTGCCAG




ATTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTGAAT




TCCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTG




GCTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGG




AACTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGA




AGTTATCTATCCAATAATGCAGGTTAATGATATTCATTATTT




AGGCGTTGATGTTGACGTTGGAGGGATGGAGCAGAGAAAA




ATACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGT




TTGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAG




GAAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGAT




GACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCAT




ACTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGA




GATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAA




GGCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTAT




GAGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATC




CAATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAA




GATTTTAGAGCCAATTAGAAAGAGATTATAA






mutant ORS to
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
321


incorporate m-
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



methoxy
TGAAAAATCTGCTCACATAGGTTTTGAACCAAGTGGTAAAA



phenylalanine into
TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT



proteins (OMe 4-8)
TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTGCATTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGAAG




TTATCTATCCAATAATGCAGGTTAATGGACACCATTATATA




GGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTATAA






mutant ORS to
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
322


incorporate p-O-
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



allyl tyrosine into
TGAAAAATCTGCTTACATAGGTTTTGAACCAAGTGGTAAAA



proteins
TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT




TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTGCATTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGCAAGAGAGGATGAAAATCCAAAGGTTGCTGAAG




TTATCTATCCAATAATGCAGGTTAATTGCGCACATTATTTA




GGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTATAA






ORS for the
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
323


incorporation of p-
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



benzoyl-L-
TGAAAAATCTGCTGGTATAGGTTTTGAACCAAGTGGTAAAA



phenylalanine (p-
TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT



BpaRS(H6))
TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTTCCTTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAGT




TATCTATCCAATAATGCAGGTTAATACGAGTCATTATCTGG




GCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAAT




ACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTTT




GTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGGA




AAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATGA




CTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATAC




TGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAGA




TAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAGG




CCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATGA




GGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCCA




ATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAGA




TTTTAGAGCCAATTAGAAAGAGATTA






ORS for the
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
324


incorporation of p-
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



azido-
TGAAAAATCTGCTACGATAGGTTTTGAACCAAGTGGTAAA



phenylalanine (p-
ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA



Az-PheRS(3))
TTTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTG




ATTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTAATTT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAG




TTATCTATCCAATAATGCAGGTTAATCCGCTTCATTATCAG




GGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTA






ORS for the
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
325


incorporation of p-
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



azido-
TGAAAAATCTGCTACGATAGGTTTTGAACCAAGTGGTAAA



phenylalanine (p-
ATACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGA



Az-PheRS(6))
TTTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTG




ATTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGA




GATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAA




GCAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTCTGTT




CCAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGG




CTTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGA




ACTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAG




TTATCTATCCAATAATGCAGGTTAATCCTCTTCATTATGAG




GGCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAA




TACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTT




TGTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGG




AAAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATG




ACTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATA




CTGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAG




ATAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAG




GCCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATG




AGGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCC




AATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAG




ATTTTAGAGCCAATTAGAAAGAGATTA






ORS for the
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
326


incorporation of p-
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



azido-
TGAAAAATCTGCTCTTATAGGTTTTGAACCAAGTGGTAAAA



phenylalanine (p-
TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT



Az-PheRS(20))
TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTACTTTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAGT




TATCTATCCAATAATGCAGGTTAATCCGGTTCATTATCAGG




GCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAAT




ACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTTT




GTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGGA




AAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATGA




CTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATAC




TGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAGA




TAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAGG




CCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATGA




GGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCCA




ATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAGA




TTTTAGAGCCAATTAGAAAGAGATTA






ORS for the
ATGGACGAATTTGAAATGATAAAGAGAAACACATCTGAAA
327


incorporation of p-
TTATCAGCGAGGAAGAGTTAAGAGAGGTTTTAAAAAAAGA



azido-
TGAAAAATCTGCTACTATAGGTTTTGAACCAAGTGGTAAAA



phenylalanine (p-
TACATTTAGGGCATTATCTCCAAATAAAAAAGATGATTGAT



Az-PheRS(24))
TTACAAAATGCTGGATTTGATATAATTATATTGTTGGCTGA




TTTACACGCCTATTTAAACCAGAAAGGAGAGTTGGATGAG




ATTAGAAAAATAGGAGATTATAACAAAAAAGTTTTTGAAG




CAATGGGGTTAAAGGCAAAATATGTTTATGGAAGTTCGTTC




CAGCTTGATAAGGATTATACACTGAATGTCTATAGATTGGC




TTTAAAAACTACCTTAAAAAGAGCAAGAAGGAGTATGGAA




CTTATAGAAGAGAGGATGAAAATCCAAAGGTTGCTGAAGT




TATCTATCCAATAATGCAGGTTAATCCACTGCATTATCAGG




GCGTTGATGTTGCAGTTGGAGGGATGGAGCAGAGAAAAAT




ACACATGTTAGCAAGGGAGCTTTTACCAAAAAAGGTTGTTT




GTATTCACAACCCTGTCTTAACGGGTTTGGATGGAGAAGGA




AAGATGAGTTCTTCAAAAGGGAATTTTATAGCTGTTGATGA




CTCTCCAGAAGAGATTAGGGCTAAGATAAAGAAAGCATAC




TGCCCAGCTGGAGTTGTTGAAGGAAATCCAATAATGGAGA




TAGCTAAATACTTCCTTGAATATCCTTTAACCATAAAAAGG




CCAGAAAAATTTGGTGGAGATTTGACAGTTAATAGCTATGA




GGAGTTAGAGAGTTTATTTAAAAATAAGGAATTGCATCCA




ATGGATTTAAAAAATGCTGTAGCTGAAGAACTTATAAAGA




TTTTAGAGCCAATTAGAAAGAGATTA






Archaeoglobus
ATGAGCGATTTCAGGATAATTGAGGAGAAGTGGCAGAAGG
328


fulgidus leucyl
CGTGGGAGAAGGACAGAATTTTTGAGTCCGATCCTAATGA



tRNA-synthetase
GAAGGAGAAGTTTTTTCTCACAATTCCCTATCCTTACCTTA



(AFLRS)
ATGGAAATCTTCACGCAGGTCACACGAGAACCTTCACAATT




GGCGATGCCTTCGCCAGATACATGAGAATGAAGGGCTACA




ACGTTCTCTTTCCCCTCGGCTTTCATGTTACGGGCACCCCAA




TCATTGGCCTTGCGGAGCTCATAGCCAAGAGGGACGAGAG




GACGATAGAGGTTTACACCAAATACCATGACGTTCCGCTGG




AGGACTTGCTTCAGCTCACAACTCCAGAGAAAATCGTTGAG




TACTTCTCAAGGGAGGCGCTGCAGGCTTTGAAGAGCATAG




GCTACTCCATTGACTGGAGGAGGGTTTTCACCACAACCGAT




GAAGAGTATCAGAGATTCATCGAGTGGCAGTACTGGAAGC




TCAAGGAGCTTGGCCTGATTGTGAAGGGCACCCACCCCGTC




AGATACTGCCCCCACGACCAGAATCCTGTTGAAGACCACG




ACCTTCTCGCTGGGGAGGAGGCAACTATTGTTGAATTTACC




GTTATAAAGTTCAGGCTTGAAGATGGAGACCTCATTTTCCC




CTGTGCAACTCTCCGTCCCGAAACCGTGTTTGGCGTCACGA




ACATCTGGGTAAAGCCGACAACCTACGTAATTGCCGAGGT




GGATGGGGAAAAGTGGTTTGTGAGCAAAGAGGCTTACGAG




AAGCTCACCTACACGGAGAAAAAAGTCAGGCTGCTGGAGG




AGGTTGATGCGTCGCAGTTCTTCGGCAAGTACGTCATAGTC




CCGCTGGTAAACAGAAAAGTGCCAATTCTGCCTGCAGAGTT




TGTTGACACCGACAACGCAACAGGAGTTGTGATGAGCGTT




CCCGCACACGCTCCTTTTGACCTGGCTGCCATTGAGGACTT




GAAGAGAGACGAGGAAACGCTGGCGAAGTACGGA'ATTGA




CAAAAGCGTTGTAGAGAGCATAAAGCCAATAGTTCTGATT




AAGACGGACATTGAAGGTGTTCCTGCTGAGAAGCTAATAA




GAGAGCTTGGAGTGAAGAGCCAGAAGGACAAGGAGCTGCT




GGATAAGGCAACCAAGACCCTCTACAAGAAGGAGTACCAC




ACGGGAATCATGCTGGACAACACGATGAACTATGCTGGAA




TGAAAGTTTCTGAGGCGAAGGAGAGAGTTCATGAGGATTT




GGTTAAGCTTGGCTTGGGGGATGTTTTCTACGAGTTCAGCG




AGAAGCCCGTAATCTGCAGGTGCGGAACGAAGTGCGTTGT




TAAGGTTGTTAGGGACCAGTGGTTCCTGAACTACTCCAACA




GAGAGTGGAAGGAGAAGGTTCTGAATCACCTTGAAAAGAT




GCGAATCATCCCCGACTACTACAAGGAGGAGTTCAGGAAC




AAGATTGAGTGGCTCAGGGACAAGGCTTGTGCCAGAAGGA




AGGGGCTTGGAACGAGAATTCCGTGGGATAAGGAGTGGCT




CATCGAGAGCCTTTCAGACTCAACAATCTACATGGCCTACT




ACATCCTTGCCAAGTACATCAACGCAGGATTGCTCAAGGCC




GAGAACATGACTCCCGAGTTCCTCGACTACGTGCTGCTGGG




CAAAGGTGAGGTTGGGAAAGTTGCGGAAGCTTCAAAACTC




AGCGTGGAGTTAATCCAGCAGATCAGGGACGACTTCGAGT




ACTGGTATCCCGTTGACCTAAGAAGCAGTGGCAAGGACTT




GGTTGCAAACCACCTGCTCTTCTACCTCTTCCACCACGTCG




CCATTTTCCCGCCAGATAAGTGGCCGAGGGCAATTGCCGTA




AACGGATACGTCAGCCTTGAGGGCAAGAAGATGAGCAAGA




GCAAAGGGCCCTTGCTAACGATGAAGAGGGCGGTGCAGCA




GTATGGTGCGGATGTGACGAGGCTCTACATCCTCCACGCTG




CAGAGTACGACAGCGATGCGGACTGGAAGAGCAGAGAGGT




TGAAGGGCTTGCAAACCACCTCAGGAGGTTCTACAACCTCG




TGAAGGAGAACTACCTGAAAGAGGTGGGAGAGCTAACAAC




CCTCGACCGCTGGCTTGTGAGCAGGATGCAGAGGGCAATA




AAGGAAGTGAGGGAGGCTATGGACAACCTGCAGACGAGG




AGGGCCGTGAATGCCGCCTTCTTCGAGCTCATGAACGACGT




GAGATGGTATCTGAGGAGAGGAGGTGAGAACCTCGCTATA




ATACTGGACGACTGGATCAAGCTCCTCGCCCCCTTTGCTCC




GCACATTTGCGAGGAGCTGTGGCACTTGAAGCATGACAGC




TACGTCAGCCTCGAAAGCTACCCAGAATACGACGAAACCA




GGGTTGACGAGGAGGCGGAGAGAATTGAGGAATACCTCCG




AAACCTTGTTGAGGACATTCAGGAAATCAAGAAGTTTGTTA




GCGATGCGAAGGAGGTTTACATTGCTCCCGCCGAAGACTG




GAAGGTTAAGGCAGCAAAGGTCGTTGCTGAAAGCGGGGAT




GTTGGGGAGGCGATGAAGCAGCTTATGCAGGACGAGGAGC




TTAGGAAGCTCGGCAAAGAAGTGTCAAATTTCGTCAAGAA




GATTTTCAAAGACAGAAAGAAGCTGATGCTAGTTAAGGAG




TGGGAAGTTCTGCAGCAGAACCTGAAATTTATTGAGAATG




AGACCGGACTGAAGGTTATTCTTGATACTCAGAGAGTTCCT




GAGGAGAAGAGGAGGCAGGCAGTTCCGGGCAAGCCCGCG




ATTTATGTTGCTTAA






Methanobacterium
GTGGATATTGAAAGAAAATGGCGTGATAGATGGAGAGATG
329


thermoautotrophicum 
CTGGCATATTTCAGGCTGACCCTGATGACAGAGAAAAGAT



leucyl tRNA-
ATTCCTCACAGTCGCTTACCCCTACCCCAGTGGTGCGATGC



synthetase
ACATAGGACACGGGAGGACCTACACTGTCCCTGATGTCTAT



(MtLRS)
GCACGGTTCAAGAGGATGCAGGGCTACAACGTCCTGTTTCC




CATGGCCTGGCATGTCACAGGGGCCCCTGTCATAGGGATA




GCGCGGAGGATTCAGAGGAAGGATCCCTGGACCCTCAAAA




TCTACAGGGAGGTCCACAGGGTCCCCGAGGATGAGCTTGA




ACGTTTCAGTGACCCTGAGTACATAGTTGAATACTTCAGCA




GGGAATACCGGTCTGTTATGGAGGATATGGGCTACTCCATC




GACTGGAGGCGTGAATTCAAAACCACGGATCCCACCTACA




GCAGGTTCATACAGTGGCAGATAAGGAAGCTGAGGGACCT




TGGCCTCGTAAGGAAGGGCGCCCATCCTGTTAAGTACTGCC




CTGAATGTGAAAACCCTGTGGGTGACCATGACCTCCTTGAG




GGTGAGGGGGTTGCCATAAACCAGCTCACACTCCTCAAATT




CAAACTTGGAGACTCATACCTGGTCGCAGCCACCTTCAGGC




CCGAGACAATCTATGGGGCCACCAACCTCTGGCTGAACCCT




GATGAGGATTATGTGAGGGTTGAAACAGGTGGTGAGGAGT




GGATAATAAGCAGGGCTGCCGTGGATAATCTTTCACACCA




GAAACTGGACCTCAAGGTTTCCGGTGACGTCAACCCCGGG




GACCTGATAGGGATGTGCGTGGAGAATCCTGTGACGGGCC




AGGAACACCCCATACTCCCGGCTTCCTTCGTTGACCCTGAA




TATGCCACAGGTGTTGTGTTCTCTGTCCCTGCACATGCCCCT




GCAGACTTCATAGCCCTTGAGGACCTCAGGACAGACCATG




AACTCCTTGAAAGGTACGGTCTTGAGGATGTGGTTGCTGAT




ATTGAGCCCGTGAATGTCATAGCAGTGGATGGCTACGGTG




AGTTCCCGGCGGCCGAGGTTATAGAGAAATTTGGTGTCAG




AAACCAGGAGGACCCCCGCCTTGAGGATGCCACCGGGGAG




CTATACAAGATCGAGCATGCGAGGGGTGTTATGAGCAGCC




ACATCCCTGTCTATGGTGGTATGAAGGTCTCTGAGGCCCGT




GAGGTCATCGCTGATGAACTGAAGGACCAGGGCCTTGCAG




ATGAGATGTATGAATTCGCTGAGCGACCTGTTATATGCCGC




TGCGGTGGCAGGTGCGTTGTGAGGGTCATGGAGGACCAGT




GGTTCATGAAGTACTCTGATGACGCCTGGAAGGACCTCGCC




CACAGGTGCCTCGATGGCATGAAGATAATACCCGAGGAGG




TCCGGGCCAACTTTGAATACTACATCGACTGGCTCAATGAC




TGGGCATGTTCAAGGAGGATAGGCCTTGGAACAAGGCTGC




CCTGGGATGAGAGGTGGATCATCGAACCCCTCACAGACTC




AACAATCTACATGGCATATTACACCATCGCACACCGCCTCA




GGGAGATGGATGCCGGGGAGATGGACGATGAGTTCTTTGA




TGCCATATTCCTAGATGATTCAGGAACCTTTGAGGATCTCA




GGGAGGAATTCCGGTACTGGTACCCCCTTGACTGGAGGCTC




TCTGCAAAGGACCTCATAGGCAATCACCTGACATTCCATAT




ATTCCACCACTCAGCCATATTCCCTGAGTCAGGGTGGCCCC




GGGGGGCTGTGGTCTTTGGTATGGGCCTTCTTGAGGGCAAC




AAGATGTCATCCTCCAAGGGCAACGTCATACTCCTGAGGG




ATGCCATCGAGAAGCACGGTGCAGACGTGGTGCGGCTCTT




CCTCATGTCCTCAGCAGAGCCATGGCAGGACTTTGACTGGA




GGGAGAGTGAGGTCATCGGGACCCGCAGGAGGATTGAATG




GTTCAGGGAATTCGGAGAGAGGGTCTCAGGTATCCTGGAT




GGTAGGCCAGTCCTCAGTGAGGTTACTCCAGCTGAACCTGA




AAGCTTCATTGGAAGGTGGATGATGGGTCAGCTGAACCAG




AGGATACGTGAAGCCACAAGGGCCCTTGAATCATTCCAGA




CAAGAAAGGCAGTTCAGGAGGCACTCTATCTCCTTAAAAA




GGATGTTGACCACTACCTTAAGCGTGTTGAGGGTAGAGTTG




ATGATGAGGTTAAATCTGTCCTTGCAAACGTTCTGCACGCC




TGGATAAGGCTCATGGCTCCATTCATACCCTACACTGCTGA




GGAGATGTGGGAGAGGTATGGTGGTGAGGGTTTTGTAGCA




GAAGCTCCATGGCCTGACTTCTCAGATGATGCAGAGAGCA




GGGATGTGCAGGTTGCAGAGGAGATGGTCCAGAATACCGT




TAGAGACATTCAGGAAATCATGAAGATCCTTGGATCCACCC




CGGAGAGGGTCCACATATACACCTCACCAAAATGGAAATG




GGATGTGCTAAGGGTCGCAGCAGAGGTAGGAAAACTAGAT




ATGGGCTCCATAATGGGAAGGGTTTCAGCTGAGGGCATCC




ATGATAACATGAAGGAGGTTGCTGAATTTGTAAGGAGGAT




CATCAGGGACCTTGGTAAATCAGAGGTTACGGTGATAGAC




GAGTACAGCGTACTCATGGATGCATCTGATTACATTGAATC




AGAGGTTGGAGCCAGGGTTGTGATACACAGCAAACCAGAC




TATGACCCTGAAAACAAGGCTGTGAATGCCGTTCCCCTGAA




GCCAGCCATATACCTTGAATGA






mutant TyrRS
MDEFEMIKRNTSEIISEEELREVLKKDEKSAQIGFEPSGKIHLG
330


(LWJ16)
HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY




NKKVFEAMGLKAKYVYGSTFQLDKDYTLNVYRLALKTTLKR




ARRSMELIAREDENPKVAEVIYPIMQVNAIHYPGVDVAVGGM




EQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVSSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






TyrRS(SS12)
MDEFEMIKRNTSEIISEEELREVLKKDEKSALIGFEPSGKIHLGH
331



YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN




KKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRA




RRSMELIAREDENPKVAEVIYPIMQVNPAHYQGVDVVVGGM




EQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTI






p-iPr-PheRS
MDEFEMIKRNTSEIISEEELREVLKKDEKSAGIGFEPSGKIHLG
332



HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY




NKKVFEAMGLKAKCAYGSPFQLDKDYTLNVYRLALKTTLKR




ARRSMELIAREDENPKVAEVIYPIMQVNGYHYLGVDVAVGG




MEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNF




IAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIK




RPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKIL




EPIRKRL






p-NH2-PheRS(1)
MDEFEMIKRNTSEIISEEELREVLKKDEKSAQIGFEPSGKIHLG
333



HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY




NKKVFEAMGLKAKYVYGSPFQLDKDYTLNVYRLALKTTLKR




ARRSMELIAREDENPKVAEVIYPIMQVNCSHYYGVDVAVGG




MEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNF




IAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIK




RPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKIL




EPIRKRL






p-NH2-PheRS(2)
MDEFEMIKRNTSEIISEEELREVLKKDEKSATIGFEPSGKIHLGH
334



YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN




KKVFEAMGLKAKYVYGSTFQLDKDYTLNVYRLALKTTLKRA




RRSMELIAREDENPKVAEVIYPIMQVNPLHYAGVDVAVGGME




QRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






p-NH2-PheRS(3a)
MDEFEMIKRNTSEIISEEELREVLKKDEKSAHIGFEPSGKIHLG
335



HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY




NKKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKR




ARRSMELIAREDENPKVAEVIYPIMQVNRPHYLGVDVAVGG




MEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNF




IAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIK




RPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKIL




EPIRKRL






p-NH2-PheRS(3b)
MDEFEMIKRNTSEIISEEELREVLKKDEKSAQIGFEPSGKIHLG
336



HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY




NKKVFEAMGLKAKYVYGSPFQLDKDYTLNVYRLALKTTLKR




ARRSMELIAREDENPKVAEVIYPIMQVNQSHYDGVDVAVGG




MEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNF




IAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIK




RPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKIL




EPIRKRL






O-Allyl-TyrRS(1)
MDEFEMIKRNTSEIISEEELREVLKKDEKSASIGFEPSGKIHLGH
337



YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN




KKVFEAMGLKAKYVYGSTFQLDKDYTLNVYRLALKTTLKRA




RRSMELIAREDENPKVAEVIYPIMQVNTYHYAGVDVAVGGM




EQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






O-Allyl-TyrRS(3)
MDEFEMIKRNTSEIISEEELREVLKKDEKSAPIGFEPSGKIHLGH
338



YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN




KKVFEAMGLKAKYVYGSMFQLDKDYTLNVYRLALKTTLKR




ARRSMELIAREDENPKVAEVIYPIMQVNNTHYGGVDVAVGG




MEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNF




IAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIK




RPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKIL




EPIRKRL



O-Allyl-TyrRS(4)
MDEFEMIKRNTSEIISEEELREVLKKDEKSATIGFEPSGKIHLGH
339



YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN




KKVFEAMGLKAKYVYGSHFQLDKDYTLNVYRLALKTTLKRA




RRSMELIAREDENPKVAEVIYPIMQVNQTHYEGVDVAVGGM




EQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






p-Br-PheRS
MDEFEMIKRNTSEIISEEELREVLKKDEKSAHIGFEPSGKIHLG
340



HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY




NKKVFEAMGLKAKYVYGSKFQLDKDYTLNVYRLALKTTLKR




ARRSMELIAREDENPKVAEVIYPIMQVNPCHYHGVDVAVGG




MEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNF




IAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIK




RPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKIL




EPIRKRL






p-Az-PheRS(1)
MDEFEMIKRNTSEIISEEELREVLKKDEKSAAIGFEPSGKIHLG
341



HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY




NKKVFEAMGLKAKYVYGSRFQLDKDYTLNVYRLALKTTLKR




ARRSMELIAREDENPKVAEVIYPIMQVNVYHYDGVDVAVGG




MEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNF




IAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIK




RPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKIL




EPIRKRL






p-Az-PheRS(3)
MDEFEMIKRNTSEIISEEELREVLKKDEKSAGIGFEPSGKIHLG
342



HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY




NKKVFEAMGLKAKYVYGSTFQLDKDYTLNVYRLALKTTLKR




ARRSMELIAREDENPKVAEVIYPIMQVNTYYYLGVDVAVGG




MEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNF




IAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIK




RPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKIL




EPIRKRL






p-Az-PheRS(5)
MDEFEMIKRNTSEIISEEELREVLKKDEKSALIGFEPSGKIHLGH
343



YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN




KKVFEAMGLKAKYVYGSPFQLDKDYTLNVYRLALKTTLKRA




RRSMELIAREDENPKVAEVIYPIMQVNQIHSSGVDVAVGGME




QRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






mutant ORS to
MDEFEMIKRNTSEIISEEELREVLKKDEKSADIGFEPSGKIHLG
344


incorporate m-acyl
HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY



phenylalanine into
NKKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKR



proteins (ketone 3-
ARRSMELIAREDENPKVAEVIYPIMQVNGMHYQGVDVAVGG



4)
MEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNF




IAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIK




RPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKIL




EPIRKRL






mutant ORS to
MDEFEMIKRNTSEIISEEELREVLKKDEKSAYIGFEPSGKIHLG
345


incorporate m-acyl
HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY



phenylalanine into
NKKVFEAMGLKAKYVYGSLFQLDKDYTLNVYRLALKTTLKR



proteins (ketone 3-
ARRSMELIAREDENPKVAEVIYPIMQVNDIHYTGVDVAVGGM



7)
EQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






mutant ORS to
MDEFEMIKRNTSEIISEEELREVLKKDEKSALIGFEPSGKIHLGH
346


incorporate m-acyl
YLQIKKMIDLQNAGFDIIILLTDLNAYLNQKGELDEIRKIGDYN



phenylalanine into
KKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRA



proteins (ketone 4-
RRSMELIAREDENPKVAEVIYPIMQVNDIHYLGVDVAVGGME



1)
QRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






mutant ORS to
MDEFEMIKRNTSEIISEEELREVLKKDEKSALIGFEPSGKIHLGH
347


incorporate m-acyl
YLQIKKMIDLQNAGFDIIILLTDLKAYLNQKGELDEIRKIGDYN



phenylalanine into
KKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRA



proteins (ketone 5-
RRSMELIAREDENPKVAEVIYPIMSVNVIHYLGVDVVVGGME



4)
QRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL
348





mutant ORS to
MDEFEMIKRNTSEIISEEELREVLKKDEKSALIGFEPSGKIHLGH



incorporate m-acyl
YLQIKKMIDLQNAGFDIIILLPDLSAYLNQKGELDEIRKIGDYN



phenylalanine into
KKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRA



proteins (ketone 6-
RRSMELIAREDENPKVAEVIYPIMQVNDIHYLGVDVAVGGME



8)
QRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






mutant ORS to
MDEFEMIKRNTSEIISEEELREVLKKDEKSATIGFEPSGKIHLGH
349


incorporate m-
YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN



methoxy
KKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRA



phenylalanine into
RRSMELIAREDENPKVAEVIYPIMQVNDIHYAGVDVAVGGME



proteins (OMe 1-
QRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA



6)
VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






mutant ORS to
MDEFEMIKRNTSEIISEEELREVLKKDEKSATIGFEPSGKIHLGH
350


incorporate m-
YLQIKKMIDLQNAGFDIIILLSDLPAYLNQKGELDEIRKIGDYN



methoxy
KKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKRA



phenylalanine into
RRSMELIAREDENPKVAEVIYPIMQVNDIHYLGVDVAVGGME



proteins (OMe 1-
QRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA



8)
VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






mutant ORS to
MDEFEMIKRNTSEIISEEELREVLKKDEKSATIGFEPSGKIHLGH
351


incorporate m-
YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN



methoxy
KKVFEAMGLKAKYVYGSMFQLDKDYTLNVYRLALKTTLKR



phenylalanine into
ARRSMELIAREDENPKVAEVIYPIMQVNSSHYDGVDVAVGG



proteins (OMe 2-
MEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNF



7)
IAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIK




RPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKIL




EPIRKRL






mutant ORS to
MDEFEMIKRNTSEIISEEELREVLKKDEKSAQIGFEPSGKIHLG
352


incorporate m-
HYLQIKKMIDLQNAGFDIIILLPDLHAYLNQKGELDEIRKIGDY



methoxy
NKKVFEAMGLKAKYVYGSEFQLDKDYTLNVYRLALKTTLKR



phenylalanine into
ARRSMELIAREDENPKVAEVIYPIMQVNDIHYLGVDVDVGGM



proteins (OMe 4-
EQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA



1)
VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






mutant ORS to
MDEFEMIKRNTSEIISEEELREVLKKDEKSAHIGFEPSGKIHLG
353


incorporate m-
HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY



methoxy
NKKVFEAMGLKAKYVYGSAFQLDKDYTLNVYRLALKTTLKR



phenylalanine into
ARRSMELIAREDENPKVAEVIYPIMQVNGHHYIGVDVAVGGM



proteins (OMe 4-
EQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA



8)
VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






mutant ORS to
MDEFEMIKRNTSEIISEEELREVLKKDEKSAYIGFEPSGKIHLG
354


incorporate p-O-
HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY



allyl tyrosine into
NKKVFEAMGLKAKYVYGSAFQLDKDYTLNVYRLALKTTLKR



proteins
ARRSMELIAREDENPKVAEVIYPIMQVNCAHYLGVDVAVGG




MEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNF




IAVDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIK




RPEKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKIL




EPIRKRL






ORS for the
MDEFEMIKRNTSEIISEEELREVLKKDEKSAGIGFEPSGKIHLG
355


incorporation of p-
HYLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDY



benzoyl-L-
NKKVFEAMGLKAKYVYGSSFQLDKDYTLNVYRLALKTTLKR



phenylalanine (p-
ARRSMELIAREDENPKVAEVIYPIMQVNTSHYLGVDVAVGGM



BpaRS(H6))
EQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






ORS for the
MDEFEMIKRNTSEIISEEELREVLKKDEKSATIGFEPSGKIHLGH
356


incorporation of p-
YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN



azido-
KKVFEAMGLKAKYVYGSNFQLDKDYTLNVYRLALKTTLKRA



phenylalanine p-
RRSMELIAREDENPKVAEVIYPIMQVNPLHYQGVDVAVGGME



Az-PheRS(3)
QRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






ORS for the
MDEFEMIKRNTSEIISEEELREVLKKDEKSATIGFEPSGKIHLGH
357


incorporation of p-
YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN



azido-
KKVFEAMGLKAKYVYGSSFQLDKDYTLNVYRLALKTTLKRA



phenylalanine p-
RRSMELIAREDENPKVAEVIYPIMQVNPLHYQGVDVAVGGME



Az-PheRS(6)
QRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






ORS for the
MDEFEMIKRNTSEIISEEELREVLKKDEKSALIGFEPSGKIHLGH
358


incorporation of p-
YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN



azido-
KKVFEAMGLKAKYVYGSTFQLDKDYTLNVYRLALKTTLKRA



phenylalanine p-
RRSMELIAREDENPKVAEVIYPIMQVNPVHYQGVDVAVGGM



Az-PheRS(20)
EQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






ORS for the
MDEFEMIKRNTSEIISEEELREVLKKDEKSATIGFEPSGKIHLGH
359


incorporation of p-
YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYN



azido-
KKVFEAMGLKAKYVYGSSFQLDKDYTLNVYRLALKTTLKRA



phenylalanine p-
RRSMELIAREDENPKVAEVIYPIMQVNPSHYQGVDVAVGGME



Az-PheRS(24)
QRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIA




VDDSPEEIRAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRP




EKFGGDLTVNSYEELESLFKNKELHPMDLKNAVAEELIKILEPI




RKRL






Archaeoglobus
MSDFRIIEEKWQKAWEKDRIFESDPNEKEKFFLTIPYPYLNGN
360


fulgidus leucyl
LHAGHTRTFTIGDAFARYMRMKGYNVLFPLGFHVTGTPIIGLA



tRNA-synthetase
ELIAKRDERTIEVYTKYHDVPLEDLLQLTTPEKIVEYFSREALQ



(AFLRS)
ALKSIGYSIDWRRVFTTTDEEYQRFIEWQYWKLKELGLIVKGT




HPVRYCPHDQNPVEDHDLLAGEEATIVEFTVIKFRLEDGDLIFP




CATLRPETVFGVTNIWVKPTTYVIAEVDGEKWFVSKEAYEKL




TYTEKKVRLLEEVDASQFFGKYVIVPLVNRKVPILPAEFVDTD




NATGVVMSVPAHAPFDLAAIEDLKRDEETLAKYGIDKSVVESI




KPIVLIKTDIEGVPAEKLIRELGVKSQKDKELLDKATKTLYKK




EYHTGIMLDNTMNYAGMKVSEAKERVHEDLVKLGLGDVFY




EFSEKPVICRCGTKCVVKVVRDQWFLNYSNREWKEKVLNHL




EKMRIIPDYYKEEFRNKIEWLRDKACARRKGLGTRIPWDKEW




LIESLSDSTIYMAYYILAKYINAGLLKAENMTPEFLDYVLLGK




GEVGKVAEASKLSVELIQQIRDDFEYWYPVDLRSSGKDLVAN




HLLFYLFHHVAIFPPDKWPRAIAVNGYVSLEGKKMSKSKGPL




LTMKRAVQQYGADVTRLYILHAAEYDSDADWKSREVEGLA




NHLRRFYNLVKENYLKEVGELTTLDRWLVSRMQRAIKEVRE




AMDNLQTRRAVNAAFFELMNDVRWYLRRGGENLAIILDDWI




KLLAPFAPHICEELWHLKHDSYVSLESYPEYDETRVDEEAERI




EEYLRNLVEDIQEIKKFVSDAKEVYIAPAEDWKVKAAKVVAE




SGDVGEAMKQLMQDEELRKLGKEVSNFVKKIFKDRKKLMLV




KEWEVLQQNLKFIENETGLKVILDTQRVPEEKRRQAVPGKPAI




YVA






Methanobacterium
VDTERKWRDRWRDAGIFQADPDDREKIFLTVAYPYPSGAMHI
361


thermoautotrophicum
GHGRTYTVPDVYARFKRMQGYNVLFPMAWHVTGAPVIGIAR



leucyl tRNA-
RIQRKDPWTLKIYREVHRVPEDELERFSDPEYIVEYFSREYRSV



synthetase
MEDMGYSIDWRREFKTTDPTYSRFIQWQIRRLRDLGLVRKGA



(MtLRS)
HPVKYCPECENPVGDHDLLEGEGVAINQLTLLKFKLGDSYLV




AATFRPETIYGATNLWLNPDEDYVRVETGGEEWIISRAAVDN




LSHQKLDLKVSGDVNPGDLIGMCVENPVTGQEHPILPASFVDP




EYATGVVFSVPAHAPADFIALEDLRTDHELLERYGLEDVVADI




EPVNVIAVDGYGEFPAAEVIEKFGVRNQEDPRLEDATGELYKI




EHARGVMSSHIPVYGGMKVSEAREVIADELKDQGLADEMYE




FAERPVICRCGGRCVVRVMEDQWFMKYSDDAWKDLAHRCL




DGMKIIPEEVRANFEYYIDWLNDWACSRRIGLGTRLPWDERW




IIEPLTDSTIYMAYYTIAHRLREMDAGEMDDEFFDAIFLDDSGT




FEDLREEFRYWYPLDWRLSAKDLIGNHLTFHIFHHSAIFPESG




WPRGAVVFGMGLLEGNKMSSSKGNVILLRDAIEKHGADVVR




LFLMSSAEPWQDFDWRESEVIGTRRRIEWFREFGERVSGILDG




RPVLSEVTPAEPESFIGRWNMGQLNQRIREATRALESFQTRKA




VQEALYLLKKDVDHYLKRVEGRVDDEVKSVLANVLHAWIRL




MAPFIPYTAEEMNERYGGEGFVAEAPWPDFSDDAESRDVQV




AEEMVQNTVRDIQEIMKILGSTPERVHIYTSPKWRWDVLRVA




AEVGKLDMGSIMGRVSAEGIHDNMKEVAEFVRRIIRDLGRSE




VTVIDEYSVLMDASDYIESEVGARVVIHSKPDYDPENKAVNA




VPLKPAIYLE









Example 3: High-throughput Incorporation of Unnatural Amino Acids in Living Cells

The ability to study cellular systems and the mechanisms that drive disease-relevant and fundamental biological processes relies on a suite of chemical and genetic perturbagens to interrogate these complex systems in situ using experimental paradigms as close to the native state as possible. Several tools have been designed to modulate biological systems at the different layers of function and information flow; namely, the DNA, epigenome, RNA, and protein levels. Accurate alteration and control of each of these layers of biological function has provided valuable insights, and has led to the identification of new ways to modulate disease as well as novel therapeutic protein targets for small molecules. Despite these advances, there are remarkably few programmable tools that can be applied towards unbiased high-throughput interrogation of the proteome in living cells. Currently available paradigms are used to study individual proteins, or at best small collections of proteins. Medium-throughput screening modalities have been engineered for specific families of proteins, for example in activity-based protein profiling (ABPP), but these tools are limited to proteins whose enzymatic activity can be readily harnessed using a reactive biochemical handle. The examples provided herein illustrate a high-throughput system for the incorporation of functionalized unnatural amino acid for proteome-wide interrogation and profiling in living cells, which has significantly enhanced generality compared to current state-of-the-art methods (FIGS. 1 and 2).


Unnatural amino acid incorporation in living cells has been an established research tool for over a decade. David Liu and Peter Schultz (Scripps Research Institute) developed the methodology to incorporate novel chemical matter, functional groups, and bio-orthogonal chemical handles into full-length proteins8. Novel handles are incorporated using read-through of stop codons, which are pre-emptively introduced into the coding frame of a protein gene, for example9. A complementary tRNA that recognizes the novel stop codon sequence in the mRNA can be used to rescue, or suppress, the formation of truncated proteins (FIG. 1). The rescuing tRNA can be charged with a variety of natural and unnatural amino acids using evolved amino acyl-tRNA synthetases that lead to the introduction of new chemical handles into the protein of interest (FIG. 1). Stop codon suppression has been achieved using vast assortment of chemical handles, like azide and alkyne tags10, fluorescent markers, and covalent bond forming adducts, etc.11,12 (FIG. 3). The limitation of this approach is that stop codons must be introduced into each gene of interest, usually in a conservative and structurally benign site, and likewise each individual protein must be altered in a new cell line13. This approach requires laborious researcher intervention, which has hitherto prohibited high-throughput screening campaigns using this technology. Recent work has produced a CRISPR/Cas9 reagent, called Base Editor 3 (BE3), as well as variants BE2 and BE1, that convert cytosine (C) to thymidine (T) in DNA by catalyzing a cytosine-deamination reaction to uridine (U) in a genomic DNA location programmed by a guide-RNA sequence14. The mutational repertoire of BE3 includes the transformation of 5 codons for glutamine, arginine, and tryptophan into the 3 stop codons (Table 4). The possible target codons include 5 out of 61 amino acid-encoding codons (>8%), making it likely that a protein can be mutated to contain a stop codon using base editing. Polar amino acids, like arginine and glutamine, are statistically enriched in surface-exposed regions of proteins, and tryptophan is statistically overrepresented in protein-protein interactions regions (hot-spots). These characteristics render these 5 codons particularly useful for replacement with unnatural functionalized amino acids to introduce bio-orthogonal handles on the surface of any protein of interest, or in an unbiased high-throughput programmable manner.


Several example applications enabled by the use of base-editing reagents (e.g. BE3) to introduce stop codons into protein coding sequences and incorporate novel chemical functionalities in a high-throughput and programmable manner are described. This platform can enable a number of unbiased large-scale research applications to study proteins in the native cellular context (FIGS. 1 and 2). Moreover, the orthogonal suppression of more than one stop codon within one cell to orchestrate multiple unnatural amino acid incorporations into a variety of protein targets is described.









TABLE 4







Stop-codon suppression using high-throughput programmable


base-editing tools















Stop


Target
Amino acid

Edited
codon


codon
(abbreviation)
Base-editing outcome(s)
codon
name





CAG
Glutamine (Gln/Q)
1st base C custom character  T coding
TAG
Amber




strand




TGG
Tryptophan
2nd base C custom character  T on
TAG
Amber



(Trp/W)
complementary strand




CGA
Arginine (Arg/R)
1st base C custom character  T coding
TGA
Opal




strand




CAA
Glutamine (Gln/Q)
1st base C custom character  T coding
TAA
Ochre




strand




TGG
Tryptophan
3rd base C custom character  T on
UGA
Opal



(Trp/W)
complementary strand




CGG
Arginine (Arg/R)
1st base C custom character  T on coding
TAG
Amber




strand and 2nd base Ccustom character  T






on complementary strand




CGA
Arginine (Arg/R)
1st base C custom character  T on coding
TAA
Ochre




strand and 2nd base Ccustom character  T






on complementary strand










Application 1. Incorporation of unnatural amino acids with reactive side-chain handles in a guide-RNA sequence-specific manner into protein-coding genes in living cells to conduct high-throughput protein degradation screening by recruitment of ubiquitin-ligase enzymes


The ability to study protein degradation in a high-throughput and quantifiable manner has been difficult to execute to date. This platform is important to study because genetic perturbation of all proteins using either CRISPR/Cas9 or siRNA may be both toxic to cells when essential genes are modified and because the effects of a small molecule will not be recapitulated due to the long-lasting nature of the modification. Current technologies to degrade proteins are limited in their throughput. First, proteins of interest can be targeted for degradation if a small molecule ligand exists that binds to the target17,18. This approach relies on ligand discovery, which can be time intensive and is inherently limited in throughput. An alternative strategy leads to protein degradation by tagging the target of interest with degradation-inducing tags. Such systems, like the auxin degradation system19, could be generated using a number of different protein tags; however, these approaches are limited by introducing such a tag onto the protein of interest. Protein tagging is therefore limited in its throughput and generality because protein tagging may alter the native function of the protein.


It is believed that BE3 can be used to introduce stop codons that can be suppressed to introduce azide or alkyne handles into protein-coding regions in cells. BE3 can change C to T in DNA and thus can change native amino acids to stop codons. Stop codon suppression has been demonstrated for amber (UAG), ochre (UAA), and opal (UGA) stop codons. It is envisioned that glutamines (CAG) can be converted into an amber stop UAG in one step using BE3. All possible transformations to stop codons are highlighted in FIG. 8B. This amounts to a total of 5/61 (>8%) when native stop codons are excluded. If four letter codes are included, the total targetable space in the proteome increases dramatically. Notably, the targeted amino acids are often polar and therefore are often surface exposed. This improves the likelihood that the introduced novel amino acid will be readily accessible to reagents of our choosing. Furthermore, there is often more than one amino acid (e.g. multiple glutamine or arginine residues) that can be targeted in each protein, which improves the targetable scope of these experiments. Consequently, using this system to introduce azide handles into all proteins in a cell could be carried out. Integration of chemical handles into multiple proteins or multiple tags within one protein at a time will be desirable and is possible with complimentary suppressor systems.


Azide handles can be used for a number of chemical transformations; however, one preeminent use would be to conduct a proteome-wide degradation screen. By generating an alkyne-tagged ImID (FIG. 4), like thalidomide, each protein in a cell could be directed to the proteasome via cereblon (CRBN) dependent ubiquitination20,21. Such a screen could be employed to study proteins where genetic perturbation leads to lethality to a cell, like essential genes, and can also be used to evaluate components of a complex where genetic knockout of important components leads to malfunctions and failures of the complex to assemble. This process can be used to identify drug targets in a high throughput and multiplex-able way. Multiple proteins can be degraded at once or complimentary activities can be encoded using this system where one protein is degraded while another is modified in another manner.


Identification of Unknown Targets of Bioactive Small Molecules Using Binding-Based Protein Profiling and Introduction of Photo-Crosslinking Unnatural Amino Acids to Generate Protein-Protein Interactome Maps


In addition to alkyne and azide handles, we believe that aziridine handles could be used to track protein complex formation. These amino acids bind adjacent protein surfaces together in a covalent manner. Thus, integration of such tags into proteins could help discern direct protein contacts made between each protein in a cell. Scanning using multiple target sites per protein will be necessary to generate full coverage of the interactome. It is believed that these tools could be integrated with small molecule screening platforms, RNAi screens, or CRIPSR gene knockout screening to identify small molecules that can perturb protein-protein interactions. Furthermore, using bulky residues that prevent protein binding can be used to identify interactions that drive biological phenomena. Notably, if orthogonal suppressor sets could be used, protein-protein interactions could be forced to test novel hypotheses about cellular function.


High-Throughput Phenotypic Screening in Living Cells by Perturbing Protein Sub-Cellular Localization in a Guide-RNA Sequence-Specific Manner, Coupling to Chemical Probes that Localize to the Nucleus, Mitochondria, and the Plasma Membrane and Modulation of Protein Function and/or Colocalization by Induction by Induction of a Covalent-Linkage Between Protein Partners Using a Halo-Tag, SNAP-Tag, CLIP-Tag Reagent15


The introduction of azide or alkyne tags into coding regions of proteins affords the opportunity to append novel signaling moieties to individual proteins of interest. Localization signals can be attached to any and all proteins in a consistent manner to study the effects of localization on the entire proteome. Three primary tags can be appended to proteins; namely, nuclear, membrane, and mitochondrial localization signals (FIGS. 5 and 6). Furthermore, it is believed that a variety of ligands can be appended to proteins of interest to study the effects of such modifications. For example, various lipids can be appended to proteins to alter their membrane-associated behaviors (e.g. myristolation, prenylation) (FIG. 5). This approach can be used to test all post-translational modifications in a programmable manner like phosphorylation, ubiquitination, acetylation, methylation, etc. It is also thought that the appendage of various metabolites to proteins of interest could be used to recruit various proteins and modifying enzymes to a target protein. This set of experiments could be tested using cellular components with programmable interactions like the SNAP-tag, Halo-tag, Rapamycin, and FK-506. It is also thought that these handles can be used for in-cell tracer experiments in a high throughput manner and that dual modulation using each of the three suppressor sets within one cell should allow simultaneous tracing of three cellular components in a programmable manner.


Orthogonal Incorporation of Multiple Unnatural Amino Acids Using Multiple Guide-RNAs for Each of the Stop Codons


It is also believed that the ability to introduce orthogonal sets of suppressors (FIGS. 2 and 8) could be transformative. This capability could allow researchers to study the interactions of complex protein networks simultaneously in a living cell. Multiple complementary tracer molecules could be used to label multiple proteins in the same cell. This could also be used to simultaneously endow multiple proteins with different chemical functionalities. Protein-protein interactions could be altered while subcellular localization is changed for another target all while a third is being degraded.


In summary, it is believed that utilizing BE3 and guide-RNA libraries to introduce unnatural amino acids into the proteome of living cells holds significant promise as a platform for generating and testing biological hypotheses, and to aid in research and development of future therapeutics. The unbiased introduction of bio-orthogonal handles coupled with the DNA-sequencing readout of guide-RNAs is a highly desirable technology. The present disclosure enables unbiased high-throughput omic-type interrogation techniques previously applicable only at the genomic and transcriptomic levels to be performed with equal ease at the proteomic level.


Example 4. Incorporation of Unnatural Amino Acids into BRD4 or PRSS2 Proteins

For illustration purpose only, the present disclosure further provides examples of unnatural amino acids incorporation into two proteins that are expressed in HEK293T cells, BRD4 and PRSS2. PRSS2 is a serine protease and BRD4 is a histone actyl lysine reader protein that is involved in regulating gene expression. These two proteins were selected for their diversity of subcellular localization and the number of reagents that can be used to assay their activity after the incorporation of unnatural amino acids.


Glutamine codons (CAG) in BRD4 (Q123, Q175, Q1323/Q1324, and Q1333) or PRSS2 (Q100, Q211, and Q236) are targeted to be converted to amber codons (TAG), because they are highly charged and likely to be surface exposed. The nucleobase editor used for the condon conversion is the rAPOBEC1-XTEN-Cas9 nickase-UGI-NLS fusion protein (designated BE3, SEQ ID NO: 295). Four gRNA sequences were designed for converting glutamine codons to amber codons in BRD4: GAATGCTCAGGAATGTATCC (targeting Q123, SEQ ID NO: 367), gATAGTCCAGGCAAAAGGAAG (targeting Q175, SEQ ID NO:368), ACCAGCAGAGGGAGTTGGCC (targeting Q1323/Q1324, SEQ ID NO: 369), and GGGAGCAGGAGCGAAGACGC (targeting Q1333, SEQ ID NO: 370). Three gRNA sequences were designed for converting glutamine codons to amber codons in PSSR2: GAATGAACAGTTCATCAATG (targeting Q100, SEQ ID NO: 371), gTCCTGCCAGGGTGATTCTGG (targeting Q211, SEQ ID NO: 372), and gTGTGCCCAGAAGAACAGGCC (targeting Q236, SEQ ID NO: 373).


Cells are plated at 30,000 cells/well in a 48 well dish and transiently transfected with 750 ng of the BE3 construct and 250 ng of each guide using lipofectamine. Three days after the initial transfection, 1 μg of the pAcBac2.tR4-OMeYRS/GFP* plasmid is used. This plasmid contains the E. coli Tyr ORS system and has two copies of the Tyr CUA tRNA as well as eGFP for a transfection and integration control to be used as a validation, where GFP can be pulled down using the click handle in subsequent experiments. See, Xiao et al., Angewandte Chemie, Volume 52, Issue 52, Pages 14080-14083, 2013, the entire contents of which is incorporated herein by reference.


Twenty-four hours after transfection, media is replaced with media containing the unnatural amino acid 4-h-azido-Phe-OH. Cells are allowed to grow in this media for 24 hours to allow the unnatural amino acids to be incorporated. The media is then supplemented with Cyclo-octyne PEG biotin for the attaching of biotin to the protein via the click chemistry handle in the unnatural amino acids. Cells are lysed and incubated for 6 hours at 4° C. with additional cyclo-octyne peg biotin to run the click reaction. Western Blot analysis using anti PRSS2 (Abcam) or anti BRD4 antibody (Bethyl) are used to visualize each band on the 680 channel while streptavidin dye was visualized on the 800 channel. Colocalization of the 680 bands and 800 bands for biotin attached via the click reaction biotin and the protein of interest are expected. High throughput sequencing can be used to evaluate the conversion rate of each base as described in Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage, Nature, 533(7603):420-4, 2016, the entire contensts are incorporated herein by reference.


Subsequently, PRSS2 activity is assayed using FP-Biotin reagents in an activity based protein profiling (ABPP) type experiment. See, Liu et al., PNAS, vol. 96 no. 26, 14694-14699, 1999; Kidd et al., Biochemistry, 40(13):4005-15, 2001; Bachovchin et al., PNAS, vol. 107 no. 49, 20941-20946, 2010; and Bachovchin et al., Nat Chem Biol., 10(8):656-63, 2014, the entire contents of each of which are incorporated herein by reference.


BRD4 activity is assayed using JQ1, a BET bromodomain probe compound, in a number of robust biochemical and cellular assays as described in Filippakopoulos et al., Nature, 468(7327):1067-73, 2010; Andres et al., Nature Biotechnology, 32, 92-96, 2014; Roberts et al., Curr Protoc Chem Biol., 7(4):263-78, 2015, the entire contents of each of which are incorporated herein by reference.










BRD4 Nucleotide Sequence 



(SEQ ID NO: 374)



ATGTCTGCGGAGAGCGGCCCTGGGACGAGATTGAGAAATCTGCCAGTAATGGGGG






ATGGACTAGAAACTTCCCAAATGTCTACAACACAGGCCCAGGCCCAACCCCAGCC





AGCCAACGCAGCCAGCACCAACCCCCCGCCCCCAGAGACCTCCAACCCTAACAAG





CCCAAGAGGCAGACCAACCAACTGCAATACCTGCTCAGAGTGGTGCTCAAGACAC





TATGGAAACACCAGTTTGCATGGCCTTTCCAGCAGCCTGTGGATGCCGTCAAGCTG





AACCTCCCTGATTACTATAAGATCATTAAAACGCCTATGGATATGGGAACAATAA





AGAAGCGCTTGGAAAACAACTATTACTGGAATGCTCAGGAATGTATCCAGGACTT





CAACACTATGTTTACAAATTGTTACATCTACAACAAGCCTGGAGATGACATAGTCT





TAATGGCAGAAGCTCTGGAAAAGCTCTTCTTGCAAAAAATAAATGAGCTACCCAC





AGAAGAAACCGAGATCATGATAGTCCAGGCAAAAGGAAGAGGACGTGGGAGGAA





AGAAACAGGGACAGCAAAACCTGGCGTTTCCACGGTACCAAACACAACTCAAGCA





TCGACTCCTCCGCAGACCCAGACCCCTCAGCCGAATCCTCCTCCTGTGCAGGCCAC





GCCTCACCCCTTCCCTGCCGTCACCCCGGACCTCATCGTCCAGACCCCTGTCATGA





CAGTGGTGCCTCCCCAGCCACTGCAGACGCCCCCGCCAGTGCCCCCCCAGCCACA





ACCCCCACCCGCTCCAGCTCCCCAGCCCGTACAGAGCCACCCACCCATCATCGCGG





CCACCCCACAGCCTGTGAAGACAAAGAAGGGAGTGAAGAGGAAAGCAGACACCA





CCACCCCCACCACCATTGACCCCATTCACGAGCCACCCTCGCTGCCCCCGGAGCCC





AAGACCACCAAGCTGGGCCAGCGGCGGGAGAGCAGCCGGCCTGTGAAACCTCCA





AAGAAGGACGTGCCCGACTCTCAGCAGCACCCAGCACCAGAGAAGAGCAGCAAG





GTCTCGGAGCAGCTCAAGTGCTGCAGCGGCATCCTCAAGGAGATGTTTGCCAAGA





AGCACGCCGCCTACGCCTGGCCCTTCTACAAGCCTGTGGACGTGGAGGCACTGGG





CCTACACGACTACTGTGACATCATCAAGCACCCCATGGACATGAGCACAATCAAG





TCTAAACTGGAGGCCCGTGAGTACCGTGATGCTCAGGAGTTTGGTGCTGACGTCCG





ATTGATGTTCTCCAACTGCTATAAGTACAACCCTCCTGACCATGAGGTGGTGGCCA





TGGCCCGCAAGCTCCAGGATGTGTTCGAAATGCGCTTTGCCAAGATGCCGGACGA





GCCTGAGGAGCCAGTGGTGGCCGTGTCCTCCCCGGCAGTGCCCCCTCCCACCAAG





GTTGTGGCCCCGCCCTCATCCAGCGACAGCAGCAGCGATAGCTCCTCGGACAGTG





ACAGTTCGACTGATGACTCTGAGGAGGAGCGAGCCCAGCGGCTGGCTGAGCTCCA





GGAGCAGCTCAAAGCCGTGCACGAGCAGCTTGCAGCCCTCTCTCAGCCCCAGCAG





AACAAACCAAAGAAAAAGGAGAAAGACAAGAAGGAAAAGAAAAAAGAAAAGCA





CAAAAGGAAAGAGGAAGTGGAAGAGAATAAAAAAAGCAAAGCCAAGGAACCTC





CTCCTAAAAAGACGAAGAAAAATAATAGCAGCAACAGCAATGTGAGCAAGAAGG





AGCCAGCGCCCATGAAGAGCAAGCCCCCTCCCACGTATGAGTCGGAGGAAGAGG





ACAAGTGCAAGCCTATGTCCTATGAGGAGAAGCGGCAGCTCAGCTTGGACATCAA





CAAGCTCCCCGGCGAGAAGCTGGGCCGCGTGGTGCACATCATCCAGTCACGGGAG





CCCTCCCTGAAGAATTCCAACCCCGACGAGATTGAAATCGACTTTGAGACCCTGA





AGCCGTCCACACTGCGTGAGCTGGAGCGCTATGTCACCTCCTGTTTGCGGAAGAA





AAGGAAACCTCAAGCTGAGAAAGTTGATGTGATTGCCGGCTCCTCCAAGATGAAG





GGCTTCTCGTCCTCAGAGTCGGAGAGCTCCAGTGAGTCCAGCTCCTCTGACAGCGA





AGACTCCGAAACAGAGATGGCTCCGAAGTCAAAAAAGAAGGGGCACCCCGGGAG





GGAGCAGAAGAAGCACCATCATCACCACCATCAGCAGATGCAGCAGGCCCCGGCT





CCTGTGCCCCAGCAGCCGCCCCCGCCTCCCCAGCAGCCCCCACCGCCTCCACCTCC





GCAGCAGCAACAGCAGCCGCCACCCCCGCCTCCCCCACCCTCCATGCCGCAGCAG





GCAGCCCCGGCGATGAAGTCCTCGCCCCCACCCTTCATTGCCACCCAGGTGCCCGT





CCTGGAGCCCCAGCTCCCAGGCAGCGTCTTTGACCCCATCGGCCACTTCACCCAGC





CCATCCTGCACCTGCCGCAGCCTGAGCTGCCCCCTCACCTGCCCCAGCCGCCTGAG





CACAGCACTCCACCCCATCTCAACCAGCACGCAGTGGTCTCTCCTCCAGCTTTGCA





CAACGCACTACCCCAGCAGCCATCACGGCCCAGCAACCGAGCCGCTGCCCTGCCT





CCCAAGCCCGCCCGGCCCCCAGCCGTGTCACCAGCCTTGACCCAAACACCCCTGCT





CCCACAGCCCCCCATGGCCCAACCCCCCCAAGTGCTGCTGGAGGATGAAGAGCCA





CCTGCCCCACCCCTCACCTCCATGCAGATGCAGCTGTACCTGCAGCAGCTGCAGAA





GGTGCAGCCCCCTACGCCGCTACTCCCTTCCGTGAAGGTGCAGTCCCAGCCCCCAC





CCCCCCTGCCGCCCCCACCCCACCCCTCTGTGCAGCAGCAGCTGCAGCAGCAGCCG





CCACCACCCCCACCACCCCAGCCCCAGCCTCCACCCCAGCAGCAGCATCAGCCCC





CTCCACGGCCCGTGCACTTGCAGCCCATGCAGTTTTCCACCCACATCCAACAGCCC





CCGCCACCCCAGGGCCAGCAGCCCCCCCATCCGCCCCCAGGCCAGCAGCCACCCC





CGCCGCAGCCTGCCAAGCCTCAGCAAGTCATCCAGCACCACCATTCACCCCGGCA





CCACAAGTCGGACCCCTACTCAACCGGTCACCTCCGCGAAGCCCCCTCCCCGCTTA





TGATACATTCCCCCCAGATGTCACAGTTCCAGAGCCTGACCCACCAGTCTCCACCC





CAGCAAAACGTCCAGCCTAAGAAACAGGAGCTGCGTGCTGCCTCCGTGGTCCAGC





CCCAGCCCCTCGTGGTGGTGAAGGAGGAGAAGATCCACTCACCCATCATCCGCAG





CGAGCCCTTCAGCCCCTCGCTGCGGCCGGAGCCCCCCAAGCACCCGGAGAGCATC





AAGGCCCCCGTCCACCTGCCCCAGCGGCCGGAAATGAAGCCTGTGGATGTCGGGA





GGCCTGTGATCCGGCCCCCAGAGCAGAACGCACCGCCACCAGGGGCCCCTGACAA





GGACAAACAGAAACAGGAGCCGAAGACTCCAGTTGCGCCCAAAAAGGACCTGAA





AATCAAGAACATGGGCTCCTGGGCCAGCCTAGTGCAGAAGCATCCGACCACCCCC





TCCTCCACAGCCAAGTCATCCAGCGACAGCTTCGAGCAGTTCCGCCGCGCCGCTCG





GGAGAAAGAGGAGCGTGAGAAGGCCCTGAAGGCTCAGGCCGAGCACGCTGAGAA





GGAGAAGGAGCGGCTGCGGCAGGAGCGCATGAGGAGCCGAGAGGACGAGGATGC





GCTGGAGCAGGCCCGGCGGGCCCATGAGGAGGCACGTCGGCGCCAGGAGCAGCA





GCAGCAGCAGCGCCAGGAGCAACAGCAGCAGCAGCAACAGCAAGCAGCTGCGGT





GGCTGCCGCCGCCACCCCACAGGCCCAGAGCTCCCAGCCCCAGTCCATGCTGGAC





CAGCAGAGGGAGTTGGCCCGGAAGCGGGAGCAGGAGCGAAGACGCCGGGAAGCC





ATGGCAGCTACCATTGACATGAATTTCCAGAGTGATCTATTGTCAATATTTGAAGA





AAATCTTTTCTGA





BRD4 Amino Acid Sequence (glutamines targeted are underlined and


bolded)


(SEQ ID NO: 375)



MSAESGPGTRLRNLPVMGDGLETSQMSTTQAQAQPQPANAASTNPPPPETSNPNKPK






RQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKR





LENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTEETEI





MIVQAKGRGRGRKETGTAKPGVSTVPNTTQASTPPQTQTPQPNPPPVQATPHPFPAVT





PDLIVQTPVMTVVPPQPLQTPPPVPPQPQPPPAPAPQPVQSHPPIIAATPQPVKTKKGVK





RKADTTTPTTIDPIHEPPSLPPEPKTTKLGQRRESSRPVKPPKKDVPDSQQHPAPEKSSK





VSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDVEALGLHDYCDIIKHPMDMSTIKSK





LEAREYRDAQEFGADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPE





EPVVAVSSPAVPPPTKVVAPPSSSDSSSDSSSDSDSSTDDSEEERAQRLAELQEQLKAV





HEQLAALSQPQQNKPKKKEKDKKEKKKEKHKRKEEVEENKKSKAKEPPPKKTKKNN





SSNSNVSKKEPAPMKSKPPPTYESEEEDKCKPMSYEEKRQLSLDINKLPGEKLGRVVHI





IQSREPSLKNSNPDEIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMK





GFSSSESESSSESSSSDSEDSETEMAPKSKKKGHPGREQKKHHHHHHQQMQQAPAPVP





QQPPPPPQQPPPPPPPQQQQQPPPPPPPPSMPQQAAPAMKSSPPPFIATQVPVLEPQLPGS





VFDPIGHFTQPILHLPQPELPPHLPQPPEHSTPPHLNQHAVVSPPALHNALPQQPSRPSN





RAAALPPKPARPPAVSPALTQTPLLPQPPMAQPPQVLLEDEEPPAPPLTSMQMQLYLQ





QLQKVQPPTPLLPSVKVQSQPPPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPPQQQHQPP





PRPVHLQPMQFSTHIQQPPPPQGQQPPHPPPGQQPPPPQPAKPQQVIQHHHSPRHHKSD





PYSTGHLREAPSPLMIHSPQMSQFQSLTHQSPPQQNVQPKKQELRAASVVQPQPLVVV





KEEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPEQNAPPP





GAPDKDKQKQEPKTPVAPKKDLKIKNMGSWASLVQKHPTTPSSTAKSSSDSFEQFRR





AAREKEEREKALKAQAEHAEKEKERLRQERMRSREDEDALEQARRAHEEARRRQEQ





QQQQRQEQQQQQQQQAAAVAAAATPQAQSSQPQSMLDQQRELARKREQERRRREA





MAATIDMNFQSDLLSIFEENLF





PRSS2 Nucleotide Sequence 


(SEQ ID NO: 376)



ATGAATCTACTTCTGATCCTTACCTTTGTTGCAGCTGCTGTTGCTGCCCCCTTTGAT






GATGATGACAAGATCGTTGGGGGCTACATCTGTGAGGAGAATTCTGTCCCCTACC





AGGTGTCCTTGAATTCTGGCTACCACTTCTGCGGTGGCTCCCTCATCAGCGAACAG





TGGGTGGTGTCAGCAGGTCACTGCTACAAGTCGGCAATTAACTCAAAATTATCAG





GAAGAGGGTGTGAATATCACCGCATCCAGGTGAGACTGGGAGAGCACAACATCG





AAGTCCTGGAGGGGAATGAATAGTTCATCAATGCGGCCAAGATCATCCGCCACCC





CAAATACAACAGCCGGACTCTGGACAATGACATCCTGCTGATCAAGCTCTCCTCAC





CTGCCGTCATCAATTCCCGCGTGTCCGCCATCTCTCTGCCCACTGCCCCTCCAGCTG





CTGGCACCGAGTCCCTCATCTCCGGCTGGGGCAACACTCTGAGTTCTGGTGCCGAC





TACCCAGACGAGCTGCAGTGCCTGGATGCTCCTGTGCTGAGCCAGGCTGAGTGTG





AAGCCTCCTACCCTGGAAAGATTACCAACAACATGTTCTGTGTGGGCTTCCTCGAG





GGAGGCAAGGATTCCTGCCAGGGTGATTCTGGTGGCCCTGTGGTCTCCAATGGAG





AGCTCCAAGGAATTGTCTCCTGGGGCTATGGCTGTGCCCAGAAGAACAGGCCTGG





AGTCTACACCAAGGTCTACAACTATGTGGACTGGATTAAGGACACCATAGCTGCC





AACAGCCATCACCACCACCATCACTAA





PSSR2 Amino Acid Sequence (glutamines targeted are underlined and


bolded)


(SEQ ID NO: 377)



MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWV






VSAGHCYKSAINSKLSGRGCEYHRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRT





LDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAP





VLSQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCA







Q
KNRPGVYTKVYNYVDWIKDTIAANS







REFERENCES



  • 1 Edwards, H. & Schimmel, P. A bacterial amber suppressor in Saccharomyces cerevisiae is selectively recognized by a bacterial aminoacyl-tRNA synthetase. Molecular and cellular biology, doi:10.1128/MCB.10.4.1633 (1990).

  • 2 Edwards, H. & Trezeguet, V. An Escherichia coli tyrosine transfer RNA is a leucine-specific transfer RNA in the yeast Saccharomyces cerevisiae. PNAS, doi:10.1073/pnas.88.4.1153 (1991).

  • 3 Kiga, D., Sakamoto, K. & Kodama, K. Escherichia coli tyrosyl-tRNA synthetase for site-specific incorporation of an unnatural amino acid into proteins in eukaryotic translation and its application in a wheat germ cell—PNAS (2002).

  • 4 Dumas, A., Lercher, L., Spicer, C. D. & Davis, B. G. Designing logical codon reassignment—Expanding the chemistry in biology. Chemical Science 6, 50-69, doi:10.1039/c4sc01534g (2015).

  • 5 Huttlin, E. L., Ting, L., Bruckner, R. J., Gebreab, F. & Gygi, M. P. The BioPlex Network: A Systematic Exploration of the Human Interactome. Cell (2015).

  • 6 Bachovchin, D. A. et al. A high-throughput, multiplexed assay for superfamily-wide profiling of enzyme activity. Nature chemical biology 10, 656-663, doi:10.1038/nchembio.1578 (2014).

  • 7 Bachovchin, D. A., Brown, S. J., Rosen, H. & Cravatt, B. F. Identification of selective inhibitors of uncharacterized enzymes by high-throughput screening with fluorescent activity-based probes. Nature biotechnology 27, 387-394, doi:10.1038/nbt.1531 (2009).

  • 8 Liu, D. R., Magliery, T. J., Pastrnak, M., P. Schultz, P. G. Engineering a tRNA and aminoacyl-Trna synthetase for the site-specific incorporation of unnatural amino acids into proteins in vivo. Proceedings of the . . . (1997).

  • 9 Wang, L., Xie, J. & Schultz, P. G. Expanding the genetic code. Annu. Rev. Biophys. Biomol. Struct., doi:10.1146/annurev.biophys.35.101105.121507 (2006).

  • 10 Zhang, Z., Smith, B. A. C., Wang, L., Brock, A. & Cho, C. A new strategy for the site-specific modification of proteins in vivo. Biochemistry, doi:10.1021/bi0300231 (2003).

  • 11 Chin, J. W., Martin, A. B. & King, D. S. Addition of a photocrosslinking amino acid to the genetic code of Escherichia coli. Proceedings of the . . . , doi:10.1073/pnas.172226299 (2002).

  • 12 Chin, J. W. & Schultz, P. G. In vivo photocrosslinking with unnatural amino acid mutagenesis. Chembiochem, doi:10.1002/1439-7633(20021104)3:11<1135::AID-CBIC1135>3.0.CO;2-M (2002).

  • 13 Liu, W., Brock, A., Chen, S., Chen, S. & Schultz, P. G. Genetic incorporation of unnatural amino acids into proteins in mammalian cells. Nature methods (2007).

  • 14 Komor, A. C., Kim, Y. B., Packer, M. S., Zuris, J. A. & Liu, D. R. Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature, 533(7603):420-4, doi:10.1038/nature17946 (2016).

  • 15 Erhart, D., Zimmermann, M., Jacques, O. & Wittwer, M. B. Chemical development of intracellular protein heterodimerizers. Chemistry & biology (2013).

  • 16 Shalev, M. & Baasov, T. When proteins start to make sense: fine-tuning of aminoglycosides for PTC suppression therapy. Med Chem Comm 5, 1092-1105, doi:10.1039/C4MD00081A (2014).

  • 17 Winter, G. E. et al. DRUG DEVELOPMENT. Phthalimide conjugation as a strategy for in vivo target protein degradation. Science 348, 1376-1381, doi:10.1126/science.aab1433 (2015).

  • 18 Bondeson, D. P. et al. Catalytic in vivo protein knockdown by small-molecule PROTACs. Nature Chemical Biology 11, 611-617, doi:10.1038/nchembio.1858 (2015).

  • 19 Nishimura, K., Fukagawa, T., Takisawa, H. & Kakimoto, T. An auxin-based degron system for the rapid depletion of proteins in nonplant cells. Nature doi:10.1038/nmeth.1401 (2009).

  • 20 Lu, G. et al. The myeloma drug lenalidomide promotes the cereblon-dependent destruction of Ikaros proteins. Science 343, 305-309, doi:10.1126/science.1244917 (2014).

  • 21 Schenone, M., Schreiber, S. L., Carr, S. A. & Ebert, B. L. Lenalidomide causes selective degradation of IKZF1 and IKZF3 in multiple myeloma cells. Science (2014).



EQUIVALENTS AND SCOPE

In the claims articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The disclosure includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The disclosure includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.


Furthermore, the disclosure encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, and descriptive terms from one or more of the listed claims is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Where elements are presented as lists, e.g., in Markush group format, each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It should it be understood that, in general, where the disclosure, or aspects of the disclosure, is/are referred to as comprising particular elements and/or features, certain embodiments of the disclosure or aspects of the disclosure consist, or consist essentially of, such elements and/or features. For purposes of simplicity, those embodiments have not been specifically set forth in haec verba herein.


It is also noted that the terms “comprising” and “containing” are intended to be open and permits the inclusion of additional elements or steps. Where ranges are given, endpoints are included. Furthermore, unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or sub-range within the stated ranges in different embodiments of the disclosure, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.


This application refers to various issued patents, published patent applications, journal articles, and other publications, all of which are incorporated herein by reference. If there is a conflict between any of the incorporated references and the instant specification, the specification shall control. In addition, any particular embodiment of the present disclosure that falls within the prior art may be explicitly excluded from any one or more of the claims. Because such embodiments are deemed to be known to one of ordinary skill in the art, they may be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the disclosure can be excluded from any claim, for any reason, whether or not related to the existence of prior art.


Those skilled in the art will recognize or be able to ascertain using no more than routine experimentation many equivalents to the specific embodiments described herein. The scope of the present embodiments described herein is not intended to be limited to the above Description, but rather is as set forth in the appended claims. Those of ordinary skill in the art will appreciate that various changes and modifications to this description may be made without departing from the spirit or scope of the present disclosure, as defined in the following claims.

Claims
  • 1. A method of incorporating an unnatural amino acid into a protein of interest at one or more specific position(s), the method comprising: (i) contacting a polynucleotide encoding the protein of interest with a fusion protein comprising (a) a guide nucleotide sequence-programmable DNA-binding protein domain; (b) a cytosine deaminase domain; and (c) a uracil glycosylase inhibitor (UGI) domain, wherein the fusion protein is associated with a guide nucleotide sequence, and whereby the contacting results in changing a target codon to a suppressible stop codon or a rare codon via deamination of a cytosine (C) base; and(ii) using the polynucleotide containing the suppressible stop codon or rare codon in a translation system, whereby the unnatural amino acid is incorporated into the protein of interest at the suppressible stop codon or rare codon during translation of the protein,wherein the polynucleotide comprises a coding strand and a complementary strand.
  • 2. The method of claim 1, wherein the guide nucleotide sequence-programmable DNA binding protein domain is selected from the group consisting of: nuclease inactive Cas9 (dCas9) domains, nuclease inactive Cpf1 domains, nuclease inactive Argonaute domains, Cas9 nickase, and variants thereof.
  • 3. The method of claim 1, wherein the cytosine deaminase domain comprises an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase.
  • 4. The method of claim 1, wherein the cytosine deaminase domain comprises the amino acid sequence of any one of SEQ ID NOs: 270-288 and 378-381, or an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 270-288 or 378-381.
  • 5. The method of claim 1, wherein the cytosine deaminase domain and the guide nucleotide sequence-programmable DNA-binding protein domain are fused via an linker.
  • 6. The method of claim 1, wherein the fusion protein comprises the amino acid sequence of any one of SEQ ID NO: 291-295 and 382-386, or an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 291-295 or 382-386.
  • 7. The method of claim 1, wherein the guide nucleotide sequence is an RNA.
  • 8. The method of claim 1, wherein the target codon is changed to a suppressible stop codon selected from the group consisting of TAG (Amber), TGA (Opal), and TAA (Ochre).
  • 9. The method of claim 1, wherein the target codon is changed to a rare codon selected from the group consisting of AGG, ATA, AGT, TTT, and TTC.
  • 10. The method of claim 1, wherein the translation system comprises: (a) an orthogonal tRNA (OtRNA);(b) an orthogonal aminoacyl tRNA synthetase (ORS); and(c) an unnatural amino acid,wherein the ORS preferentially aminoacylates the OtRNA with the unnatural amino acid, and the OtRNA recognizes at least one suppressible stop codon.
  • 11. The method of claim 1, wherein two or more types of unnatural amino acids are incorporated into the protein of interest.
  • 12. The method of claim 1, wherein the unnatural amino acid is incorporated into two or more proteins of interest.
  • 13. The method of claim 1, wherein the unnatural amino acid is incorporated proteome-wide.
  • 14. A method of incorporating an unnatural amino acid into a protein of interest at one or more specific position(s), the method comprising: (i) contacting a polynucleotide encoding the protein of interest with a fusion protein comprising (a) a programmable DNA-binding protein domain; (b) a cytosine deaminase domain; and (c) a uracil glycosylase inhibitor (UGI) domain, whereby the contacting results in changing a target codon to a suppressible stop codon or a rare codon via deamination of a target base; and(ii) using the polynucleotide containing the suppressible stop codon or rare codon in a translation system, whereby the unnatural amino acids are incorporated into the protein of interest at the suppressible stop codon or rare codon during translation of the protein,wherein the polynucleotide comprises a coding strand and a complementary strand.
  • 15. The method of claim 1, wherein the unnatural amino acid comprises a click chemistry handle.
  • 16. The method of claim 14, wherein the guide nucleotide sequence-programmable DNA binding protein domain is selected from the group consisting of: nuclease inactive Cas9 (dCas9) domains, nuclease inactive Cpf1 domains, nuclease inactive Argonaute domains, Cas9 nickase, and variants thereof.
  • 17. The method of claim 14, wherein the cytosine deaminase domain comprises an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase.
  • 18. The method of claim 14, wherein the cytosine deaminase domain comprises the amino acid sequence of any one of SEQ ID NOs: 270-288 and 378-381, or an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 270-288 or 378-381.
  • 19. The method of claim 14, wherein the fusion protein comprises the amino acid sequence of any one of SEQ ID NO: 291-295 and 382-386, or an amino acid sequence having at least 80% sequence identity with any one of SEQ ID NOs: 291-295 or 382-386.
RELATED APPLICATIONS

This application is a national stage filing under 35 U.S.C. § 371 of international PCT application, PCT/US2017/048390, filed Aug. 24, 2017, which claims priority under 35 U.S.C. § 119(e) to U.S. Provisional Application, U.S. Ser. No. 62/379,122, filed on Aug. 24, 2016, each of which is incorporated herein by reference.

GOVERNMENT SUPPORT

This invention was made with government support under grant number DGE1144152 awarded by the National Science Foundation, and under grant number GM095450 awarded by the National Institutes of Health. The government has certain rights in the invention.

PCT Information
Filing Document Filing Date Country Kind
PCT/US2017/048390 8/24/2017 WO
Publishing Document Publishing Date Country Kind
WO2018/039438 3/1/2018 WO A
US Referenced Citations (517)
Number Name Date Kind
4182449 Kozlow Jan 1980 A
4186183 Steck et al. Jan 1980 A
4217344 Vanlerberghe et al. Aug 1980 A
4235871 Papahadjopoulos et al. Nov 1980 A
4261975 Fullerton et al. Apr 1981 A
4485054 Mezei et al. Nov 1984 A
4501728 Geho et al. Feb 1985 A
4663290 Weis et al. May 1987 A
4737323 Martin et al. Apr 1988 A
4774085 Fidler Sep 1988 A
4797368 Carter et al. Jan 1989 A
4837028 Allen Jun 1989 A
4873316 Meade et al. Oct 1989 A
4880635 Janoff et al. Nov 1989 A
4889818 Gelfand et al. Dec 1989 A
4897355 Eppstein et al. Jan 1990 A
4906477 Kurono et al. Mar 1990 A
4911928 Wallach Mar 1990 A
4917951 Wallach Apr 1990 A
4920016 Allen et al. Apr 1990 A
4921757 Wheatley et al. May 1990 A
4946787 Eppstein et al. Aug 1990 A
4965185 Grischenko et al. Oct 1990 A
5017492 Kotewicz et al. May 1991 A
5047342 Chatterjee Sep 1991 A
5049386 Eppstein et al. Sep 1991 A
5079352 Gelfand et al. Jan 1992 A
5139941 Muzyczka et al. Aug 1992 A
5173414 Lebkowski et al. Dec 1992 A
5223409 Ladner et al. Jun 1993 A
5244797 Kotewicz et al. Sep 1993 A
5270179 Chatterjee Dec 1993 A
5374553 Gelfand et al. Dec 1994 A
5405776 Kotewicz et al. Apr 1995 A
5436149 Barnes Jul 1995 A
5449639 Wei et al. Sep 1995 A
5496714 Comb et al. Mar 1996 A
5512462 Cheng Apr 1996 A
5580737 Polisky et al. Dec 1996 A
5614365 Tabor et al. Mar 1997 A
5658727 Barbas et al. Aug 1997 A
5668005 Kotewicz et al. Sep 1997 A
5677152 Birch et al. Oct 1997 A
5767099 Harris et al. Jun 1998 A
5780053 Ashley et al. Jul 1998 A
5830430 Unger et al. Nov 1998 A
5834247 Comb et al. Nov 1998 A
5835699 Kimura Nov 1998 A
5851548 Dattagupta et al. Dec 1998 A
5855910 Ashley et al. Jan 1999 A
5962313 Podsakoff et al. Oct 1999 A
5981182 Jacobs, Jr. et al. Nov 1999 A
6057153 George et al. May 2000 A
6063608 Kotewicz et al. May 2000 A
6156509 Schellenberger Dec 2000 A
6183998 Ivanov et al. Feb 2001 B1
6429298 Ellington et al. Aug 2002 B1
6453242 Eisenberg et al. Sep 2002 B1
6479264 Louwrier Nov 2002 B1
6503717 Case et al. Jan 2003 B2
6534261 Cox, III et al. Mar 2003 B1
6589768 Kotewicz et al. Jul 2003 B1
6599692 Case et al. Jul 2003 B1
6607882 Cox, III et al. Aug 2003 B1
6610522 Kotewicz et al. Aug 2003 B1
6689558 Case Feb 2004 B2
6824978 Cox, III et al. Nov 2004 B1
6933113 Case et al. Aug 2005 B2
6979539 Cox, III et al. Dec 2005 B2
7013219 Case et al. Mar 2006 B2
7045337 Schultz et al. May 2006 B2
7070928 Liu et al. Jul 2006 B2
7078208 Smith et al. Jul 2006 B2
7083970 Schultz et al. Aug 2006 B2
7163824 Cox, III et al. Jan 2007 B2
7192739 Liu et al. Mar 2007 B2
7223545 Liu et al. May 2007 B2
7354761 Schultz et al. Apr 2008 B2
7368275 Schultz et al. May 2008 B2
7442160 Liu et al. Oct 2008 B2
7476500 Liu et al. Jan 2009 B1
7476734 Liu Jan 2009 B2
7479573 Chu et al. Jan 2009 B2
7491494 Liu et al. Feb 2009 B2
7541450 Liu et al. Jun 2009 B2
7557068 Liu et al. Jul 2009 B2
7595179 Chen et al. Sep 2009 B2
7638300 Schultz et al. Dec 2009 B2
7670807 Lampson et al. Mar 2010 B2
7678554 Liu et al. Mar 2010 B2
7713721 Schultz et al. May 2010 B2
7771935 Liu et al. Aug 2010 B2
7794931 Breaker et al. Sep 2010 B2
7807408 Liu et al. Oct 2010 B2
7851658 Liu et al. Dec 2010 B2
7915025 Schultz et al. Mar 2011 B2
7919277 Russell et al. Apr 2011 B2
7993672 Huang et al. Aug 2011 B2
7998904 Liu et al. Aug 2011 B2
8012739 Schultz et al. Sep 2011 B2
8017323 Liu et al. Sep 2011 B2
8017755 Liu et al. Sep 2011 B2
8030074 Schultz et al. Oct 2011 B2
8067556 Hogrefe et al. Nov 2011 B2
8114648 Schultz et al. Feb 2012 B2
8173364 Schultz et al. May 2012 B2
8173392 Schultz et al. May 2012 B2
8183012 Schultz et al. May 2012 B2
8183178 Liu et al. May 2012 B2
8206914 Liu et al. Jun 2012 B2
8361725 Russell et al. Jan 2013 B2
8394604 Liu et al. Mar 2013 B2
8440431 Voytas et al. May 2013 B2
8440432 Voytas et al. May 2013 B2
8450471 Voytas et al. May 2013 B2
8492082 De Franciscis et al. Jul 2013 B2
8546553 Terns et al. Oct 2013 B2
8569256 Heyes et al. Oct 2013 B2
8586363 Voytas et al. Nov 2013 B2
8680069 de Fougerolles et al. Mar 2014 B2
8691729 Liu et al. Apr 2014 B2
8691750 Constien et al. Apr 2014 B2
8697359 Zhang Apr 2014 B1
8697853 Voytas et al. Apr 2014 B2
8709466 Coady et al. Apr 2014 B2
8728526 Heller May 2014 B2
8748667 Budzik et al. Jun 2014 B2
8758810 Okada et al. Jun 2014 B2
8759103 Kim et al. Jun 2014 B2
8759104 Unciti-Broceta et al. Jun 2014 B2
8771728 Huang et al. Jul 2014 B2
8790664 Pitard et al. Jul 2014 B2
8795965 Zhang Aug 2014 B2
8822663 Schrum et al. Sep 2014 B2
8846578 McCray et al. Sep 2014 B2
8889418 Zhang et al. Nov 2014 B2
8900814 Yasukawa et al. Dec 2014 B2
8975232 Liu et al. Mar 2015 B2
8993233 Zhang et al. Mar 2015 B2
8999641 Zhang et al. Apr 2015 B2
9023594 Liu et al. May 2015 B2
9068179 Liu et al. Jun 2015 B1
9150626 Liu et al. Oct 2015 B2
9163271 Schultz et al. Oct 2015 B2
9163284 Liu et al. Oct 2015 B2
9181535 Liu et al. Nov 2015 B2
9200045 Liu et al. Dec 2015 B2
9221886 Liu et al. Dec 2015 B2
9228207 Liu et al. Jan 2016 B2
9234213 Wu Jan 2016 B2
9243038 Liu et al. Jan 2016 B2
9267127 Liu et al. Feb 2016 B2
9322006 Liu et al. Apr 2016 B2
9322037 Liu et al. Apr 2016 B2
9340799 Liu et al. May 2016 B2
9340800 Liu et al. May 2016 B2
9359599 Liu et al. Jun 2016 B2
9388430 Liu et al. Jul 2016 B2
9394537 Liu et al. Jul 2016 B2
9434774 Liu et al. Sep 2016 B2
9458484 Ma et al. Oct 2016 B2
9512446 Joung et al. Dec 2016 B1
9526724 Oshiack et al. Dec 2016 B2
9526784 Liu et al. Dec 2016 B2
9534210 Park et al. Jan 2017 B2
9580698 Xu et al. Feb 2017 B1
9610322 Liu et al. Apr 2017 B2
9637739 Siksnys et al. May 2017 B2
9737604 Liu et al. Aug 2017 B2
9738693 Telford et al. Aug 2017 B2
9753340 Saitou Sep 2017 B2
9771574 Liu et al. Sep 2017 B2
9783791 Hogrefe et al. Oct 2017 B2
9816093 Donohoue et al. Nov 2017 B1
9840538 Telford et al. Dec 2017 B2
9840690 Karli et al. Dec 2017 B2
9840699 Liu et al. Dec 2017 B2
9840702 Collingwood et al. Dec 2017 B2
9850521 Braman et al. Dec 2017 B2
9873907 Zeiner et al. Jan 2018 B2
9879270 Hittinger et al. Jan 2018 B2
9932567 Xu et al. Apr 2018 B1
9938288 Kishi et al. Apr 2018 B1
9944933 Storici et al. Apr 2018 B2
9982279 Gill et al. May 2018 B1
9999671 Liu et al. Jun 2018 B2
10011868 Liu et al. Jul 2018 B2
10053725 Liu et al. Aug 2018 B2
10059940 Zhong Aug 2018 B2
10077453 Liu et al. Sep 2018 B2
10113163 Liu et al. Oct 2018 B2
10150955 Lambowitz et al. Dec 2018 B2
10167457 Liu et al. Jan 2019 B2
10179911 Liu et al. Jan 2019 B2
10189831 Arrington et al. Jan 2019 B2
10202593 Liu et al. Feb 2019 B2
10202658 Parkin et al. Feb 2019 B2
10227581 Liu et al. Mar 2019 B2
10323236 Liu et al. Jun 2019 B2
10336997 Liu et al. Jul 2019 B2
10358670 Janulaitis et al. Jul 2019 B2
10392674 Liu et al. Aug 2019 B2
10407697 Doudna et al. Sep 2019 B2
10465176 Liu et al. Nov 2019 B2
10508298 Liu et al. Dec 2019 B2
10597679 Liu et al. Mar 2020 B2
10612011 Liu et al. Apr 2020 B2
10682410 Liu et al. Jun 2020 B2
10704062 Liu et al. Jul 2020 B2
10745677 Maianti et al. Aug 2020 B2
10858639 Liu et al. Dec 2020 B2
10912833 Liu et al. Feb 2021 B2
10930367 Zhang et al. Feb 2021 B2
10947530 Liu et al. Mar 2021 B2
10954548 Liu et al. Mar 2021 B2
11046948 Liu et al. Jun 2021 B2
11053481 Liu et al. Jul 2021 B2
11078429 Liu et al. Aug 2021 B2
11124782 Liu et al. Sep 2021 B2
20030082575 Schultz et al. May 2003 A1
20030087817 Cox et al. May 2003 A1
20030096337 Hillman et al. May 2003 A1
20030108885 Schultz et al. Jun 2003 A1
20030119764 Loeb et al. Jun 2003 A1
20030167533 Yadav et al. Sep 2003 A1
20030203480 Kovesdi et al. Oct 2003 A1
20040003420 Kuhn et al. Jan 2004 A1
20040115184 Smith et al. Jun 2004 A1
20040203109 Lal et al. Oct 2004 A1
20050136429 Guarente et al. Jun 2005 A1
20050222030 Allison Oct 2005 A1
20050260626 Lorens et al. Nov 2005 A1
20060088864 Smolke et al. Apr 2006 A1
20060104984 Littlefield et al. May 2006 A1
20060246568 Honjo et al. Nov 2006 A1
20070264692 Liu et al. Nov 2007 A1
20070269817 Shapero Nov 2007 A1
20080051317 Church et al. Feb 2008 A1
20080124725 Barrangou et al. May 2008 A1
20080182254 Hall et al. Jul 2008 A1
20080220502 Schellenberger et al. Sep 2008 A1
20090130718 Short May 2009 A1
20090215878 Tan et al. Aug 2009 A1
20090234109 Han et al. Sep 2009 A1
20100076057 Sontheimer et al. Mar 2010 A1
20100093617 Barrangou et al. Apr 2010 A1
20100104690 Barrangou et al. Apr 2010 A1
20100273857 Thakker et al. Oct 2010 A1
20100305197 Che Dec 2010 A1
20100316643 Eckert et al. Dec 2010 A1
20110016540 Weinstein et al. Jan 2011 A1
20110059160 Essner et al. Mar 2011 A1
20110059502 Chalasani Mar 2011 A1
20110104787 Church et al. May 2011 A1
20110177495 Liu et al. Jul 2011 A1
20110189775 Ainley et al. Aug 2011 A1
20110189776 Terns et al. Aug 2011 A1
20110217739 Terns et al. Sep 2011 A1
20110301073 Gregory et al. Dec 2011 A1
20120129759 Liu et al. May 2012 A1
20120141523 Castado et al. Jun 2012 A1
20120244601 Bertozzi et al. Sep 2012 A1
20120270273 Zhang et al. Oct 2012 A1
20130059931 Petersen-Mahrt et al. Mar 2013 A1
20130117869 Duchateau et al. May 2013 A1
20130130248 Haurwitz et al. May 2013 A1
20130158245 Russell et al. Jun 2013 A1
20130165389 Schellenberger et al. Jun 2013 A1
20130309720 Schultz et al. Nov 2013 A1
20130344117 Mirosevich et al. Dec 2013 A1
20130345064 Liu et al. Dec 2013 A1
20140004280 Loomis Jan 2014 A1
20140005269 Ngwuluka et al. Jan 2014 A1
20140017214 Cost Jan 2014 A1
20140018404 Chen et al. Jan 2014 A1
20140044793 Goll et al. Feb 2014 A1
20140065711 Liu et al. Mar 2014 A1
20140068797 Doudna et al. Mar 2014 A1
20140127752 Zhou et al. May 2014 A1
20140141094 Smyth et al. May 2014 A1
20140141487 Feldman et al. May 2014 A1
20140179770 Zhang et al. Jun 2014 A1
20140186843 Zhang et al. Jul 2014 A1
20140186958 Zhang et al. Jul 2014 A1
20140201858 Ostertag et al. Jul 2014 A1
20140234289 Liu et al. Aug 2014 A1
20140248702 Zhang et al. Sep 2014 A1
20140273037 Wu Sep 2014 A1
20140273226 Wu Sep 2014 A1
20140273230 Chen et al. Sep 2014 A1
20140273234 Zhang et al. Sep 2014 A1
20140295556 Joung et al. Oct 2014 A1
20140295557 Joung et al. Oct 2014 A1
20140342456 Mali et al. Nov 2014 A1
20140342457 Mali et al. Nov 2014 A1
20140342458 Mali et al. Nov 2014 A1
20140349400 Jakimo et al. Nov 2014 A1
20140356867 Peter et al. Dec 2014 A1
20140356956 Church et al. Dec 2014 A1
20140356958 Mali et al. Dec 2014 A1
20140356959 Church et al. Dec 2014 A1
20140357523 Zeiner et al. Dec 2014 A1
20140377868 Joung et al. Dec 2014 A1
20150010526 Liu et al. Jan 2015 A1
20150031089 Lindstrom Jan 2015 A1
20150031132 Church et al. Jan 2015 A1
20150031133 Church et al. Jan 2015 A1
20150044191 Liu et al. Feb 2015 A1
20150044192 Liu et al. Feb 2015 A1
20150044772 Zhao Feb 2015 A1
20150050699 Siksnys et al. Feb 2015 A1
20150056177 Liu et al. Feb 2015 A1
20150056629 Guthrie-Honea Feb 2015 A1
20150064138 Lu et al. Mar 2015 A1
20150064789 Paschon et al. Mar 2015 A1
20150071898 Liu et al. Mar 2015 A1
20150071899 Liu et al. Mar 2015 A1
20150071900 Liu et al. Mar 2015 A1
20150071901 Liu et al. Mar 2015 A1
20150071902 Liu et al. Mar 2015 A1
20150071903 Liu et al. Mar 2015 A1
20150071906 Liu et al. Mar 2015 A1
20150079680 Bradley et al. Mar 2015 A1
20150079681 Zhang Mar 2015 A1
20150098954 Hyde et al. Apr 2015 A1
20150118216 Liu et al. Apr 2015 A1
20150132269 Orkin et al. May 2015 A1
20150140664 Byrne et al. May 2015 A1
20150159172 Miller et al. Jun 2015 A1
20150165054 Liu et al. Jun 2015 A1
20150166980 Liu et al. Jun 2015 A1
20150166981 Liu et al. Jun 2015 A1
20150166982 Liu et al. Jun 2015 A1
20150166983 Liu et al. Jun 2015 A1
20150166984 Liu et al. Jun 2015 A1
20150166985 Liu et al. Jun 2015 A1
20150191744 Wolfe et al. Jul 2015 A1
20150197759 Xu et al. Jul 2015 A1
20150211058 Carstens Jul 2015 A1
20150218573 Loque et al. Aug 2015 A1
20150225773 Farmer et al. Aug 2015 A1
20150252358 Maeder et al. Sep 2015 A1
20150275202 Liu et al. Oct 2015 A1
20150307889 Petolino et al. Oct 2015 A1
20150315252 Haugwitz et al. Nov 2015 A1
20150344549 Muir et al. Dec 2015 A1
20160015682 Cawthorne et al. Jan 2016 A2
20160017393 Jacobson et al. Jan 2016 A1
20160017396 Cann et al. Jan 2016 A1
20160032292 Storici et al. Feb 2016 A1
20160032353 Braman et al. Feb 2016 A1
20160040155 Maizels et al. Feb 2016 A1
20160046952 Hittinger et al. Feb 2016 A1
20160046961 Jinek et al. Feb 2016 A1
20160046962 May et al. Feb 2016 A1
20160053272 Wurtzel et al. Feb 2016 A1
20160053304 Wurtzel et al. Feb 2016 A1
20160074535 Ranganathan et al. Mar 2016 A1
20160076093 Shendure et al. Mar 2016 A1
20160090603 Carnes et al. Mar 2016 A1
20160090622 Liu et al. Mar 2016 A1
20160115488 Zhang et al. Apr 2016 A1
20160138046 Wu May 2016 A1
20160186214 Brouns et al. Jun 2016 A1
20160200779 Liu et al. Jul 2016 A1
20160201040 Liu et al. Jul 2016 A1
20160201089 Gersbach et al. Jul 2016 A1
20160206566 Lu et al. Jul 2016 A1
20160208243 Zhang et al. Jul 2016 A1
20160208288 Liu et al. Jul 2016 A1
20160215275 Zhong Jul 2016 A1
20160215276 Liu et al. Jul 2016 A1
20160215300 May et al. Jul 2016 A1
20160244784 Jacobson et al. Aug 2016 A1
20160244829 Bang et al. Aug 2016 A1
20160264934 Giallourakis et al. Sep 2016 A1
20160272593 Ritter et al. Sep 2016 A1
20160272965 Zhang et al. Sep 2016 A1
20160281072 Zhang Sep 2016 A1
20160298136 Chen et al. Oct 2016 A1
20160304846 Liu et al. Oct 2016 A1
20160304855 Stark et al. Oct 2016 A1
20160312304 Sorrentino et al. Oct 2016 A1
20160319262 Doudna et al. Nov 2016 A1
20160333389 Liu et al. Nov 2016 A1
20160340622 Abdou Nov 2016 A1
20160340662 Zhang et al. Nov 2016 A1
20160345578 Barrangou et al. Dec 2016 A1
20160346360 Quake et al. Dec 2016 A1
20160346361 Quake et al. Dec 2016 A1
20160346362 Quake et al. Dec 2016 A1
20160348074 Quake et al. Dec 2016 A1
20160348096 Liu et al. Dec 2016 A1
20160350476 Quake et al. Dec 2016 A1
20160355796 Davidson et al. Dec 2016 A1
20160369262 Reik et al. Dec 2016 A1
20170009224 Liu et al. Jan 2017 A1
20170009242 McKinley et al. Jan 2017 A1
20170014449 Bangera et al. Jan 2017 A1
20170020922 Wagner et al. Jan 2017 A1
20170037432 Donohoue et al. Feb 2017 A1
20170044520 Liu et al. Feb 2017 A1
20170044592 Peter et al. Feb 2017 A1
20170053729 Kotani et al. Feb 2017 A1
20170058271 Joung et al. Mar 2017 A1
20170058272 Carter et al. Mar 2017 A1
20170058298 Kennedy et al. Mar 2017 A1
20170073663 Wang et al. Mar 2017 A1
20170073670 Nishida et al. Mar 2017 A1
20170087224 Quake Mar 2017 A1
20170087225 Quake Mar 2017 A1
20170088587 Quake Mar 2017 A1
20170088828 Quake Mar 2017 A1
20170107536 Zhang et al. Apr 2017 A1
20170107560 Peter et al. Apr 2017 A1
20170114367 Hu et al. Apr 2017 A1
20170121693 Liu et al. May 2017 A1
20170145394 Yeo et al. May 2017 A1
20170145405 Tang et al. May 2017 A1
20170145438 Kantor May 2017 A1
20170152528 Zhang Jun 2017 A1
20170152787 Kubo et al. Jun 2017 A1
20170159033 Kamtekar et al. Jun 2017 A1
20170166928 Vyas et al. Jun 2017 A1
20170175104 Doudna et al. Jun 2017 A1
20170175142 Zhang et al. Jun 2017 A1
20170191047 Terns et al. Jul 2017 A1
20170191078 Zhang et al. Jul 2017 A1
20170198269 Zhang et al. Jul 2017 A1
20170198277 Kmiec et al. Jul 2017 A1
20170198302 Feng et al. Jul 2017 A1
20170226522 Hu et al. Aug 2017 A1
20170233703 Xie et al. Aug 2017 A1
20170233756 Begemann et al. Aug 2017 A1
20170247671 Yung et al. Aug 2017 A1
20170247703 Sloan et al. Aug 2017 A1
20170268022 Liu et al. Sep 2017 A1
20170275648 Barrangou et al. Sep 2017 A1
20170275665 Silas et al. Sep 2017 A1
20170283797 Robb et al. Oct 2017 A1
20170283831 Zhang et al. Oct 2017 A1
20170314016 Kim et al. Nov 2017 A1
20170362635 Chamberlain et al. Dec 2017 A1
20180023062 Lamb et al. Jan 2018 A1
20180064077 Dunham et al. Mar 2018 A1
20180066258 Powell Mar 2018 A1
20180068062 Zhang et al. Mar 2018 A1
20180073012 Liu et al. Mar 2018 A1
20180080051 Sheikh et al. Mar 2018 A1
20180087046 Badran et al. Mar 2018 A1
20180100147 Yates et al. Apr 2018 A1
20180105867 Xiao et al. Apr 2018 A1
20180119118 Lu et al. May 2018 A1
20180127759 Lu et al. May 2018 A1
20180127780 Liu et al. May 2018 A1
20180155708 Church et al. Jun 2018 A1
20180155720 Donohoue et al. Jun 2018 A1
20180163213 Aneja et al. Jun 2018 A1
20180170984 Harris et al. Jun 2018 A1
20180179503 Maianti et al. Jun 2018 A1
20180179547 Zhang et al. Jun 2018 A1
20180201921 Malcolm Jul 2018 A1
20180230464 Zhong Aug 2018 A1
20180230471 Storici et al. Aug 2018 A1
20180236081 Liu et al. Aug 2018 A1
20180237758 Liu et al. Aug 2018 A1
20180237787 Maianti et al. Aug 2018 A1
20180245066 Yao et al. Aug 2018 A1
20180258418 Kim Sep 2018 A1
20180265864 Li et al. Sep 2018 A1
20180273939 Yu et al. Sep 2018 A1
20180282722 Jakimo et al. Oct 2018 A1
20180298391 Jakimo et al. Oct 2018 A1
20180305688 Zhong Oct 2018 A1
20180305704 Zhang Oct 2018 A1
20180312822 Lee et al. Nov 2018 A1
20180312825 Liu et al. Nov 2018 A1
20180312828 Liu et al. Nov 2018 A1
20180312835 Yao et al. Nov 2018 A1
20180327756 Zhang et al. Nov 2018 A1
20180346927 Doudna et al. Dec 2018 A1
20190010481 Joung et al. Jan 2019 A1
20190055543 Tran et al. Feb 2019 A1
20190093099 Liu et al. Mar 2019 A1
20190185883 Liu et al. Jun 2019 A1
20190225955 Liu et al. Jul 2019 A1
20190233847 Savage et al. Aug 2019 A1
20190241633 Fotin-Mleczek et al. Aug 2019 A1
20190256842 Liu et al. Aug 2019 A1
20190264202 Church et al. Aug 2019 A1
20190276816 Liu et al. Sep 2019 A1
20190322992 Liu et al. Oct 2019 A1
20190352632 Liu et al. Nov 2019 A1
20190367891 Liu et al. Dec 2019 A1
20200010818 Liu et al. Jan 2020 A1
20200010835 Maianti et al. Jan 2020 A1
20200063127 Lu et al. Feb 2020 A1
20200071722 Liu et al. Mar 2020 A1
20200172931 Liu et al. Jun 2020 A1
20200181619 Tang et al. Jun 2020 A1
20200190493 Liu et al. Jun 2020 A1
20200216833 Liu et al. Jul 2020 A1
20200255868 Liu et al. Aug 2020 A1
20200277587 Liu et al. Sep 2020 A1
20200323984 Liu et al. Oct 2020 A1
20200399619 Maianti et al. Dec 2020 A1
20200399626 Liu et al. Dec 2020 A1
20210054416 Liu et al. Feb 2021 A1
20210115428 Maianti et al. Apr 2021 A1
20210196809 Maianti et al. Jul 2021 A1
20210198330 Liu et al. Jul 2021 A1
20210214698 Liu et al. Jul 2021 A1
20210230577 Liu et al. Jul 2021 A1
20210254127 Liu et al. Aug 2021 A1
20210315994 Liu et al. Oct 2021 A1
20210317440 Liu et al. Oct 2021 A1
20220033785 Liu et al. Feb 2022 A1
Foreign Referenced Citations (1618)
Number Date Country
2012244264 Nov 2012 AU
2012354062 Jul 2014 AU
2015252023 Nov 2015 AU
2015101792 Jan 2016 AU
112015013786 Jul 2017 BR
2894668 Jun 2014 CA
2894681 Jun 2014 CA
2894684 Jun 2014 CA
2 852 593 Nov 2015 CA
1069962 Mar 1993 CN
103224947 Jul 2013 CN
103233028 Aug 2013 CN
103388006 Nov 2013 CN
103614415 Mar 2014 CN
103642836 Mar 2014 CN
103668472 Mar 2014 CN
103820441 May 2014 CN
103820454 May 2014 CN
103911376 Jul 2014 CN
103923911 Jul 2014 CN
103981211 Aug 2014 CN
103981212 Aug 2014 CN
104004778 Aug 2014 CN
104004782 Aug 2014 CN
104017821 Sep 2014 CN
104109687 Oct 2014 CN
104178461 Dec 2014 CN
104342457 Feb 2015 CN
104404036 Mar 2015 CN
104450774 Mar 2015 CN
104480144 Apr 2015 CN
104498493 Apr 2015 CN
104504304 Apr 2015 CN
104531704 Apr 2015 CN
104531705 Apr 2015 CN
104560864 Apr 2015 CN
104561095 Apr 2015 CN
104593418 May 2015 CN
104593422 May 2015 CN
104611370 May 2015 CN
104651392 May 2015 CN
104651398 May 2015 CN
104651399 May 2015 CN
104651401 May 2015 CN
104673816 Jun 2015 CN
104725626 Jun 2015 CN
104726449 Jun 2015 CN
104726494 Jun 2015 CN
104745626 Jul 2015 CN
104762321 Jul 2015 CN
104805078 Jul 2015 CN
104805099 Jul 2015 CN
104805118 Jul 2015 CN
104846010 Aug 2015 CN
104894068 Sep 2015 CN
104894075 Sep 2015 CN
104928321 Sep 2015 CN
105039339 Nov 2015 CN
105039399 Nov 2015 CN
105063061 Nov 2015 CN
105087620 Nov 2015 CN
105112422 Dec 2015 CN
105112445 Dec 2015 CN
105112519 Dec 2015 CN
105121648 Dec 2015 CN
105132427 Dec 2015 CN
105132451 Dec 2015 CN
105177038 Dec 2015 CN
105177126 Dec 2015 CN
105210981 Jan 2016 CN
105219799 Jan 2016 CN
105238806 Jan 2016 CN
105255937 Jan 2016 CN
105274144 Jan 2016 CN
105296518 Feb 2016 CN
105296537 Feb 2016 CN
105316324 Feb 2016 CN
105316327 Feb 2016 CN
105316337 Feb 2016 CN
105331607 Feb 2016 CN
105331608 Feb 2016 CN
105331609 Feb 2016 CN
105331627 Feb 2016 CN
105400773 Mar 2016 CN
105400779 Mar 2016 CN
105400810 Mar 2016 CN
105441451 Mar 2016 CN
105462968 Apr 2016 CN
105463003 Apr 2016 CN
105463027 Apr 2016 CN
105492608 Apr 2016 CN
105492609 Apr 2016 CN
105505976 Apr 2016 CN
105505979 Apr 2016 CN
105518134 Apr 2016 CN
105518135 Apr 2016 CN
105518137 Apr 2016 CN
105518138 Apr 2016 CN
105518139 Apr 2016 CN
105518140 Apr 2016 CN
105543228 May 2016 CN
105543266 May 2016 CN
105543270 May 2016 CN
105567688 May 2016 CN
105567689 May 2016 CN
105567734 May 2016 CN
105567735 May 2016 CN
105567738 May 2016 CN
105593367 May 2016 CN
105594664 May 2016 CN
105602987 May 2016 CN
105624146 Jun 2016 CN
105624187 Jun 2016 CN
105646719 Jun 2016 CN
105647922 Jun 2016 CN
105647962 Jun 2016 CN
105647968 Jun 2016 CN
105647969 Jun 2016 CN
105671070 Jun 2016 CN
105671083 Jun 2016 CN
105695485 Jun 2016 CN
105779448 Jul 2016 CN
105779449 Jul 2016 CN
105802980 Jul 2016 CN
105821039 Aug 2016 CN
105821040 Aug 2016 CN
105821049 Aug 2016 CN
105821072 Aug 2016 CN
105821075 Aug 2016 CN
105821116 Aug 2016 CN
105838733 Aug 2016 CN
105861547 Aug 2016 CN
105861552 Aug 2016 CN
105861554 Aug 2016 CN
105886498 Aug 2016 CN
105886534 Aug 2016 CN
105886616 Aug 2016 CN
105907758 Aug 2016 CN
105907785 Aug 2016 CN
105925608 Sep 2016 CN
105950560 Sep 2016 CN
105950626 Sep 2016 CN
105950633 Sep 2016 CN
105950639 Sep 2016 CN
105985985 Oct 2016 CN
106011104 Oct 2016 CN
106011150 Oct 2016 CN
106011167 Oct 2016 CN
106011171 Oct 2016 CN
106032540 Oct 2016 CN
106047803 Oct 2016 CN
106047877 Oct 2016 CN
106047930 Oct 2016 CN
106086008 Nov 2016 CN
106086028 Nov 2016 CN
106086061 Nov 2016 CN
106086062 Nov 2016 CN
106109417 Nov 2016 CN
106119275 Nov 2016 CN
106119283 Nov 2016 CN
106148286 Nov 2016 CN
106148370 Nov 2016 CN
106148416 Nov 2016 CN
106167525 Nov 2016 CN
106167808 Nov 2016 CN
106167810 Nov 2016 CN
106167821 Nov 2016 CN
106172238 Dec 2016 CN
106190903 Dec 2016 CN
106191057 Dec 2016 CN
106191061 Dec 2016 CN
106191062 Dec 2016 CN
106191064 Dec 2016 CN
106191071 Dec 2016 CN
106191099 Dec 2016 CN
106191107 Dec 2016 CN
106191113 Dec 2016 CN
106191114 Dec 2016 CN
106191116 Dec 2016 CN
106191124 Dec 2016 CN
106222177 Dec 2016 CN
106222193 Dec 2016 CN
106222203 Dec 2016 CN
106244555 Dec 2016 CN
106244557 Dec 2016 CN
106244591 Dec 2016 CN
106244609 Dec 2016 CN
106282241 Jan 2017 CN
106318934 Jan 2017 CN
106318973 Jan 2017 CN
106350540 Jan 2017 CN
106367435 Feb 2017 CN
106399306 Feb 2017 CN
106399311 Feb 2017 CN
106399360 Feb 2017 CN
106399367 Feb 2017 CN
106399375 Feb 2017 CN
106399377 Feb 2017 CN
106434651 Feb 2017 CN
106434663 Feb 2017 CN
106434688 Feb 2017 CN
106434737 Feb 2017 CN
106434748 Feb 2017 CN
106434752 Feb 2017 CN
106434782 Feb 2017 CN
106446600 Feb 2017 CN
106479985 Mar 2017 CN
106480027 Mar 2017 CN
106480036 Mar 2017 CN
106480067 Mar 2017 CN
106480080 Mar 2017 CN
106480083 Mar 2017 CN
106480097 Mar 2017 CN
106544351 Mar 2017 CN
106544353 Mar 2017 CN
106544357 Mar 2017 CN
106554969 Apr 2017 CN
106566838 Apr 2017 CN
106701763 May 2017 CN
106701808 May 2017 CN
106701818 May 2017 CN
106701823 May 2017 CN
106701830 May 2017 CN
106754912 May 2017 CN
106755026 May 2017 CN
106755077 May 2017 CN
106755088 May 2017 CN
106755091 May 2017 CN
106755097 May 2017 CN
106755424 May 2017 CN
106801056 Jun 2017 CN
106834323 Jun 2017 CN
106834341 Jun 2017 CN
106834347 Jun 2017 CN
106845151 Jun 2017 CN
106868008 Jun 2017 CN
106868031 Jun 2017 CN
106906240 Jun 2017 CN
106906242 Jun 2017 CN
106916820 Jul 2017 CN
106916852 Jul 2017 CN
106939303 Jul 2017 CN
106947750 Jul 2017 CN
106947780 Jul 2017 CN
106957830 Jul 2017 CN
106957831 Jul 2017 CN
106957844 Jul 2017 CN
106957855 Jul 2017 CN
106957858 Jul 2017 CN
106967697 Jul 2017 CN
106967726 Jul 2017 CN
106978428 Jul 2017 CN
106987570 Jul 2017 CN
106987757 Jul 2017 CN
107012164 Aug 2017 CN
107012174 Aug 2017 CN
107012213 Aug 2017 CN
107012250 Aug 2017 CN
107022562 Aug 2017 CN
107034188 Aug 2017 CN
107034218 Aug 2017 CN
107034229 Aug 2017 CN
107043775 Aug 2017 CN
107043779 Aug 2017 CN
107043787 Aug 2017 CN
107058320 Aug 2017 CN
107058328 Aug 2017 CN
107058358 Aug 2017 CN
107058372 Aug 2017 CN
107083392 Aug 2017 CN
107099533 Aug 2017 CN
107099850 Aug 2017 CN
107119053 Sep 2017 CN
107119071 Sep 2017 CN
107129999 Sep 2017 CN
107130000 Sep 2017 CN
107142272 Sep 2017 CN
107142282 Sep 2017 CN
107177591 Sep 2017 CN
107177595 Sep 2017 CN
107177625 Sep 2017 CN
107177631 Sep 2017 CN
107190006 Sep 2017 CN
107190008 Sep 2017 CN
107217042 Sep 2017 CN
107217075 Sep 2017 CN
107227307 Oct 2017 CN
107227352 Oct 2017 CN
107236737 Oct 2017 CN
107236739 Oct 2017 CN
107236741 Oct 2017 CN
107245502 Oct 2017 CN
107254485 Oct 2017 CN
107266541 Oct 2017 CN
107267515 Oct 2017 CN
107287245 Oct 2017 CN
107298701 Oct 2017 CN
107299114 Oct 2017 CN
107304435 Oct 2017 CN
107312785 Nov 2017 CN
107312793 Nov 2017 CN
107312795 Nov 2017 CN
107312798 Nov 2017 CN
107326042 Nov 2017 CN
107326046 Nov 2017 CN
107354156 Nov 2017 CN
107354173 Nov 2017 CN
107356793 Nov 2017 CN
107362372 Nov 2017 CN
107365786 Nov 2017 CN
107365804 Nov 2017 CN
107384894 Nov 2017 CN
107384922 Nov 2017 CN
107384926 Nov 2017 CN
107400677 Nov 2017 CN
107418974 Dec 2017 CN
107435051 Dec 2017 CN
107435069 Dec 2017 CN
107446922 Dec 2017 CN
107446923 Dec 2017 CN
107446924 Dec 2017 CN
107446932 Dec 2017 CN
107446951 Dec 2017 CN
107446954 Dec 2017 CN
107460196 Dec 2017 CN
107474129 Dec 2017 CN
107475300 Dec 2017 CN
107488649 Dec 2017 CN
107502608 Dec 2017 CN
107502618 Dec 2017 CN
107513531 Dec 2017 CN
107519492 Dec 2017 CN
107523567 Dec 2017 CN
107523583 Dec 2017 CN
107541525 Jan 2018 CN
107557373 Jan 2018 CN
107557378 Jan 2018 CN
107557381 Jan 2018 CN
107557390 Jan 2018 CN
107557393 Jan 2018 CN
107557394 Jan 2018 CN
107557455 Jan 2018 CN
107574179 Jan 2018 CN
107586777 Jan 2018 CN
107586779 Jan 2018 CN
107604003 Jan 2018 CN
107619829 Jan 2018 CN
107619837 Jan 2018 CN
107630006 Jan 2018 CN
107630041 Jan 2018 CN
107630042 Jan 2018 CN
107630043 Jan 2018 CN
107641631 Jan 2018 CN
107653256 Feb 2018 CN
107686848 Feb 2018 CN
206970581 Feb 2018 CN
107760652 Mar 2018 CN
107760663 Mar 2018 CN
107760684 Mar 2018 CN
107760715 Mar 2018 CN
107784200 Mar 2018 CN
107794272 Mar 2018 CN
107794276 Mar 2018 CN
107815463 Mar 2018 CN
107828738 Mar 2018 CN
107828794 Mar 2018 CN
107828826 Mar 2018 CN
107828874 Mar 2018 CN
107858346 Mar 2018 CN
107858373 Mar 2018 CN
107880132 Apr 2018 CN
107881184 Apr 2018 CN
107893074 Apr 2018 CN
107893075 Apr 2018 CN
107893076 Apr 2018 CN
107893080 Apr 2018 CN
107893086 Apr 2018 CN
107904261 Apr 2018 CN
107937427 Apr 2018 CN
107937432 Apr 2018 CN
107937501 Apr 2018 CN
107974466 May 2018 CN
107988229 May 2018 CN
107988246 May 2018 CN
107988256 May 2018 CN
107988268 May 2018 CN
108018316 May 2018 CN
108034656 May 2018 CN
108048466 May 2018 CN
108102940 Jun 2018 CN
108103092 Jun 2018 CN
108103098 Jun 2018 CN
108103586 Jun 2018 CN
108148835 Jun 2018 CN
108148837 Jun 2018 CN
108148873 Jun 2018 CN
108192956 Jun 2018 CN
108251423 Jul 2018 CN
108251451 Jul 2018 CN
108251452 Jul 2018 CN
108342480 Jul 2018 CN
108359691 Aug 2018 CN
108359712 Aug 2018 CN
108384784 Aug 2018 CN
108396027 Aug 2018 CN
108410877 Aug 2018 CN
108410906 Aug 2018 CN
108410907 Aug 2018 CN
108410911 Aug 2018 CN
108424931 Aug 2018 CN
108441519 Aug 2018 CN
108441520 Aug 2018 CN
108486108 Sep 2018 CN
108486111 Sep 2018 CN
108486145 Sep 2018 CN
108486146 Sep 2018 CN
108486154 Sep 2018 CN
108486159 Sep 2018 CN
108486234 Sep 2018 CN
108504657 Sep 2018 CN
108504685 Sep 2018 CN
108504693 Sep 2018 CN
108546712 Sep 2018 CN
108546717 Sep 2018 CN
108546718 Sep 2018 CN
108559730 Sep 2018 CN
108559732 Sep 2018 CN
108559745 Sep 2018 CN
108559760 Sep 2018 CN
108570479 Sep 2018 CN
108588071 Sep 2018 CN
108588123 Sep 2018 CN
108588128 Sep 2018 CN
108588182 Sep 2018 CN
108610399 Oct 2018 CN
108611364 Oct 2018 CN
108624622 Oct 2018 CN
108642053 Oct 2018 CN
108642055 Oct 2018 CN
108642077 Oct 2018 CN
108642078 Oct 2018 CN
108642090 Oct 2018 CN
108690844 Oct 2018 CN
108707604 Oct 2018 CN
108707620 Oct 2018 CN
108707621 Oct 2018 CN
108707628 Oct 2018 CN
108707629 Oct 2018 CN
108715850 Oct 2018 CN
108728476 Nov 2018 CN
108728486 Nov 2018 CN
108753772 Nov 2018 CN
108753783 Nov 2018 CN
108753813 Nov 2018 CN
108753817 Nov 2018 CN
108753832 Nov 2018 CN
108753835 Nov 2018 CN
108753836 Nov 2018 CN
108795902 Nov 2018 CN
108822217 Nov 2018 CN
108823248 Nov 2018 CN
108823249 Nov 2018 CN
108823291 Nov 2018 CN
108841845 Nov 2018 CN
108853133 Nov 2018 CN
108866093 Nov 2018 CN
108893529 Nov 2018 CN
108913664 Nov 2018 CN
108913691 Nov 2018 CN
108913714 Nov 2018 CN
108913717 Nov 2018 CN
109 517 841 Mar 2019 CN
0264166 Apr 1988 EP
2604255 Jun 2013 EP
2840140 Feb 2015 EP
2966170 Jan 2016 EP
3009511 Apr 2016 EP
3031921 Jun 2016 EP
3045537 Jul 2016 EP
3 115 457 Jan 2017 EP
3144390 Mar 2017 EP
3199632 Aug 2017 EP
3216867 Sep 2017 EP
3252160 Dec 2017 EP
3450553 Dec 2019 EP
2740248 Feb 2020 ES
2528177 Jan 2016 GB
2 531 454 Apr 2016 GB
2542653 Mar 2017 GB
1208045 Feb 2016 HK
2007-501626 Feb 2007 JP
2008-515405 May 2008 JP
2010-033344 Feb 2010 JP
2010-539929 Dec 2010 JP
2011-081011 Apr 2011 JP
2011-523353 Aug 2011 JP
2012-525146 Oct 2012 JP
2012-210172 Nov 2012 JP
2012-531909 Dec 2012 JP
2015-523856 Aug 2015 JP
2015-532654 Nov 2015 JP
2016-534132 Nov 2016 JP
101584933 Jan 2016 KR
20160133380 Nov 2016 KR
20170037025 Apr 2017 KR
20170037028 Apr 2017 KR
101748575 Jun 2017 KR
20170128137 Nov 2017 KR
2018-0022465 Mar 2018 KR
2016104674 Aug 2017 RU
2634395 Oct 2017 RU
2652899 May 2018 RU
2015128057 Mar 2019 RU
2015128098 Mar 2019 RU
2687451 May 2019 RU
2019112514 Jun 2019 RU
2019127300 Sep 2019 RU
2701850 Oct 2019 RU
10201707569 Oct 2017 SG
10201710486 Jan 2018 SG
10201710487 Jan 2018 SG
10201710488 Jan 2018 SG
I608100 Dec 2017 TW
2018-29773 Aug 2018 TW
WO 9002809 Mar 1990 WO
WO 9116024 Oct 1991 WO
WO 9117271 Nov 1991 WO
WO 9117424 Nov 1991 WO
WO 9206188 Apr 1992 WO
WO 9206200 Apr 1992 WO
WO 9324641 Dec 1993 WO
WO 9418316 Aug 1994 WO
WO 94026877 Nov 1994 WO
WO 9604403 Feb 1996 WO
WO 9610640 Apr 1996 WO
WO 9832845 Jul 1998 WO
WO 2001036452 May 2001 WO
WO 2001038547 May 2001 WO
WO 2002059296 Aug 2002 WO
WO 2002068676 Sep 2002 WO
WO 2002103028 Dec 2002 WO
WO 2004007684 Jan 2004 WO
WO 2005014791 Feb 2005 WO
WO 2005019415 Mar 2005 WO
WO 2006002547 Jan 2006 WO
WO 2006042112 Apr 2006 WO
WO 2007025097 Mar 2007 WO
07066923 Jun 2007 WO
WO 2007136815 Nov 2007 WO
WO 2007143574 Dec 2007 WO
08005529 Jan 2008 WO
WO 2008108989 Sep 2008 WO
WO 2009098290 Aug 2009 WO
WO 2009134808 Nov 2009 WO
WO 2010011961 Jan 2010 WO
WO 2010028347 Mar 2010 WO
WO 2010054108 May 2010 WO
WO 2010054154 May 2010 WO
WO 2010068289 Jun 2010 WO
WO 2010075424 Jul 2010 WO
WO 2010102257 Sep 2010 WO
WO 2010129019 Nov 2010 WO
WO 2010129023 Nov 2010 WO
WO 2010132092 Nov 2010 WO
WO 2010144150 Dec 2010 WO
WO 2011002503 Jan 2011 WO
WO 2011017293 Feb 2011 WO
WO 2011053868 May 2011 WO
WO 2011053982 May 2011 WO
WO 2011068810 Jun 2011 WO
WO 2011075627 Jun 2011 WO
WO 2011091311 Jul 2011 WO
WO 2011091396 Jul 2011 WO
WO 2011109031 Sep 2011 WO
WO 2011143124 Nov 2011 WO
WO 2011147590 Dec 2011 WO
WO 2011159369 Dec 2011 WO
WO 2012054726 Apr 2012 WO
WO 2012065043 May 2012 WO
WO 2012088381 Jun 2012 WO
WO 2012125445 Sep 2012 WO
WO 2012138927 Oct 2012 WO
WO 2012149470 Nov 2012 WO
WO 2012158985 Nov 2012 WO
WO 2012158986 Nov 2012 WO
WO 2012164565 Dec 2012 WO
WO 2012170930 Dec 2012 WO
WO 2013012674 Jan 2013 WO
WO 2013013105 Jan 2013 WO
WO 2013039857 Mar 2013 WO
WO 2013039861 Mar 2013 WO
WO 2013045632 Apr 2013 WO
WO 2013047844 Apr 2013 WO
WO 2013066438 May 2013 WO
WO 2013086441 Jun 2013 WO
WO 2013086444 Jun 2013 WO
WO 2013098244 Jul 2013 WO
WO 2013119602 Aug 2013 WO
WO 2013126794 Aug 2013 WO
WO 2013130824 Sep 2013 WO
WO 2013141680 Sep 2013 WO
WO 2013142578 Sep 2013 WO
WO 2013152359 Oct 2013 WO
WO 2013160230 Oct 2013 WO
WO 2013166315 Nov 2013 WO
WO 2013169398 Nov 2013 WO
WO 2013169802 Nov 2013 WO
WO 2013176772 Nov 2013 WO
WO 2013176915 Nov 2013 WO
WO 2013176916 Nov 2013 WO
WO 2013181440 Dec 2013 WO
WO 2013186754 Dec 2013 WO
WO 2013188037 Dec 2013 WO
WO 2013188522 Dec 2013 WO
WO 2013188638 Dec 2013 WO
WO 2013192278 Dec 2013 WO
WO 2013142378 Jan 2014 WO
WO 2014004336 Jan 2014 WO
WO 2014005042 Jan 2014 WO
WO 2014011237 Jan 2014 WO
WO 2014011901 Jan 2014 WO
WO 2014018423 Jan 2014 WO
WO 2014020608 Feb 2014 WO
WO 2014022120 Feb 2014 WO
WO 2014022702 Feb 2014 WO
WO 2014036219 Mar 2014 WO
WO 2014039513 Mar 2014 WO
WO 2014039523 Mar 2014 WO
WO 2014039585 Mar 2014 WO
WO 2014039684 Mar 2014 WO
WO 2014039692 Mar 2014 WO
WO 2014039702 Mar 2014 WO
WO 2014039872 Mar 2014 WO
WO 2014039970 Mar 2014 WO
WO 2014041327 Mar 2014 WO
WO 2014043143 Mar 2014 WO
WO 2014047103 Mar 2014 WO
WO 2014055782 Apr 2014 WO
WO 2014059173 Apr 2014 WO
WO 2014059255 Apr 2014 WO
WO 2014065596 May 2014 WO
WO 2014066505 May 2014 WO
WO 2014068346 May 2014 WO
WO 2014070887 May 2014 WO
WO 2014071006 May 2014 WO
WO 2014071219 May 2014 WO
WO 2014071235 May 2014 WO
WO 2014072941 May 2014 WO
WO 2014081729 May 2014 WO
WO 2014081730 May 2014 WO
WO 2014081855 May 2014 WO
WO 2014082644 Jun 2014 WO
WO 2014085261 Jun 2014 WO
WO 2014085593 Jun 2014 WO
WO 2014085830 Jun 2014 WO
WO 2014089212 Jun 2014 WO
WO 2014089290 Jun 2014 WO
WO 2014089348 Jun 2014 WO
WO 2014089513 Jun 2014 WO
WO 2014089533 Jun 2014 WO
WO 2014089541 Jun 2014 WO
WO 2014093479 Jun 2014 WO
WO 2014093595 Jun 2014 WO
WO 2014093622 Jun 2014 WO
WO 2014093635 Jun 2014 WO
WO 2014093655 Jun 2014 WO
WO 2014093661 Jun 2014 WO
WO 2014093694 Jun 2014 WO
WO 2014093701 Jun 2014 WO
WO 2014093709 Jun 2014 WO
WO 2014093712 Jun 2014 WO
WO 2014093718 Jun 2014 WO
WO 2014093736 Jun 2014 WO
WO 2014093768 Jun 2014 WO
WO 2014093852 Jun 2014 WO
WO 2014096972 Jun 2014 WO
WO 2014099744 Jun 2014 WO
WO 2014099750 Jun 2014 WO
WO 2014104878 Jul 2014 WO
WO 2014110006 Jul 2014 WO
WO 2014110552 Jul 2014 WO
WO 2014113493 Jul 2014 WO
WO 2014123967 Aug 2014 WO
WO 2014124226 Aug 2014 WO
WO 2014125668 Aug 2014 WO
WO 2014127287 Aug 2014 WO
WO 2014128324 Aug 2014 WO
WO 2014128659 Aug 2014 WO
WO 2014130706 Aug 2014 WO
WO 2014130955 Aug 2014 WO
WO 2014131833 Sep 2014 WO
WO 2014138379 Sep 2014 WO
WO 2014143381 Sep 2014 WO
WO 2014144094 Sep 2014 WO
WO 2014144155 Sep 2014 WO
WO 2014144288 Sep 2014 WO
WO 2014144592 Sep 2014 WO
WO 2014144761 Sep 2014 WO
WO 2014144951 Sep 2014 WO
WO 2014145599 Sep 2014 WO
WO 2014145736 Sep 2014 WO
WO 2014150624 Sep 2014 WO
WO 2014152432 Sep 2014 WO
WO 2014152940 Sep 2014 WO
WO 2014153118 Sep 2014 WO
WO 2014153470 Sep 2014 WO
WO 2014158593 Oct 2014 WO
WO 2014161821 Oct 2014 WO
WO 2014164466 Oct 2014 WO
WO 2014165177 Oct 2014 WO
WO 2014165349 Oct 2014 WO
WO 2014165612 Oct 2014 WO
WO 2014165707 Oct 2014 WO
WO 2014165825 Oct 2014 WO
WO 2014172458 Oct 2014 WO
WO 2014172470 Oct 2014 WO
WO 2014172489 Oct 2014 WO
WO 2014173955 Oct 2014 WO
WO 2014182700 Nov 2014 WO
WO 2014183071 Nov 2014 WO
WO 2014184143 Nov 2014 WO
WO 2014184741 Nov 2014 WO
WO 2014184744 Nov 2014 WO
WO 2014186585 Nov 2014 WO
WO 2014186686 Nov 2014 WO
WO 2014190181 Nov 2014 WO
WO 2014191128 Dec 2014 WO
WO 2014191518 Dec 2014 WO
WO 2014191521 Dec 2014 WO
WO 2014191525 Dec 2014 WO
WO 2014191527 Dec 2014 WO
WO 2014193583 Dec 2014 WO
WO 2014194190 Dec 2014 WO
WO 2014197568 Dec 2014 WO
WO 2014197748 Dec 2014 WO
WO 2014199358 Dec 2014 WO
WO 2014200659 Dec 2014 WO
WO 2014201015 Dec 2014 WO
WO 2014204578 Dec 2014 WO
WO 2014204723 Dec 2014 WO
WO 2014204724 Dec 2014 WO
WO 2014204725 Dec 2014 WO
WO 2014204726 Dec 2014 WO
WO 2014204727 Dec 2014 WO
WO 2014204728 Dec 2014 WO
WO 2014204729 Dec 2014 WO
WO 2014205192 Dec 2014 WO
WO 2014207043 Dec 2014 WO
WO 2015002780 Jan 2015 WO
WO 2015004241 Jan 2015 WO
WO 2015006290 Jan 2015 WO
WO 2015006294 Jan 2015 WO
WO 2015006437 Jan 2015 WO
WO 2015006498 Jan 2015 WO
WO 2015006747 Jan 2015 WO
WO 2015007194 Jan 2015 WO
WO 2015010114 Jan 2015 WO
WO 2015011483 Jan 2015 WO
WO 2015013583 Jan 2015 WO
WO 2015017866 Feb 2015 WO
WO 2015018503 Feb 2015 WO
WO 2015021353 Feb 2015 WO
WO 2015021426 Feb 2015 WO
WO 2015021990 Feb 2015 WO
WO 2015024017 Feb 2015 WO
WO 2015024986 Feb 2015 WO
WO 2015026883 Feb 2015 WO
WO 2015026885 Feb 2015 WO
WO 2015026886 Feb 2015 WO
WO 2015026887 Feb 2015 WO
WO 2015027134 Feb 2015 WO
WO 2015028969 Mar 2015 WO
WO 2015030881 Mar 2015 WO
WO 2015031619 Mar 2015 WO
WO 2015031775 Mar 2015 WO
WO 2015032494 Mar 2015 WO
WO 2015033293 Mar 2015 WO
WO 2015034872 Mar 2015 WO
WO 2015034885 Mar 2015 WO
WO 2015035136 Mar 2015 WO
WO 2015035139 Mar 2015 WO
WO 2015035162 Mar 2015 WO
WO 2015040075 Mar 2015 WO
WO 2015040402 Mar 2015 WO
WO 2015042585 Mar 2015 WO
WO 2015048577 Apr 2015 WO
WO 2015048690 Apr 2015 WO
WO 2015048707 Apr 2015 WO
WO 2015048801 Apr 2015 WO
WO 2015049897 Apr 2015 WO
WO 2015051191 Apr 2015 WO
WO 2015052133 Apr 2015 WO
WO 2015052231 Apr 2015 WO
WO 2015052335 Apr 2015 WO
WO 2015053995 Apr 2015 WO
WO 2015054253 Apr 2015 WO
WO 2015054315 Apr 2015 WO
WO 2015057671 Apr 2015 WO
WO 2015057834 Apr 2015 WO
WO 2015057852 Apr 2015 WO
WO 2015057976 Apr 2015 WO
WO 2015057980 Apr 2015 WO
WO 2015059265 Apr 2015 WO
WO 2015065964 May 2015 WO
WO 2015066119 May 2015 WO
WO 2015066634 May 2015 WO
WO 2015066636 May 2015 WO
WO 2015066637 May 2015 WO
WO 2015066638 May 2015 WO
WO 2015066643 May 2015 WO
WO 2015069682 May 2015 WO
WO 2015070083 May 2015 WO
WO 2015070193 May 2015 WO
WO 2015070212 May 2015 WO
WO 2015071474 May 2015 WO
WO 2015073683 May 2015 WO
WO 2015073867 May 2015 WO
WO 2015073990 May 2015 WO
WO 2015075056 May 2015 WO
WO 2015075154 May 2015 WO
WO 2015075175 May 2015 WO
WO 2015075195 May 2015 WO
WO 2015075557 May 2015 WO
WO 2015077058 May 2015 WO
WO 2015077290 May 2015 WO
WO 2015077318 May 2015 WO
WO 2015079056 Jun 2015 WO
WO 2015079057 Jun 2015 WO
WO 2015086795 Jun 2015 WO
WO 2015086798 Jun 2015 WO
WO 2015088643 Jun 2015 WO
WO 2015089046 Jun 2015 WO
WO 2015089077 Jun 2015 WO
WO 2015089277 Jun 2015 WO
WO 2015089351 Jun 2015 WO
WO 2015089354 Jun 2015 WO
WO 2015089364 Jun 2015 WO
WO 2015089406 Jun 2015 WO
WO 2015089419 Jun 2015 WO
WO 2015089427 Jun 2015 WO
WO 2015089462 Jun 2015 WO
WO 2015089465 Jun 2015 WO
WO 2015089473 Jun 2015 WO
WO 2015089486 Jun 2015 WO
WO 2015095804 Jun 2015 WO
WO 2015099850 Jul 2015 WO
WO 2015100929 Jul 2015 WO
WO 2015103057 Jul 2015 WO
WO 2015103153 Jul 2015 WO
WO 2015105928 Jul 2015 WO
WO 2015108993 Jul 2015 WO
WO 2015109752 Jul 2015 WO
WO 2015110474 Jul 2015 WO
WO 2015112790 Jul 2015 WO
WO 2015112896 Jul 2015 WO
WO 2015113063 Jul 2015 WO
WO 2015114365 Aug 2015 WO
WO 2015115903 Aug 2015 WO
WO 2015116686 Aug 2015 WO
WO 2015116969 Aug 2015 WO
WO 2015117021 Aug 2015 WO
WO 2015117041 Aug 2015 WO
WO 2015117081 Aug 2015 WO
WO 2015118156 Aug 2015 WO
WO 2015119941 Aug 2015 WO
WO 2015121454 Aug 2015 WO
WO 2015122967 Aug 2015 WO
WO 2015123339 Aug 2015 WO
WO 2015124715 Aug 2015 WO
WO 2015124718 Aug 2015 WO
WO 2015126927 Aug 2015 WO
WO 2015127428 Aug 2015 WO
WO 2015127439 Aug 2015 WO
WO 2015129686 Sep 2015 WO
WO 2015131101 Sep 2015 WO
WO 2015133554 Sep 2015 WO
WO 2015134121 Sep 2015 WO
WO 2015134812 Sep 2015 WO
WO 2015136001 Sep 2015 WO
WO 2015138510 Sep 2015 WO
WO 2015138739 Sep 2015 WO
WO 2015138855 Sep 2015 WO
WO 2015138870 Sep 2015 WO
WO 2015139008 Sep 2015 WO
WO 2015139139 Sep 2015 WO
WO 2015143046 Sep 2015 WO
WO 2015143177 Sep 2015 WO
WO 2015145417 Oct 2015 WO
WO 2015148431 Oct 2015 WO
WO 2015148670 Oct 2015 WO
WO 2015148680 Oct 2015 WO
WO 2015148760 Oct 2015 WO
WO 2015148761 Oct 2015 WO
WO 2015148860 Oct 2015 WO
WO 2015148863 Oct 2015 WO
WO 2015153760 Oct 2015 WO
WO 2015153780 Oct 2015 WO
WO 2015153789 Oct 2015 WO
WO 2015153791 Oct 2015 WO
WO 2015153889 Oct 2015 WO
WO 2015153940 Oct 2015 WO
WO 2015155341 Oct 2015 WO
WO 2015155686 Oct 2015 WO
WO 2015157070 Oct 2015 WO
WO 2015157534 Oct 2015 WO
WO 2015159068 Oct 2015 WO
WO 2015159086 Oct 2015 WO
WO 2015159087 Oct 2015 WO
WO 2015160683 Oct 2015 WO
WO 2015161276 Oct 2015 WO
WO 2015163733 Oct 2015 WO
WO 2015164740 Oct 2015 WO
WO 2015164748 Oct 2015 WO
WO 2015165274 Nov 2015 WO
WO 2015165275 Nov 2015 WO
WO 2015165276 Nov 2015 WO
WO 2015166272 Nov 2015 WO
WO 2015167766 Nov 2015 WO
WO 2015167956 Nov 2015 WO
WO 2015168125 Nov 2015 WO
WO 2015168158 Nov 2015 WO
WO 2015168404 Nov 2015 WO
WO 2015168547 Nov 2015 WO
WO 2015168800 Nov 2015 WO
WO 2015171603 Nov 2015 WO
WO 2015171894 Nov 2015 WO
WO 2015171932 Nov 2015 WO
WO 2015172128 Nov 2015 WO
WO 2015173436 Nov 2015 WO
WO 2015175642 Nov 2015 WO
WO 2015179540 Nov 2015 WO
WO 2015183025 Dec 2015 WO
WO 2015183026 Dec 2015 WO
WO 2015183885 Dec 2015 WO
WO 2015184259 Dec 2015 WO
WO 2015184262 Dec 2015 WO
WO 2015184268 Dec 2015 WO
WO 2015188056 Dec 2015 WO
WO 2015188065 Dec 2015 WO
WO 2015188094 Dec 2015 WO
WO 2015188109 Dec 2015 WO
WO 2015188132 Dec 2015 WO
WO 2015188135 Dec 2015 WO
WO 2015188191 Dec 2015 WO
WO 2015189693 Dec 2015 WO
WO 2015191693 Dec 2015 WO
WO 2015191899 Dec 2015 WO
WO 2015191911 Dec 2015 WO
WO 2015193858 Dec 2015 WO
WO 2015195547 Dec 2015 WO
WO 2015195621 Dec 2015 WO
WO 2015195798 Dec 2015 WO
WO 2015198020 Dec 2015 WO
WO 2015200334 Dec 2015 WO
WO 2015200378 Dec 2015 WO
WO 2015200555 Dec 2015 WO
WO 2015200805 Dec 2015 WO
WO 016007347 Jan 2016 WO
WO 2016001978 Jan 2016 WO
WO 2016004010 Jan 2016 WO
WO 2016004318 Jan 2016 WO
WO 2016007604 Jan 2016 WO
WO 2016007948 Jan 2016 WO
WO 2016011080 Jan 2016 WO
WO 2016011210 Jan 2016 WO
WO 2016011428 Jan 2016 WO
WO 2016012544 Jan 2016 WO
WO 2016012552 Jan 2016 WO
WO 2016014409 Jan 2016 WO
WO 2016014565 Jan 2016 WO
WO 2016014794 Jan 2016 WO
WO 2016014837 Jan 2016 WO
WO 2016016119 Feb 2016 WO
WO 2016016358 Feb 2016 WO
WO 2016019144 Feb 2016 WO
WO 2016020399 Feb 2016 WO
WO 2016021972 Feb 2016 WO
WO 2016021973 Feb 2016 WO
WO 2016022363 Feb 2016 WO
WO 2016022866 Feb 2016 WO
WO 2016022931 Feb 2016 WO
WO 2016025131 Feb 2016 WO
WO 2016025469 Feb 2016 WO
WO 2016025759 Feb 2016 WO
WO 2016026444 Feb 2016 WO
WO 2016028682 Feb 2016 WO
WO 2016028843 Feb 2016 WO
WO 2016028887 Feb 2016 WO
WO 2016033088 Mar 2016 WO
WO 2016033230 Mar 2016 WO
WO 2016033246 Mar 2016 WO
WO 2016033298 Mar 2016 WO
WO 2016035044 Mar 2016 WO
WO 2016036754 Mar 2016 WO
WO 2016037157 Mar 2016 WO
WO 2016040030 Mar 2016 WO
WO 2016040594 Mar 2016 WO
WO 2016044182 Mar 2016 WO
WO 2016044416 Mar 2016 WO
WO 2016046635 Mar 2016 WO
WO 2016049024 Mar 2016 WO
WO 2016049163 Mar 2016 WO
WO 2016049230 Mar 2016 WO
WO 2016049251 Mar 2016 WO
WO 2016049258 Mar 2016 WO
WO 2016053397 Apr 2016 WO
WO 2016054326 Apr 2016 WO
WO 2016057061 Apr 2016 WO
WO 2016057821 Apr 2016 WO
WO 2016057835 Apr 2016 WO
WO 2016057850 Apr 2016 WO
WO 2016057951 Apr 2016 WO
WO 2016057961 Apr 2016 WO
WO 2016061073 Apr 2016 WO
WO 2016061374 Apr 2016 WO
WO 2016061481 Apr 2016 WO
WO 2016061523 Apr 2016 WO
WO 2016064894 Apr 2016 WO
WO 2016065364 Apr 2016 WO
WO 2016069282 May 2016 WO
WO 2016069283 May 2016 WO
WO 2016069591 May 2016 WO
WO 2016069774 May 2016 WO
WO 2016069910 May 2016 WO
WO 2016069912 May 2016 WO
WO 2016070037 May 2016 WO
WO 2016070070 May 2016 WO
WO 2016070129 May 2016 WO
WO 2016072399 May 2016 WO
WO 2016072936 May 2016 WO
WO 2016073433 May 2016 WO
WO 2016073559 May 2016 WO
WO 2016073990 May 2016 WO
WO 2016075662 May 2016 WO
WO 2016076672 May 2016 WO
WO 2016077273 May 2016 WO
WO 2016077350 May 2016 WO
WO 2016080097 May 2016 WO
WO 2016080795 May 2016 WO
WO 2016081923 May 2016 WO
WO 2016081924 May 2016 WO
WO 2016082135 Jun 2016 WO
WO 2016083811 Jun 2016 WO
WO 2016084084 Jun 2016 WO
WO 2016084088 Jun 2016 WO
WO 2016086177 Jun 2016 WO
WO 2016089433 Jun 2016 WO
WO 2016089866 Jun 2016 WO
WO 2016089883 Jun 2016 WO
WO 2016090385 Jun 2016 WO
WO 2016094679 Jun 2016 WO
WO 2016094845 Jun 2016 WO
WO 2016094867 Jun 2016 WO
WO 2016094872 Jun 2016 WO
WO 2016094874 Jun 2016 WO
WO 2016094880 Jun 2016 WO
WO 2016094888 Jun 2016 WO
WO 2016097212 Jun 2016 WO
WO 2016097231 Jun 2016 WO
WO 2016097751 Jun 2016 WO
WO 2016099887 Jun 2016 WO
WO 2016100272 Jun 2016 WO
WO 2016100389 Jun 2016 WO
WO 2016100568 Jun 2016 WO
WO 2016100571 Jun 2016 WO
WO 2016100951 Jun 2016 WO
WO 2016100955 Jun 2016 WO
WO 2016100974 Jun 2016 WO
WO 2016103233 Jun 2016 WO
WO 2016104716 Jun 2016 WO
WO 2016106236 Jun 2016 WO
WO 2016106239 Jun 2016 WO
WO 2016106244 Jun 2016 WO
WO 2016106338 Jun 2016 WO
WO 2016108926 Jul 2016 WO
WO 2016109255 Jul 2016 WO
WO 2016109840 Jul 2016 WO
WO 2016110214 Jul 2016 WO
WO 2016110453 Jul 2016 WO
WO 2016110511 Jul 2016 WO
WO 2016110512 Jul 2016 WO
WO 2016111546 Jul 2016 WO
WO 2016112242 Jul 2016 WO
WO 2016112351 Jul 2016 WO
WO 2016112963 Jul 2016 WO
WO 2016113357 Jul 2016 WO
WO 2016114972 Jul 2016 WO
WO 2016115179 Jul 2016 WO
WO 2016115326 Jul 2016 WO
WO 2016115355 Jul 2016 WO
WO 2016116032 Jul 2016 WO
WO 2016120480 Aug 2016 WO
WO 2016123071 Aug 2016 WO
WO 2016123230 Aug 2016 WO
WO 2016123243 Aug 2016 WO
WO 2016123578 Aug 2016 WO
WO 2016126747 Aug 2016 WO
WO 2016130600 Aug 2016 WO
WO 2016130697 Aug 2016 WO
WO 2016131009 Aug 2016 WO
WO 2016132122 Aug 2016 WO
WO 2016133165 Aug 2016 WO
WO 2016135507 Sep 2016 WO
WO 2016135557 Sep 2016 WO
WO 2016135558 Sep 2016 WO
WO 2016135559 Sep 2016 WO
WO 2016137774 Sep 2016 WO
WO 2016137949 Sep 2016 WO
WO 2016141224 Sep 2016 WO
WO 2016141893 Sep 2016 WO
WO 2016142719 Sep 2016 WO
WO 2016145150 Sep 2016 WO
WO 2016148994 Sep 2016 WO
WO 2016149484 Sep 2016 WO
WO 2016149547 Sep 2016 WO
WO 2016150336 Sep 2016 WO
WO 2016150855 Sep 2016 WO
WO 2016154016 Sep 2016 WO
WO 2016154579 Sep 2016 WO
WO 2016154596 Sep 2016 WO
WO 2016155482 Oct 2016 WO
WO 2016161004 Oct 2016 WO
WO 2016161207 Oct 2016 WO
WO 2016161260 Oct 2016 WO
WO 2016161380 Oct 2016 WO
WO 2016161446 Oct 2016 WO
WO 2016164356 Oct 2016 WO
WO 2016164797 Oct 2016 WO
WO 2016166340 Oct 2016 WO
WO 2016167300 Oct 2016 WO
WO 2016168631 Oct 2016 WO
WO 2016170484 Oct 2016 WO
WO 2016172359 Oct 2016 WO
WO 2016172727 Oct 2016 WO
WO 2016174056 Nov 2016 WO
WO 2016174151 Nov 2016 WO
WO 2016174250 Nov 2016 WO
WO 2016176191 Nov 2016 WO
WO 2016176404 Nov 2016 WO
WO 2016176690 Nov 2016 WO
WO 2016177682 Nov 2016 WO
WO 2016178207 Nov 2016 WO
WO 2016179038 Nov 2016 WO
WO 2016179112 Nov 2016 WO
WO 2016181357 Nov 2016 WO
WO 2016182893 Nov 2016 WO
WO 2016182917 Nov 2016 WO
WO 2016182959 Nov 2016 WO
WO 2016183236 Nov 2016 WO
WO 2016183298 Nov 2016 WO
WO 2016183345 Nov 2016 WO
WO 2016183402 Nov 2016 WO
WO 2016183438 Nov 2016 WO
WO 2016183448 Nov 2016 WO
WO 2016184955 Nov 2016 WO
WO 2016184989 Nov 2016 WO
WO 2016185411 Nov 2016 WO
WO 2016186745 Nov 2016 WO
WO 2016186772 Nov 2016 WO
WO 2016186946 Nov 2016 WO
WO 2016186953 Nov 2016 WO
WO 2016187717 Dec 2016 WO
WO 2016187904 Dec 2016 WO
WO 2016191684 Dec 2016 WO
WO 2016191869 Dec 2016 WO
WO 2016196273 Dec 2016 WO
WO 2016196282 Dec 2016 WO
WO 2016196308 Dec 2016 WO
WO 2016196361 Dec 2016 WO
WO 2016196499 Dec 2016 WO
WO 2016196539 Dec 2016 WO
WO 2016196655 Dec 2016 WO
WO 2016196805 Dec 2016 WO
WO 2016196887 Dec 2016 WO
WO 2016197132 Dec 2016 WO
WO 2016197133 Dec 2016 WO
WO 2016197354 Dec 2016 WO
WO 2016197355 Dec 2016 WO
WO 2016197356 Dec 2016 WO
WO 2016197357 Dec 2016 WO
WO 2016197358 Dec 2016 WO
WO 2016197359 Dec 2016 WO
WO 2016197360 Dec 2016 WO
WO 2016197361 Dec 2016 WO
WO 2016197362 Dec 2016 WO
WO 2016198361 Dec 2016 WO
WO 2016198500 Dec 2016 WO
WO 2016200263 Dec 2016 WO
WO 2016201047 Dec 2016 WO
WO 2016201138 Dec 2016 WO
WO 2016201152 Dec 2016 WO
WO 2016201153 Dec 2016 WO
WO 2016201155 Dec 2016 WO
WO 2016205276 Dec 2016 WO
WO 2016205613 Dec 2016 WO
WO 2016205623 Dec 2016 WO
WO 2016205680 Dec 2016 WO
WO 2016205688 Dec 2016 WO
WO 2016205703 Dec 2016 WO
WO 2016205711 Dec 2016 WO
WO 2016205728 Dec 2016 WO
WO 2016205745 Dec 2016 WO
WO 2016205749 Dec 2016 WO
WO 2016205759 Dec 2016 WO
WO 2016205764 Dec 2016 WO
WO 2017001572 Jan 2017 WO
WO 2017001988 Jan 2017 WO
WO 2017004261 Jan 2017 WO
WO 2017004279 Jan 2017 WO
WO 2017004616 Jan 2017 WO
WO 2017005807 Jan 2017 WO
WO 2017009399 Jan 2017 WO
WO 2017010556 Jan 2017 WO
WO 2017011519 Jan 2017 WO
WO 2017011721 Jan 2017 WO
WO 2017011804 Jan 2017 WO
WO 2017015015 Jan 2017 WO
WO 2017015101 Jan 2017 WO
WO 2017015545 Jan 2017 WO
WO 2017015567 Jan 2017 WO
WO 2017015637 Jan 2017 WO
WO 2017017016 Feb 2017 WO
WO 2017019867 Feb 2017 WO
WO 2017019895 Feb 2017 WO
WO 2017023803 Feb 2017 WO
WO 2017023974 Feb 2017 WO
WO 2017024047 Feb 2017 WO
WO 2017024319 Feb 2017 WO
WO 2017024343 Feb 2017 WO
WO 2017024602 Feb 2017 WO
WO 2017025323 Feb 2017 WO
WO 2017027423 Feb 2017 WO
WO 2017028768 Feb 2017 WO
WO 2017029664 Feb 2017 WO
WO 2017031360 Feb 2017 WO
WO 2017031483 Feb 2017 WO
WO 2017035416 Mar 2017 WO
WO 2017040348 Mar 2017 WO
WO 2017040511 Mar 2017 WO
WO 2017040709 Mar 2017 WO
WO 2017040786 Mar 2017 WO
WO 2017040793 Mar 2017 WO
WO 2017040813 Mar 2017 WO
WO 2017043573 Mar 2017 WO
WO 2017043656 Mar 2017 WO
WO 2017044419 Mar 2017 WO
WO 2017044776 Mar 2017 WO
WO 2017044857 Mar 2017 WO
WO 2017048390 Mar 2017 WO
WO 2017049129 Mar 2017 WO
WO 2017050963 Mar 2017 WO
WO 2017053312 Mar 2017 WO
WO 2017053431 Mar 2017 WO
WO 2017053713 Mar 2017 WO
WO 2017053729 Mar 2017 WO
WO 2017053753 Mar 2017 WO
WO 2017053762 Mar 2017 WO
WO 2017053879 Mar 2017 WO
WO 2017054721 Apr 2017 WO
WO 2017058658 Apr 2017 WO
WO 2017059241 Apr 2017 WO
WO 2017062605 Apr 2017 WO
WO 2017062723 Apr 2017 WO
WO 2017062754 Apr 2017 WO
WO 2017062855 Apr 2017 WO
WO 2017062886 Apr 2017 WO
WO 2017062983 Apr 2017 WO
WO 2017064439 Apr 2017 WO
WO 2017064546 Apr 2017 WO
WO 2017064566 Apr 2017 WO
WO 2017066175 Apr 2017 WO
WO 2017066497 Apr 2017 WO
WO 2017066588 Apr 2017 WO
WO 2017066707 Apr 2017 WO
WO 2017066781 Apr 2017 WO
WO 2017068077 Apr 2017 WO
WO 2017068377 Apr 2017 WO
WO 2017069829 Apr 2017 WO
WO 2017070029 Apr 2017 WO
WO 2017070032 Apr 2017 WO
WO 2017070169 Apr 2017 WO
WO 2017070284 Apr 2017 WO
WO 2017070598 Apr 2017 WO
WO 2017070605 Apr 2017 WO
WO 2017070632 Apr 2017 WO
WO 2017070633 Apr 2017 WO
WO 2017072590 May 2017 WO
WO 2017074526 May 2017 WO
WO 2017074962 May 2017 WO
WO 2017075261 May 2017 WO
WO 2017075335 May 2017 WO
WO 2017075475 May 2017 WO
WO 2017077135 May 2017 WO
WO 2017077329 May 2017 WO
WO 2017078751 May 2017 WO
WO 2017079400 May 2017 WO
WO 2017079428 May 2017 WO
WO 2017079673 May 2017 WO
WO 2017079724 May 2017 WO
WO 2017081097 May 2017 WO
WO 2017081288 May 2017 WO
WO 2017083368 May 2017 WO
WO 2017083722 May 2017 WO
WO 2017083766 May 2017 WO
WO 2017087395 May 2017 WO
WO 2017090724 Jun 2017 WO
WO 2017091510 Jun 2017 WO
WO 2017091630 Jun 2017 WO
WO 2017092201 Jun 2017 WO
WO 2017093370 Jun 2017 WO
WO 2017093969 Jun 2017 WO
WO 2017095111 Jun 2017 WO
WO 2017096041 Jun 2017 WO
WO 2017096237 Jun 2017 WO
WO 2017100158 Jun 2017 WO
WO 2017100431 Jun 2017 WO
WO 2017104404 Jun 2017 WO
WO 2017105251 Jun 2017 WO
WO 2017105350 Jun 2017 WO
WO 2017105991 Jun 2017 WO
WO 2017106414 Jun 2017 WO
WO 2017106528 Jun 2017 WO
WO 2017106537 Jun 2017 WO
WO 2017106569 Jun 2017 WO
WO 2017106616 Jun 2017 WO
WO 2017106657 Jun 2017 WO
WO 2017106767 Jun 2017 WO
WO 2017109134 Jun 2017 WO
WO 2017109757 Jun 2017 WO
WO 2017112620 Jun 2017 WO
WO 2017115268 Jul 2017 WO
WO 2017117395 Jul 2017 WO
WO 2017118598 Jul 2017 WO
WO 2017118720 Jul 2017 WO
WO 2017123609 Jul 2017 WO
WO 2017123910 Jul 2017 WO
WO 2017124086 Jul 2017 WO
WO 2017124100 Jul 2017 WO
WO 2017124652 Jul 2017 WO
WO 2017126987 Jul 2017 WO
WO 2017127807 Jul 2017 WO
WO 2017131237 Aug 2017 WO
WO 2017132112 Aug 2017 WO
WO 2017132580 Aug 2017 WO
WO 2017136520 Aug 2017 WO
WO 2017136629 Aug 2017 WO
WO 2017136794 Aug 2017 WO
WO 2017139264 Aug 2017 WO
WO 2017139505 Aug 2017 WO
WO 2017141173 Aug 2017 WO
WO 2017142835 Aug 2017 WO
WO 2017142999 Aug 2017 WO
WO 2017143042 Aug 2017 WO
WO 2017147056 Aug 2017 WO
WO 2017147278 Aug 2017 WO
WO 2017147432 Aug 2017 WO
WO 2017147446 Aug 2017 WO
WO 2017147555 Aug 2017 WO
WO 2017151444 Sep 2017 WO
WO 2017151719 Sep 2017 WO
WO 2017152015 Sep 2017 WO
WO 2017155717 Sep 2017 WO
WO 2017157422 Sep 2017 WO
WO 2017158153 Sep 2017 WO
WO 2017160689 Sep 2017 WO
WO 2017160752 Sep 2017 WO
WO 2017160890 Sep 2017 WO
WO 2017161068 Sep 2017 WO
WO 2017165826 Sep 2017 WO
WO 2017165862 Sep 2017 WO
WO 2017172644 Oct 2017 WO
WO 2017172645 Oct 2017 WO
WO 2017172860 Oct 2017 WO
WO 2017173004 Oct 2017 WO
WO 2017173054 Oct 2017 WO
WO 2017173092 Oct 2017 WO
WO 2017174329 Oct 2017 WO
WO 2017176529 Oct 2017 WO
WO 2017176806 Oct 2017 WO
WO 2017178590 Oct 2017 WO
WO 2017180694 Oct 2017 WO
WO 2017180711 Oct 2017 WO
WO 2017180915 Oct 2017 WO
WO 2017180926 Oct 2017 WO
WO 2017181107 Oct 2017 WO
WO 2017181735 Oct 2017 WO
WO 2017182468 Oct 2017 WO
WO 2017184334 Oct 2017 WO
WO 2017184768 Oct 2017 WO
WO 2017184786 Oct 2017 WO
WO 2017186550 Nov 2017 WO
WO 2017189308 Nov 2017 WO
WO 2017189336 Nov 2017 WO
WO 2017190041 Nov 2017 WO
WO 2017190257 Nov 2017 WO
WO 2017190664 Nov 2017 WO
WO 2017191210 Nov 2017 WO
WO 2017191274 Nov 2017 WO
WO 2017192172 Nov 2017 WO
WO 2017192512 Nov 2017 WO
WO 2017192544 Nov 2017 WO
WO 2017192573 Nov 2017 WO
WO 2017193029 Nov 2017 WO
WO 2017193053 Nov 2017 WO
WO 2017196768 Nov 2017 WO
WO 2017197038 Nov 2017 WO
WO 2017197238 Nov 2017 WO
WO 2017197301 Nov 2017 WO
WO 2017201476 Nov 2017 WO
WO 2017205290 Nov 2017 WO
WO 2017205423 Nov 2017 WO
WO 2017207589 Dec 2017 WO
WO 2017208247 Dec 2017 WO
WO 2017209809 Dec 2017 WO
WO 2017213896 Dec 2017 WO
WO 2017213898 Dec 2017 WO
WO 2017214460 Dec 2017 WO
WO 2017216392 Dec 2017 WO
WO 2017216771 Dec 2017 WO
WO 2017218185 Dec 2017 WO
WO 2017219027 Dec 2017 WO
WO 2017219033 Dec 2017 WO
WO 2017220751 Dec 2017 WO
WO 2017222370 Dec 2017 WO
WO 2017222773 Dec 2017 WO
WO 2017222834 Dec 2017 WO
WO 2017223107 Dec 2017 WO
WO 2017223330 Dec 2017 WO
WO 2018000657 Jan 2018 WO
WO 2018002719 Jan 2018 WO
WO 2018005117 Jan 2018 WO
WO 2018005289 Jan 2018 WO
WO 2018005691 Jan 2018 WO
WO 2018005782 Jan 2018 WO
WO 2018005873 Jan 2018 WO
WO 201806693 Jan 2018 WO
WO 2018009520 Jan 2018 WO
WO 2018009562 Jan 2018 WO
WO 2018009822 Jan 2018 WO
WO 2018013821 Jan 2018 WO
WO 2018013932 Jan 2018 WO
WO 2018013990 Jan 2018 WO
WO 2018014384 Jan 2018 WO
WO 2018015444 Jan 2018 WO
WO 2018015936 Jan 2018 WO
WO 2018017754 Jan 2018 WO
WO 2018018979 Feb 2018 WO
WO 2018020248 Feb 2018 WO
WO 2018021878 Feb 2018 WO
WO 2018022480 Feb 2018 WO
WO 2018022634 Feb 2018 WO
WO 2018025206 Feb 2018 WO
WO 2018026723 Feb 2018 WO
WO 2018026976 Feb 2018 WO
WO 2018027078 Feb 2018 WO
WO 2018030608 Feb 2018 WO
WO 2018031683 Feb 2018 WO
WO 2018035250 Feb 2018 WO
WO 2018035300 Feb 2018 WO
WO 2018035423 Feb 2018 WO
WO 2018035503 Feb 2018 WO
WO 2018039145 Mar 2018 WO
WO 2018039438 Mar 2018 WO
WO 2018039440 Mar 2018 WO
WO 2018039448 Mar 2018 WO
WO 2018048827 Mar 2018 WO
WO 2018049073 Mar 2018 WO
WO 2018049168 Mar 2018 WO
WO 2018051347 Mar 2018 WO
WO 2018058064 Mar 2018 WO
WO WO 2018045630 Mar 2018 WO
WO 2018062866 Apr 2018 WO
WO 2018064352 Apr 2018 WO
WO 2018064371 Apr 2018 WO
WO 2018064516 Apr 2018 WO
WO 2018067546 Apr 2018 WO
WO 2018067846 Apr 2018 WO
WO 2018068053 Apr 2018 WO
WO 2018069474 Apr 2018 WO
WO 2018071623 Apr 2018 WO
WO 2018071663 Apr 2018 WO
WO 2018071868 Apr 2018 WO
WO 2018071892 Apr 2018 WO
WO 2018074979 Apr 2018 WO
WO 2018079134 May 2018 WO
WO 2018080573 May 2018 WO
WO 2018081504 May 2018 WO
WO 2018081535 May 2018 WO
WO 2018081728 May 2018 WO
WO 2018083128 May 2018 WO
WO 2018083606 May 2018 WO
WO 2018085288 May 2018 WO
WO 2018085414 May 2018 WO
WO 2018086623 May 2018 WO
WO 2018089664 May 2018 WO
WO 2018093990 May 2018 WO
WO 2018098383 May 2018 WO
WO 2018098480 May 2018 WO
WO 2018098587 Jun 2018 WO
WO 2018099256 Jun 2018 WO
WO 2018103686 Jun 2018 WO
WO 2018106268 Jun 2018 WO
WO 2018107028 Jun 2018 WO
WO 2018107103 Jun 2018 WO
WO 2018107129 Jun 2018 WO
WO 2018108272 Jun 2018 WO
WO 2018109101 Jun 2018 WO
WO 2018111946 Jun 2018 WO
WO 2018111947 Jun 2018 WO
WO 2018112336 Jun 2018 WO
WO 2018112446 Jun 2018 WO
WO 2018119354 Jun 2018 WO
WO 2018119359 Jun 2018 WO
WO 2018120283 Jul 2018 WO
WO 2018130830 Jul 2018 WO
WO 2018135838 Jul 2018 WO
WO 2018136396 Jul 2018 WO
WO 2018138385 Aug 2018 WO
WO 2018142364 Aug 2018 WO
WO 2018148246 Aug 2018 WO
WO 2018148256 Aug 2018 WO
WO 2018148647 Aug 2018 WO
WO 2018149418 Aug 2018 WO
WO 2018149888 Aug 2018 WO
WO 2018149915 Aug 2018 WO
WO 2018152197 Aug 2018 WO
WO 2018152418 Aug 2018 WO
WO 2018154380 Aug 2018 WO
WO 2018154387 Aug 2018 WO
WO 2018154412 Aug 2018 WO
WO 2018154413 Aug 2018 WO
WO 2018154418 Aug 2018 WO
WO 2018154439 Aug 2018 WO
WO 2018154459 Aug 2018 WO
WO 2018154462 Aug 2018 WO
WO 2018156372 Aug 2018 WO
WO 2018161009 Sep 2018 WO
WO 2018165504 Sep 2018 WO
WO 2018165629 Sep 2018 WO
WO 2018170015 Sep 2018 WO
WO 2018170340 Sep 2018 WO
WO 2018175502 Sep 2018 WO
WO 2018176009 Sep 2018 WO
WO 2018177351 Oct 2018 WO
WO 2018179578 Oct 2018 WO
WO 2018183403 Oct 2018 WO
WO 2018189184 Oct 2018 WO
WO 2018191388 Oct 2018 WO
WO 2018195402 Oct 2018 WO
WO 2018195545 Oct 2018 WO
WO 2018195555 Oct 2018 WO
WO 2018197020 Nov 2018 WO
WO 2018197495 Nov 2018 WO
WO 2018202800 Nov 2018 WO
WO 2018204493 Nov 2018 WO
WO 2018208755 Nov 2018 WO
WO 2018208998 Nov 2018 WO
WO 2018209158 Nov 2018 WO
WO 2018209320 Nov 2018 WO
WO 2018213351 Nov 2018 WO
WO 2018213708 Nov 2018 WO
WO 2018213726 Nov 2018 WO
WO 2018213771 Nov 2018 WO
WO 2018213791 Nov 2018 WO
WO 2018217852 Nov 2018 WO
WO 2018217981 Nov 2018 WO
WO 2018218166 Nov 2018 WO
WO 2018218188 Nov 2018 WO
WO 2018218206 Nov 2018 WO
WO 2019005884 Jan 2019 WO
WO 2019005886 Jan 2019 WO
WO 2019010384 Jan 2019 WO
WO 2019023680 Jan 2019 WO
WO 2019051097 Mar 2019 WO
WO 2019079347 Apr 2019 WO
WO 2019084062 May 2019 WO
WO 2019118949 Jun 2019 WO
WO 2019123430 Jun 2019 WO
WO 2019139645 Jul 2019 WO
WO 2019139951 Jul 2019 WO
WO 2019147014 Aug 2019 WO
WO 2019226953 Nov 2019 WO
WO 2020014261 Jan 2020 WO
WO 2020028555 Feb 2020 WO
WO 2020041751 Feb 2020 WO
WO 2020051360 Mar 2020 WO
WO 2020086908 Apr 2020 WO
WO 2020092453 May 2020 WO
WO 2020102659 May 2020 WO
WO 2020154500 Jul 2020 WO
WO 2020181178 Sep 2020 WO
WO 2020181180 Sep 2020 WO
WO 2020181193 Sep 2020 WO
WO 2020181195 Sep 2020 WO
WO 2020181202 Sep 2020 WO
WO 2020191153 Sep 2020 WO
WO 2020191171 Sep 2020 WO
WO 2020191233 Sep 2020 WO
WO 2020191234 Sep 2020 WO
WO 2020191239 Sep 2020 WO
WO 2020191241 Sep 2020 WO
WO 2020191242 Sep 2020 WO
WO 2020191243 Sep 2020 WO
WO 2020191245 Sep 2020 WO
WO 2020191246 Sep 2020 WO
WO 2020191248 Sep 2020 WO
WO 2020191249 Sep 2020 WO
WO 2020210751 Oct 2020 WO
WO 2020214842 Oct 2020 WO
WO 2020236982 Nov 2020 WO
WO 2021025750 Feb 2021 WO
WO 2021030666 Feb 2021 WO
WO 2021072328 Apr 2021 WO
WO 2021108717 Jun 2021 WO
WO 2021155065 Aug 2021 WO
WO 2021158921 Aug 2021 WO
WO 2021158995 Aug 2021 WO
WO 2021158999 Aug 2021 WO
Non-Patent Literature Citations (1649)
Entry
U.S. Appl. No. 14/320,071, filed Jun. 30, 2014, Liu et al.
U.S. Appl. No. 16/374,634, filed Apr. 30, 2019, Liu et al.
U.S. Appl. No. 16/492,548, filed Sep. 9, 2019, Liu et al.
U.S. Appl. No. 16/643,376, filed Nov. 12, 2019, Liu et al.
U.S. Appl. No. 16/612,988, filed Jan. 27, 2020, Liu et al.
PCT/US2014/048390, Nov. 7, 2017, Invitation to Pay Additional Fees.
PCT/US2014/048390, Jan. 9, 2018, International Search Report and Written Opinion.
PCT/US2014/048390, Mar. 7, 2019, International Preliminary Report on Patentability.
U.S. Appl. No. 61/874,746, filed Sep. 6, 2013, Liu et al..
U.S. Appl. No. 61/874,682, filed Sep. 6, 2013, Liu et al..
U.S. Appl. No. 61/838,178, filed Jun. 21, 2013, Joung et al..
U.S. Appl. No. 61/837,481, filed Jun. 20, 2013, Cho et al..
U.S. Appl. No. 61/803,599, filed Mar. 20, 2013, Kim et al..
U.S. Appl. No. 61/794,422, filed Mar. 15, 2013, Knight et al..
U.S. Appl. No. 61/761,046, filed Feb. 5, 2013, Knight et al..
U.S. Appl. No. 61/758,624, filed Jan. 30, 2013, Chen et al..
U.S. Appl. No. 61/734,256, filed Dec. 6, 2012, Chen et al..
U.S. Appl. No. 61/717,324, filed Oct. 23, 2012, Cho et al..
U.S. Appl. No. 61/716,256, filed Oct. 19, 2012, Jinek et al..
U.S. Appl. No. 62/357,332, filed Jun. 30, 2016, Liu et al..
U.S. Appl. No. 62/288,661, filed Jan. 29, 2016, Muir et al..
[No. Author Listed] Score result for SEQ 355 to W02017032580. Muir et al. 2016.
[No. Author Listed], EMBL Accession No. Q99ZW2. Nov. 2012. 2 pages.
[No. Author Listed], Invitrogen Lipofectamine™ 2000 product sheets, 2002. 2 pages.
[No. Author Listed], Invitrogen Lipofectamine™ 2000 product sheets, 2005. 3 pages.
[No. Author Listed], Invitrogen Lipofectamine™ LTX product sheets, 2011. 4 pages.
[No. Author Listed], Thermo Fisher Scientific—How Cationic Lipid Mediated Transfection Works, retrieved from the internet Aug. 27, 2015. 2 pages.
Abudayyeh et al., C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector. Science Aug. 2016;353(6299):aaf5573. DOI: 10.1126/science.aaf5573.
Addgene Plasmid # 44246. pdCas9-humanized, 2017, Stanley Qi.
Addgene Plasmid # 73021. PCMV-BE3, 2017, David Liu.
Addgene Plasmid # 79620. pcDNA3.1_pCMV-nCas-PmCDA1-ugi pHl-gRNA(HPRT), 2017, Akihiko Kondo.
Aihara et al., A conformational switch controls the DNA cleavage activity of lambda integrase. Mol Cell. Jul. 2003;12(1):187-98.
Alexandrov et al., Signatures of mutational processes in human cancer. Nature. Aug. 22, 2013;500(7463):415-21. doi: 10.1038/naturel2477. Epub Aug. 14, 2013.
Ames et al., A eubacterial riboswitch class that senses the coenzyme tetrahydrofolate. Chem Biol. Jul. 3, 20100;17(7):681-5. doi: 10.1016/j.chembiol.2010.05.020.
Anders et al., Structural basis of PAM-dependent target DNA recognition by the Cas9 endonuclease. Nature. Sep. 25, 2014;513(7519):569-73. doi: 10.1038/naturel3579. Epub Jul. 27, 2014.
Arnold et al., Mutants of Tn3 resolvase which do not require accessory binding sites for recombination activity. EMBO J. Mar. 19, 199;18(5):1407-14.
Barnes et al., Repair and genetic consequences of endogenous DNA base damage in mammalian cells. Annu Rev Genet. 2004;38:445-76.
Barrangou et al., CRISPR provides acquired resistance against viruses in prokaryotes. Science. Mar. 23, 2007;315(5819): 1709-12.
Barrangou, RNA-mediated programmable DNA cleavage. Nat Biotechnol. Sep. 2012;30(9):836-8. doi: 10.1038/nbt.2357.
Basha et al., Influence of cationic lipid composition on gene silencing properties of lipid nanoparticle formulations of siRNA in antigen-presenting cells. Mol Ther. Dec. 2011;19(12):2186-200. doi: 10.1038/mt.2011.190. Epub Oct. 4, 2011.
Batey et al., Structure of a natural guanine-responsive riboswitch complexed with the metabolite hypoxanthine. Nature. Nov. 18, 2004;432(7015):411-5.
Beale et al., Comparison of the differential context-dependence of DNA deamination by APOBEC enzymes: correlation with mutation spectra in vivo. J Mol Biol. Mar. 26, 2004;337(3):585-96.
Bedell et al., In vivo genome editing using a high-efficiency TALEN system. Nature. Nov. 1, 2012;491(7422):114-8. Doi: 10.1038/nature11537. Epub Sep. 23, 2012.
Begley, Scientists unveil the ‘most clever CRISPR gadget’ so far. STAT, Apr. 20, 2016. https://www.statnews.com/2016/04/20/clever-crispr-advance-unveiled/.
Bershtein et al., Advances in laboratory evolution of enzymes. Curr Opin; Chem Biol. Apr. 2008;12(2):151-8. doi: 10.1016/j.cbpa.2008.01.027. Epub Mar. 7, 2008. Review.
Beumer et al., Efficient gene targeting in Drosophila with zinc-finger nucleases. Genetics. Apr. 2006;172(4):2391-403. Epub Feb. 1, 2006.
Billon et al., CRISPR-Mediated Base Editing Enables Efficient Disruption of Eukaryotic Genes through Induction of STOP Codons. Mol Cell. Sep. 21, 2017;67(6):1068-1079.e4. doi: 10.1016/j.molcel.2017.08.008. Epub Sep. 7, 2017.
Birling et al., Site-specific recombinases for manipulation of the mouse genome. Methods Mol Biol. 2009;561:245-63. doi: 10.1007/978-1-60327-019-9_16.
Bitinaite et al., FokI dimerization is required for DNA cleavage. Proc Natl Acad Sci U S A. Sep. 1, 1998;95(18):10570-5.
Boch, TALEs of genome targeting. Nat Biotechnol. Feb. 2011;29(2):135-6. Doi: 10.1038/nbt.1767.
Boeckle et al., Melittin analogs with high lytic activity at endosomal pH enhance transfection with purified targeted PEI polyplexes. J Control Release. May 15, 2006;112(2):240-8. Epub Mar. 20, 2006.
Bogdanove et al., TAL effectors: customizable proteins for DNA targeting. Science. Sep. 30, 2011;333(6051):1843-6. doi: 10.1126/science.1204094.
Bohlke et al., Sense codon emancipation for proteome-wide incorporation of noncanonical amino acids: rare isoleucine codon AUA as a target for genetic code expansion. FEMS Microbiol Lett. Feb. 2014;351(2):133-44. doi: 10.1111/1574-6968.12371. Epub Jan. 27, 2014.
Bolotin et al., Clustered regularly interspaced short palindrome repeats (CRISPRs) have spacers of extrachromosomal origin. Microbiology. Aug. 2005;151(Pt 8):2551-61.
Borman, Improved route to single-base genome editing. Chemical & Engineering News, Apr. 25, 2016;94(17)p. 5. http://cen.acs.org/articles/94/i17/Improved-route-single-base-genome.html.
Branden and Tooze, Introduction to Protein Structure. 1999; 2nd edition. Garland Science Publisher: 3-12.
Briner et al., Guide RNA functional modules direct Cas9 activity and orthogonality. Mol Cell. Oct. 23, 2014;56(2):333-339. doi: 10.1016/j.molcel.2014.09.019.
Britt et al., Re-engineering plant gene targeting. Trends Plant Sci. Feb. 2003;8(2):90-5.
Brouns et al., Small CRISPR RNAs guide antiviral defense in prokaryotes. Science. Aug. 15, 2008;321(5891):960-4. doi: 10.1126/science.1159689.
Brown et al., Serine recombinases as tools for genome engineering. Methods. Apr. 2011;53(4):372-9. doi: 10.1016/j.ymeth.2010.12.031. Epub Dec. 30, 2010.
Brusse et al., Spinocerebellar ataxia associated with a mutation in the fibroblast growth factor 14 gene (SCA27): A new phenotype. Mov Disord. Mar. 2006;21(3):396-401.
Buchholz et al., Alteration of Cre recombinase site specificity by substrate-linked protein evolution. Nat Biotechnol. Nov. 2001;19(11):1047-52.
Buchwald et al., Long-term, continuous intravenous heparin administration by an implantable infusion pump in ambulatory patients with recurrent venous thrombosis. Surgery. Oct. 1980;88(4):507-16.
Budisa et al., Residue-specific bioincorporation of non-natural, biologically active amino acids into proteins as possible drug carriers: structure and stability of the per-thiaproline mutant of annexin V. Proc Natl Acad Sci USA. Jan. 20, 1998;95(2):455-9.
Bulow et al., Multienzyme systems obtained by gene fusion. Trends Biotechnol. Jul. 1991;9(7):226-31.
Burke et al., RNA Aptamers to the Adenosine Moiety of S-adenosyl Methionine: Structural Inferences From Variations on a Theme and the Reproducibility of SELEX. Nucleic Acids Res. May 15, 1997;25(10):2020-4. doi: 10.1093/nar/25.10.2020.
Burstein et al., New CRISPR-Cas systems from uncultivated microbes. Nature Feb. 2017;542(7640):237-240.
Buskirk et al., Directed evolution of ligand dependence: small-molecule-activated protein splicing. Proc Natl Acad Sci U S A. Jul. 20, 2004;101(29): 10505-10. Epub Jul. 9, 2004.
Böck., Selenocysteine: the 21st amino acid. Mol Microbiol. Mar. 199;5(3):515-20.
Cade et al., Highly efficient generation of heritable zebrafish gene mutations using homo- and heterodimeric TALENs. Nucleic Acids Res. Sep. 2012;40(16):8001-10. Doi: 10.1093/nar/gks518. Epub Jun. 7, 2012.
Caldecott et al., Single-strand break repair and genetic disease. Nat Rev Genet. Aug. 2008;9(8):619-31. doi: 10.1038/nrg2380.
Cameron, Recent advances in transgenic technology. Mol Biotechnol. Jun. 1997;7(3):253-65.
Cargill et al.,Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. Jul. 1999;22(3):231-8.
Caron et al., Intracellular delivery of a Tat-eGFP fusion protein into muscle cells. Mol Ther. Mar. 2001;3(3):310-8.
Carroll et al., Gene targeting in Drosophila and Caenorhabditis elegans with zinc-finger nucleases. Methods Mol Biol. 2008;435:63-77. doi: 10.1007/978-1-59745-232-8_5.
Carroll et al., Progress and prospects: zinc-finger nucleases as gene therapy agents. Gene Ther. Nov. 2008;15(22): 1463-8. doi: 10.1038/gt.2008.145. Epub Sep. 11, 2008.
Carroll, A CRISPR approach to gene targeting. Mol Ther. Sep. 2012;20(9): 1658-60. doi: 10.1038/mt.2012.171.
Carroll, Genome engineering with zinc-finger nucleases. Genetics. Aug. 2011;188(4):773-82. doi: 10.1534/genetics.111.131433. Review.
Cermak et al., Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting. Nucleic Acids Res. Jul. 2011;39(12):e82. Doi: 10.1093/nar/gkr218. Epub Apr. 14, 2011.
Chadwick et al., In Vivo Base Editing of PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) as a Therapeutic Alternative to Genome Editing. Arterioscler Thromb Vase Biol. Sep. 2017;37(9): 1741-1747. doi: 10.1161/ATVBAHA.117.309881. Epub Jul. 27, 2017.
Chaikind et al., A programmable Cas9-serine recombinase fusion protein that operates on DNA sequences in mammalian cells. Nucleic Acids Res. Nov. 16, 2016;44(20):9758-9770. Epub Aug. 11, 2016.
Charpentier et al., Biotechnology: Rewriting a genome. Nature. Mar. 7, 2013;495(7439):50-1.doi: 10.1038/495050a.
Chavez et al., Highly efficient Cas9-mediated transcriptional programming. Nat Methods. Apr. 2015; 12(4):326-8. doi: 10.1038/nmeth.3312. Epub Mar. 2, 2015.
Chavez et al., Precise Cas9 targeting enables genomic mutation prevention. bioRxiv. Jun. 14, 2016; http://dx/doi.oreg/10.1101/058974. 6 pages.
Chavez et al., Precise Cas9 targeting enables genomic mutation prevention. Proc Natl Acad Sci U S A. Apr. 3, 2018;115(14):3669-3673. doi: 10.1073/pnas.1718148115. Epub Mar. 19, 2018. bioRxiv preprint first posted online Jun. 14, 2016.
Chelico et al., Biochemical basis of immunological and retroviral responses to DNA-targeted cytosine deamination by activation-induced cytidine deaminase and APOBEC3G. J Biol Chem. Oct. 9, 2009;284(41):27761-5. doi: 10.1074/jbc.R109.052449. Epub Aug. 13, 2009.
Chelico et al., Stochastic properties of processive cytidine DNA deaminases AID and APOBEC3G. Philos Trans R Soc Lond B Biol Sci. Mar. 12, 2009;364(1517):583-93. doi: 10.1098/rstb.2008.0195.
Chen et al., Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. Oct. 2013;65(10):1357-69. doi: 10.1016/j.addr.2012.09.039. Epub Sep. 29, 2012.
Chen et al., Structure of the DNA deaminase domain of the HIV-1 restriction factor APOBEC3G. Nature. Mar. 6, 2008;452(7183):116-9. doi: 10.1038/nature06638. Epub Feb. 20, 2008. .
Chesnoy et al., Structure and function of lipid-DNA complexes for gene delivery. Annu Rev Biophys Biomol Struct. 2000;29:27-47.
Chew et al., A multifunctional AAV-CRISPR-Cas9 and its host response. Nat Methods. Oct. 2016;13(10):868-74. doi: 10.1038/nmeth.3993. Epub Sep. 5, 2016.
Chichili et al., Linkers in the structural biology of protein-protein interactions. Protein Science. 2013;22:153-67.
Chipev et al., A leucine—proline mutation in the H1 subdomain of keratin 1 causes epidermolytic hyperkeratosis. Cell. Sep. 4, 1992;70(5):821-8.
Cho et al., Analysis of off-target effects of CRISPR/Cas-derived RNA-guided endonucleases and nickases. Genome Res. Jan. 2014;24(1): 132-41. doi: 10.1101/gr.162339.113. Epub Nov. 19, 2013.
Cho et al., Targeted genome engineering in human cells with the Cas9 RNA-guided endonuclease. Nat Biotechnol. Mar. 2013;31(3):230-2. doi: 10.1038/nbt.2507. Epub Jan. 29, 2013.
Christian et al., Targeting G with TAL effectors: a comparison of activities of TALENs constructed with NN and NK repeat variable di-residues. PLoS One. 2012;7(9):e45383. doi: 10.1371/journal.pone.0045383. Epub Sep. 24, 2012.
Christian et al., Targeting DNA double-strand breaks with TAL effector nucleases. Genetics. Oct. 2010;186(2):757-61. Doi: 10.1534/genetics.110.120717. Epub Jul. 6, 2010.
Chu et al., Increasing the efficiency of homology-directed repair for CRISPR-Cas9-induced precise gene editing in mammalian cells. Nat Biotech. Feb. 13, 2015;33:543-8.
Chung-Il et al., Artificial control of gene expression in mammalian cells by modulating RNA interference through aptamer-small molecule interaction. RNA. May 2006;12(5):710-6. Epub Apr. 10, 2006.
Chylinski et al., The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems. RNA Biol. May 2013;10(5):726-37. doi: 10.4161/ma.24321. Epub Apr. 5, 2013.
Cobb et al., Directed evolution as a powerful synthetic biology tool. Methods. Mar. 15, 2013;60(1):81-90. doi: 10.1016/j.ymeth.2012.03.009. Epub Mar. 23, 2012.
Cole-Strauss et al., Correction of the mutation responsible for sickle cell anemia by an RNA-DNA oligonucleotide. Science. Sep. 6, 1996;273(5280):1386-9.
Cong et al., Multiplex genome engineering using CRISPR/Cas systems. Science. Feb. 15, 2013;339(6121):819-23. doi: 10.1126/science.1231143. Epub Jan. 3, 2013.
Cornu et a1., DNA-binding specificity is a major determinant of the activity and toxicity of zinc-finger nucleases. Mol Ther.Feb. 2008;16(2):352-8. Epub Nov. 20, 2007.
Covino et al., The CCL2/CCR2 Axis in the Pathogenesis of HIV-1 Infection: A New Cellular Target for Therapy? Current Drug Targets Dec. 2016;17(1):76-110. DOI: 10.2174/138945011701151217110917.
Cox et al., Conditional gene expression in the mouse inner ear using Cre-1oxP. J Assoc Res Otolaryngol. Jun. 2012;13(3):295-322. doi: 10.1007/sl0162-012-0324-5. Epub Apr. 24, 2012.
Cox et al., Therapeutic genome editing: prospects and challenges. Nat Med. Feb. 2015;21(2):121-31. doi: 10.1038/nm.3793.
Cradick et al., CRISPR/Cas9 systems targeting β-globin and CCR5 genes have substantial off-target activity. Nucleic Acids Res. Nov. 1, 2013;41(20):9584-92. doi: 10.1093/nar/gkt714. Epub Aug. 11, 2013.
Cradick et al., ZFN-site searches genomes for zinc finger nuclease target sites and off-target sites. BMC Bioinformatics. May 13, 2011;12:152. doi: 10.1186/1471-2105-12-152.
Cradick et al., Zinc-finger nucleases as a novel therapeutic strategy for targeting hepatitis B virus DNAs. Mol Ther. May 2010;18(5):947-54. Doi: 10.1038/mt.2010.20. Epub Feb. 16, 2010.
Cui et al., Targeted integration in rat and mouse embryos with zinc-finger nucleases. Nat Biotechnol. Jan. 2011;29(1):64-7. Doi: 10.1038/nbt.1731. Epub Dec. 12, 2010.
Cunningham et al., Ensembl 2015. Nucleic Acids Res. Jan. 2015;43(Database issue):D662-9. doi: 10.1093/nar/gkul010. Epub Oct. 28, 2014.
D'Adda di Fagagna et al., The Gam protein of bacteriophage Mu is an orthologue of eukaryotic Ku. EMBO Rep. Jan. 2003;4(1):47-52.
Dahlem et al., Simple methods for generating and detecting locus-specific mutations induced with TALENs in the zebrafish genome. PLoS Genet. 2012;8(8):el002861. doi: 10.1371/journal.pgen.1002861. Epub Aug. 16, 2012.
Davis et al., DNA double strand break repair via non-homologous end-joining. Transl Cancer Res. Jun. 2013;2(3):130-143.
Davis et al., Small molecule-triggered Cas9 protein with improved genome-editing specificity. Nat Chem Biol. May 2015; 11(5):316-8. doi: 10.1038/nchembio.1793. Epub Apr. 6, 2015.
De Souza, Primer: genome editing with engineered nucleases. Nat Methods. Jan. 2012;9(1):27.
Deltcheva et al., CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III. Nature. Mar. 31, 2011;471(7340):602-7. doi: 10.1038/nature09886.
Dicarlo et al., Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic Acids Research Apr. 2013;41(7):4336-43.
Ding et al., A TALEN genome-editing system for generating human stem cell-based disease models. Cell Stem Cell. Feb. 7, 2013;12(2):238-51. Doi: 10.1016/j.stem.2012.11.011. Epub Dec. 13, 2012.
Ding et al., Permanent alteration of PCSK9 with in vivo CRISPR-Cas9 genome editing. Circ Res. Aug. 15, 2014;115(5):488-92. doi: 10.1161/CIRCRESAHA. 115.304351. Epub Jun. 10, 2014.
Dixon et al., Reengineering orthogonally selective riboswitches. Proc Natl Acad Sci U S A. Feb. 16, 2010;107(7):2830-5. doi: 10.1073/pnas.0911209107. Epub Jan. 26, 2010.
Doench et al., Optimized sgRNA design to maximize activity and minimize off-target effects of CRISPR-Cas9. Nat Biotechnol. Feb. 2016;34(2):184-191. doi: 10.1038/nbt.3437.
Dormiani et al., Long-term and efficient expression of human ?-globin gene in a hematopoietic cell line using a new site-specific integrating non-viral system. Gene Ther. Aug. 2015;22(8):663-74. doi: 10.1038/gt.2015.30. Epub Apr. 1, 2015.
Doudna et al., Genome editing. The new frontier of genome engineering with CRISPR-Cas9. Science. Nov. 28, 2014;346(6213):1258096. doi: 10.1126/science. 1258096.
Doyon et al., Heritable targeted gene disruption in zebrafish using designed zinc-finger nucleases. Nat Biotechnol. Jun. 2008;26(6):702-8. Doi: 10.1038/nbt1409. Epub May 25, 2008.
Dumas et al., Designing logical codon reassignment—Expanding the chemistry in biology. Chem Sci. Jan. 1, 2015;6(1):50-69. doi: 10.1039/c4sc01534g. Epub Jul. 14, 2014. Review.
Dunaime, Breakthrough method means CRISPR just got a lot more relevant to human health. The Verge. Apr. 20, 2016. http://www.theverge.com/2016/4/20/111450262/crispr-base-editing-single-nucleotides-dna-gene-liu-harvard.
During et al., Controlled release of dopamine from a polymeric brain implant: in vivo characterization. Ann Neurol. Apr. 1989;25(4):351-6.
East-Seletsky et al., Two distinct RNase activities of CRISPR-C2c2 enable guide-RNA processing and RNA detection. Nature Oct. 2016;538(7624):270-3.
Edwards et al., An Escherichia coli tyrosine transfer RNA is a leucine-specific transfer RNA in the yeast Saccharomyces cerevisiae. Proc Natl Acad Sci U S A. Feb. 15, 1991;88(4): 1153-6.
Edwards et al., Crystal structures of the thi-box riboswitch bound to thiamine pyrophosphate analogs reveal adaptive RNA-small molecule recognition. Structure. Sep. 2006; 14(9):1459-68.
Eiler et al., Structural Basis for the Fast Self-Cleavage Reaction Catalyzed by the Twister Ribozyme. Proc Natl Acad Sci U S A. Sep. 9, 2014; 111(36):13028-33. doi: 10.1073/pnas.1414571111. Epub Aug. 25, 2014.
Eltoukhy et al., Nucleic acid-mediated intracellular protein delivery by lipid-like nanoparticles. Biomaterials. Aug. 2014;35(24):6454-61. doi: 10.1016/j.biomaterials.2014.04.014. Epub May 13, 2014.
Endo et al., Toward establishing an efficient and versatile gene targeting system in higher plants. Biocatalysis and Agricultural Biotechnology 2014;3,(1):2-6.
Esvelt et al., A system for the continuous directed evolution of biomolecules. Nature. Apr. 28, 2011;472(7344):499-503. doi: 10.1038/nature09929. Epub Apr. 10, 2011.
Esvelt et al., Genome-scale engineering for systems and synthetic biology. Mol Syst Biol. 2013;9:641. doi: 10.1038/msb.2012.66.
Esvelt et al., Orthogonal Cas9 proteins for RNA-guided gene regulation and editing. Nat Methods. Nov. 2013;10(11):1116-21. doi: 10.1038/nmeth.2681. Epub Sep. 29, 2013.
Fagerlund et al., The Cpf1 CRISPR-Cas protein expands genome-editing tools. Genome Biology Nov. 17, 2015;16:251. https://doi.org/10.1186/s13059-015-0824-9.
Fang et al., Synthetic Studies Towards Halichondrins: Synthesis of the Left Halves of Norhalichondrins and Homohalichondrins. Tetrahedron Letters 1992;33(12): 1557-1560.
Farhood et al., Codelivery to mammalian cells of a transcriptional factor with cis-acting element using cationic liposomes. Anal Biochem. Feb. 10, 1995;225(1):89-93.
Felletti et al., Twister Ribozymes as Highly Versatile Expression Platforms for Artificial Riboswitches. Nat Commun. Sep. 26, 2016;7:12834. doi: 10.1038/ncomms12834.
Ferretti et al., Complete genome sequence of an M1 strain of Streptococcus pyogenes. Proc Natl Acad Sci U S A. Apr. 10, 2001;98(8):4658-63.
Ferry et al., Rational design of inducible CRISPR guide RNAs for de novo assembly of transcriptional programs. Nat Commun. Mar. 3, 2017;8:14633. doi: 10.1038/ncomms14633.
Fine et al., Trans-spliced Cas9 allows cleavage of HBB and CCR5 genes in human cells using compact expression cassettes. Scientific Reports 2015;5(l):Article No. 10777. doi:10.1038/srep10777. With Supplementary Information.
Fischer et al., Cryptic epitopes induce high-titer humoral immune response in patients with cancer. J Immunol. Sep. 1, 2010;185(5):3095-102. doi: 10.4049/jimmunol.0902166. Epub Jul. 26, 2010.
Fonfara et al., Phylogeny of Cas9 determines functional exchangeability of dual-RNA and Cas9 among orthologous type II CRISPR-Cas systems. Nucleic Acids Res. Feb. 2014;42(4):2577-90. doi: 10.1093/nar/gktl074. Epub Nov. 22, 2013.
Freshney, Culture of Animal Cells. A Manual of Basic Technique. Alan R. Liss, Inc. New York. 1983;4.
Fu et al., Improving CRISPR-Cas nuclease specificity using truncated guide RNAs. Nat Biotechnol. Mar. 2014;32(3):279-84. doi: 10.1038/nbt.2808. Epub Jan. 26, 2014.
Fu et al., High-frequency off-target mutagenesis induced by CRISPR-Cas nucleases in human cells. Nat Biotechnol. Sep. 2013;31(9):822-6. doi: 10.1038/nbt.2623. Epub Jun. 23, 2013.
Fuchs et al., Polyarginine as a multifunctional fusion tag. Protein Sci. Jun. 2005; 14(6): 1538-44.
Fujisawa et al., Disease-associated mutations in CIAS1 induce cathepsin B-dependent rapid cell death of human THP-1 monocytic cells. Blood. Apr. 1, 2007;109(7):2903-11.
Fukui et al., DNA Mismatch Repair in Eukaryotes and Bacteria. J Nucleic Acids. Jul. 27, 2010;2010. pii: 260512. doi: 10.4061/2010/260512.
Fung et al., Repair at single targeted DNA double-strand breaks in pluripotent and differentiated human cells. PLoS One. 2011;6(5):e20514. doi: 10.1371/journal.pone.0020514. Epub May 25, 2011.
Gaj et al., A comprehensive approach to zinc-finger recombinase customization enables genomic targeting in human cells. Nucleic Acids Res. Feb. 6, 2013;41(6):3937-46.
Gaj et al., Enhancing the specificity of recombinase-mediated genome engineering through dimer interface redesign. J Am Chem Soc. Apr. 2, 2014;136(13):5047-56. doi: 10.1021/ja4130059. Epub Mar. 20, 2014.
Gaj et al., Expanding the scope of site-specific recombinases for genetic and metabolic engineering. Biotechnol Bioeng. Jan. 2014;111(1):1-15. doi: 10.1002/bit.25096. Epub Sep. 13, 2013.
Gaj et al., ZFN, TALEN, and CRISPR/Cas-based methods for genome engineering. Trends Biotechnol. Jul. 2013;31(7):397-405. doi: 10.1016/j.tibtech.2013.04.004. Epub May 9, 2013.
Gallo et al., A novel pathogenic PSEN1 mutation in a family with Alzheimer's disease: phenotypical and neuropathological features. J Alzheimers Dis. 2011;25(3):425-31. doi: 10.3233/JAD-2011-110185.
Gao et al., DNA-guided genome editing using the Natronobacterium gregoryi Argonaute. Nat Biotechnol. Jul. 2016;34(7):768-73. doi: 10.1038/nbt.3547. Epub May 2, 2016.
Gardlik et al., Vectors and delivery systems in gene therapy. Med Sci Monit. Apr. 2005;11(4):RA110-21. Epub Mar. 24, 2005.
Garneau et al., The CRISPR/Cas bacterial immune system cleaves bacteriophage and plasmid DNA. Nature. Nov. 4, 2010;468(7320):67-71. doi: 10.1038/nature09523.
Gasiunas et al., Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria. Proc Natl Acad Sci U S A. Sep. 25, 2012;109(39):E2579-86. Epub Sep. 4, 2012. Supplementary materials included.
Gasiunas et al., RNA-dependent DNA endonuclease Cas9 of the CRISPR system: Holy Grail of genome editing? Trends Microbiol. Nov. 2013;21(11):562-7. doi: 10.1016/j.tim.2013.09.001. Epub Oct. 1, 2013.
Genbank Submission; NIH/NCBI, Accession No. J04623. Kita et al., Apr. 26, 1993. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. NC_002737.1. Ferretti et al., Jun. 27, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_015683.1. Trost et al., Jul. 6, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_016782.1. Trost et al., Jun. 11, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_016786.1. Trost et al., Aug. 28, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_017053.1. Fittipaldi et al., Jul. 6, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_017317.1. Trost et al., Jun. 11, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_017861.1. Heidelberg et al., Jun. 11, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_018010.1. Lucas et al., Jun. 11, 2013. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. NC_018721.1. Feng et al., Jun. 11, 2013. 1 pages. .
Genbank Submission; NIH/NCBI, Accession No. NC_021284.1. Ku et al., Jul. 12, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_021314.1. Zhang et al., Jul. 15, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_021846.1. Lo et al., Jul. 22, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NM_174936. Guo et al., Oct. 28, 2015. 6 pages.
Genbank Submission; NIH/NCBI, Accession No. NP_472073.1. Glaser et al., Jun. 27, 2013. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. P42212. Prasher et al., Mar. 19, 2014. 7 pages.
Genbank Submission; NIH/NCBI, Accession No. YP_002342100.1. Bernardini et al., Jun. 10, 2013. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. YP_002344900.1. Gundogdu et al., Mar. 19, 2014. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. YP_820832.1. Makarova et al., Aug. 27, 2013. 2 pages.
Gerber et al., RNA editing by base deamination: more enzymes, more targets, new mysteries. Trends Biochem Sci. Jun. 2001;26(6):376-84.
Gersbach et al., Directed evolution of recombinase specificity by split gene reassembly. Nucleic Acids Res. Jul. 2010;38(12):4198-206. doi: 10.1093/nar/gkq125. Epub Mar. 1, 2010.
Gersbach et al., Targeted plasmid integration into the human genome by an engineered zinc-finger recombinase. Nucleic Acids Res. Sep. 1, 2011;39(17):7868-78. doi: 10.1093/nar/kr421. Epub Jun. 7, 2011.
Gilbert et al., CRISPR-mediated modular RNA-guided regulation of transcription in eukaryotes. Cell. 2013 154(2):442-51.
Gilleron et al., Image-based analysis of lipid nanoparticle-mediated siRNA delivery, intracellular trafficking and endosomal escape. Nat Biotechnol. Jul. 2013;31(7):638-46. doi: 10.1038/nbt.2612. Epub Jun. 23, 2013.
Gonzalez et al., An iCRISPR platform for rapid, multiplexable, and inducible genome editing in human pluripotent stem cells. Cell Stem Cell. Aug. 7, 2014;15(2):215-26. doi: 10.1016/j.stem.2014.05.018. Epub Jun. 12, 2014.
Guilinger et al., Broad specificity profiling of TALENs results in engineered nucleases with improved DNA-cleavage specificity. Nat Methods. Apr. 2014;11(4):429-35. doi: 10.1038/nmeth.2845. Epub Feb. 16, 2014.
Guilinger et al., Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat Biotechnol. Jun. 2014;32(6):577-82. doi: 10.1038/nbt.2909. Epub Apr. 25, 2014.
Guo et al., Protein tolerance to random amino acid change. Proc Natl Acad Sci U S A. Jun. 22, 2004;101(25):9205-10. Epub Jun. 14, 2004.
Haeussler et al., Evaluation of off-target and on-target scoring algorithms and integration into the guide RNA selection tool CRISPOR. Genome Biol. Jul. 5, 2016;17(1): 148. doi: 10.1186/s13059-016-1012-2.
Hale et al., RNA-guided RNA cleavage by a CRISPR RNA-Cas protein complex. Cell. Nov. 25, 2009;139(5):945-56. doi: 10.1016/j.cell.2009.07.040.
Hamano-Takaku et al., A mutant Escherichia coli tyrosyl-tRNA synthetase utilizes the unnatural amino acid azatyrosine more efficiently than tyrosine. J Biol Chem. Dec. 22, 2000;275(51):40324-8.
Han, New CRISPR/Cas9-based Tech Edits Single Nucleotides Without Breaking DNA. Genome Web, Apr. 20, 2016. https://www.genomeweb.com/gene-silencinggene-editing/new-crisprcas9-based-tech-edits-single-nucleotides-without-breaking-dna.
Harrington et al., Recent developments and current status of gene therapy using viral vectors in the United Kingdom. BMJ. 2004;329(7470):839?842. doi:10.1136/bmj.329.7470.839.
Harris et al., RNA Editing Enzyme APOBEC1 and Some of Its Homologs Can Act as DNA Mutators. Mol Cell. Nov. 2002; 10(5): 1247-53.
Hartung et al., Correction of metabolic, craniofacial, and neurologic abnormalities in MPS I mice treated at birth with adeno-associated virus vector transducing the human alpha-L-iduronidase gene. Mol Ther. Jun. 2004;9(6):866-75.
Hasadsri et al., Functional protein delivery into neurons using polymeric nanoparticles. J Biol Chem. Mar. 13, 2009;284(11):6972-81. doi: 10.1074/jbc.M805956200. Epub Jan. 7, 2009.
Hayes et al., Stop codons preceded by rare arginine codons are efficient determinants of SsrA tagging in Escherichia coli. Proc Natl Acad Sci U S A. Mar. 19, 2002;99(6):3440-5. Epub Mar. 12, 2002.
Heller et al., Replisome assembly and the direct restart of stalled replication forks. Nat Rev Mol Cell Biol. Dec. 2006;7(12):932-43. Epub Nov. 8, 2006.
Hess et al., Directed evolution using dCas9-targeted somatic hypermutation in mammalian cells. Nat Methods. Dec. 2016;13(12):1036-1042. doi: 10.1038/nmeth.4038. Epub Oct. 31, 2016.
Hickford et al., Antitumour polyether macrolides: four new halichondrins from the New Zealand deep-water marine sponge Lissodendoryx sp. Bioorg Med Chem. Mar. 15, 2009;17(6):2199-203. doi: 10.1016/j.bmc.2008.10.093. Epub Nov. 19, 2008.
Hida et al., Directed evolution for drug and nucleic acid; delivery. Adv Drug Deliv Rev. Dec. 22, 2007;59(15):1562-78. Epub Aug. 28, 2007.; Review.
Hill et al., Functional analysis of conserved histidines in ADP-glucose pyrophosphorylase from Escherichia coli.Biochem Biophys Res Commun. Mar. 17, 1998;244(2):573-7.
Hilton et al., Enabling functional genomics with genome engineering. Genome Res. Oct. 2015;25(10):1442-55. doi: 10.1101/gr.190124.115.
Hirano et al., Structural Basis for the Altered PAM Specificities of Engineered CRISPR-Cas9. Mol Cell. Mar. 17, 2016;61(6):886-94. doi: 10.1016/j.molcel.2016.02.018.
Hockemeyer et al., Efficient targeting of expressed and silent genes in human ESCs and iPSCs using zinc-finger nucleases. Nat Biotechnol. Sep. 2009;27(9):851-7. doi: 10.1038/nbt.1562. Epub Aug. 13, 2009.
Hockemeyer et al., Genetic engineering of human pluripotent cells using TALE nucleases. Nat Biotechnol. Jul. 7, 2011;29(8):731-4. doi: 10.1038/nbt.1927.
Holden et al., Crystal structure of the anti-viral APOBEC3G catalytic domain and functional implications. Nature. Nov. 6, 2008;456(7218):121-4. doi: 10.1038/nature07357. Epub Oct. 12, 2008.
Hondares et al., Peroxisome Proliferator-activated Receptor (PPAR) Induces PPAR Coactivator 1 (PGC-1) Gene Expression and Contributes to Thermogenic Activation of Brown Fat. J Biol. Chem Oct. 2011; 286(50):43112-22. doi: 10.1074/jbc.M111.252775.
Horvath et al., CRISPR/Cas, the immune system of bacteria and archaea. Science. Jan. 8, 2010;327(5962):167-70. doi: 10.1126/science.1179555.
Horvath et al., Diversity, Activity, and Evolution of CRISPR Loci in Streptococcus thermophilus. J Bacteriol. Feb. 2008;190(4):1401-12. doi: 10.1128/JB.01415-07. Epub Dec. 7, 2007.
Hou et al., Efficient genome engineering in human pluripotent stem cells using Cas9 from Neisseria meningitidis. Proc Natl Acad Sci U S A. Sep. 24, 2013;110(39): 15644-9. doi: 10.1073/pnas.1313587110. Epub Aug. 12, 2013.
Houdebine, The methods to generate transgenic animals and to control transgene expression. J Biotechnol. Sep. 25, 2002;98(2-3):145-60.
Howard et al., Intracerebral drug delivery in rats with lesion-induced memory deficits. J Neurosurg. Jul. 1989;71(1):105-12.
Hower et al., Shape-based peak identification for ChlP-Seq. BMC Bioinformatics. Jan. 1, 20112;12:15. doi: 10.1186/1471-2105-12-15.
Hsu et al., DNA targeting specificity of RNA-guided Cas9 nucleases. Nat Biotechnol. Sep. 2013;31(9):827-32. doi: 10.1038/nbt.2647. Epub Jul. 21, 2013.
Hu et al., Chemical Biology Approaches to Genome Editing: Understanding, Controlling, and Delivering Programmable Nucleases. Cell Chem Biol. Jan. 21, 2016;23(1):57-73. doi: 10.1016/j.chembiol.2015.12.009.
Huang et al., Heritable gene targeting in zebrafish using customized TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):699-700. doi: 10.1038/nbt.1939.
Humbert et al., Targeted gene therapies: tools, applications, optimization. Crit Rev Biochem Mol Biol. May-Jun. 2012;47(3):264-81. doi: 10.3109/10409238.2012.658112.
Hurt et al., Highly specific zinc finger proteins obtained by directed domain shuffling and cell-based selection. Proc Natl Acad Sci U S A. Oct. 14, 2003;100(21):12271-6. Epub Oct. 3, 2003.
Husimi, Selection and evolution of bacteriophages in cellstat. Adv Biophys. ; 1989;25:1-43. Review.
Hwang et al., Efficient genome editing in zebrafish using a CRISPR-Cas system. Nat Biotechnol. Mar. 2013;31(3):227-9. doi: 10.1038/nbt.2501. Epub Jan. 29, 2013.
Hwang et al., Efficient In Vivo Genome Editing Using RNA-Guided Nucleases. Nat Biotechnol. Mar. 2013; 31(3): 227-229. doi: 10.1038/nbt.2501. Epub Jan. 29, 2013.
Ikediobi et al., Mutation analysis of 24 known cancer genes in the NCI-60 cell line set. Mol Cancer Ther. Nov. 2006;5(11):2606-12. Epub Nov. 6, 2006.
International Preliminary Report on Patentability for PCT/US2014/048390, dated Mar. 7, 2019.
International Search Report and Written Opinion for PCT/US2017/48390, dated Jan. 9, 2018.
Invitation to Pay Additional Fees for PCT/US2017/48 390, dated Nov. 7, 2017.
Irrthum et al., Congenital hereditary lymphedema caused by a mutation that inactivates VEGFR3 tyrosine kinase. Am J Hum Genet. Aug. 2000;67(2):295-301. Epub Jun. 9, 2000.
Ishino et al., Nucleotide sequence of the iap gene, responsible for alkaline phosphatase isozyme conversion in Escherichia coli, and identification of the gene product. J Bacteriol. Dec. 1987;169(12):5429-33. cited by applicant . Jamieson et al., Drug discovery with engineered zinc-finger proteins. Nat Rev Drug Discov. May 2003;2(5):361-8.
Jamieson et al., Drug discovery with engineered zinc-finger proteins. Nat Rev Drug Discov. May 2003;2(5):361-8.
Jansen et al., Backbone and nucleobase contacts to glucosamine-6-phosphate in the glmS ribozyme. Nat Struct Mol Biol. Jun. 2006;13(6):517-23. Epub May 14, 2006.
Jansen et al., Identification of genes that are associated with DNA repeats in prokaryotes. Mol Microbiol. Mar. 2002;43(6): 1565-75.
Jenkins et al., Comparison of a preQ1 riboswitch aptamer in metabolite-bound and free states with implications for gene regulation. J Biol Chem. Jul. 15, 2011;286(28):24626-37. doi: 10.1074/jbc.M111.230375. Epub May 18, 2011.
Jiang et al., RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Nat Biotechnol. Mar. 2013;31(3):233-9. doi: 10.1038/nbt.2508. Epub Jan. 29, 2013.
Jiang et al., Structural Biology. A Cas9-guide RNA Complex Preorganized for Target DNA Recognition. Science. Jun. 26, 2015;348(6242): 1477-81. doi: 10.1126/science.aab1452.
Jiang et al., Structures of a CRISPR-Cas9 R-loop complex primed for DNA cleavage. Science. Feb. 19, 2016;351(6275):867-71. doi: 10.1126/science.aad8282. Epub Jan. 14, 2016.
Jinek et al., A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science. Aug. 17, 2012;337(6096):816-21. doi: 10.1126/science. 1225829. Epub Jun. 28, 2012.
Jinek et al., RNA-programmed genome editing in human cells. Elife. Jan. 29, 2013;2:e00471. doi: 10.7554/eLife.00471.
Jinek et al., Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science. Mar. 14, 2014;343(6176):1247997. doi: 10.1126/science.1247997. Epub Feb. 6, 2014.
Jore et al., Structural basis for CRISPR RNA-guided DNA recognition by Cascade. Nat Struct Mol Biol. May 2011;18(5):529-36. doi: 10.1038/nsmb.2019. Epub Apr. 3, 2011.
Joung et al.,TALENs: a widely applicable technology for targeted genome editing. Nat Rev Mol Cell Biol. Jan. 2013;14(1):49-55. doi: 10.1038/nrm3486. Epub Nov. 21, 2012.
Kaiser et al., Gene therapy. Putting the fingers on gene repair. Science. Dec. 23, 2005;310(5756):1894-6.
Kakiyama et al., A peptide release system using a photo-cleavable linker in a cell array format for cell-toxicity analysis. Polymer J. Feb. 27, 2013;45:535-9.
Kandavelou et al., Targeted manipulation of mammalian genomes using designed zinc finger nucleases. Biochem Biophys Res Commun. Oct. 9, 2009;388(1):56-61. doi: 10.1016/j.bbrc.2009.07.112. Epub Jul. 25, 2009.
Kang et al., Structural Insights into riboswitch control of the biosynthesis of queuosine, a modified nucleotide found in the anticodon of tRNA. Mol Cell. Mar. 27, 2009;33(6):784-90. doi: 10.1016/j.molcel.2009.02.019. Epub Mar. 12, 2009.
Kappel et al., Regulating gene expression in transgenic animals.Curr Opin Biotechnol. Oct. 1992;3(5):548-53.
Karpenshif et al., From yeast to mammals: recent advances in genetic control of homologous recombination. DNA Repair (Amst). Oct. 1, 2012;11(10):781-8. doi: 10.1016/j.dnarep.2012.07.001. Epub Aug. 11, 2012. Review.
Karpinsky et al., Directed evolution of a recombinase that excises the provirus of most HIV-1 primary isolates with high specificity. Nat Biotechnol. Apr. 2016;34(4):401-9. doi: 10.1038/nbt.3467. Epub Feb. 22, 2016.
Kaya et al., A bacterial Argonaute with noncanonical guide RNA specificity. Proc. Natl. Acad. Sci. U S A Apr. 2016;113(15):4057-62.
Kellendonk et al., Regulation of Cre recombinase activity by the synthetic steroid RU 486. Nucleic Acids Res. Apr. 15, 1996;24(8): 1404-11.
Kiga et al., An engineered Escherichia coli tyrosyl-tRNA synthetase for site-specific incorporation of an unnatural amino acid into proteins in eukaryotic translation and its application in a wheat germ cell-free system. Proc Natl Acad Sci U S A. Jul. 23, 2002;99(15):9715-20. Epub Jul. 3, 2002.
Kim et al., A library of TAL effector nucleases spanning the human genome. Nat Biotechnol. Mar. 2013;31(3):251-8. Doi: 10.1038/nbt.2517. Epub Feb. 17, 2013.
Kim et al., Genome-wide target specificities of CRISPR RNA-guided programmable deaminases. Nat Biotechnol. May 2017;35(5):475-480. doi: 10.1038/nbt.3852. Epub Apr. 10, 2017.
Kim et al., Highly efficient RNA-guided base editing in mouse embryos. Nat Biotechnol. May 2017;35(5):435-437. doi: 10.1038/nbt.3816. Epub Feb. 27, 2017.
Kim et al., Highly efficient RNA-guided genome editing in human cells via delivery of purified Cas9 ribonucleoproteins. Genome Res. Jun. 2014;24(6): 1012-9. doi: 10.1101/gr.171322.113. Epub Apr. 2, 2014.
Kim et al., Increasing the genome-targeting scope and precision of base editing with engineered Cas9-cytidine deaminase fusions. Nat Biotechnol. Apr. 2017;35(4):371-376. doi: 10.1038/nbt.3803. Epub Feb. 13, 2017.
Kim et al., TALENs and ZFNs are associated with different mutationsignatures. Nat Methods. Mar. 2013;10(3):185. doi: 10.1038/nmeth.2364. Epub Feb. 10, 2013.
Kim et al., Targeted genome editing in human cells with zinc finger nucleases constructed via modular assembly. Genome Res. Jul. 2009; 19(7): 1279-88. doi: 10.1101/gr.089417.108. Epub May 21, 2009.
Kim et al., The role of apolipoprotein E in Alzheimer's disease. Neuron. Aug. 13, 2009;63(3):287-303. doi: 10.1016/j.neuron.2009.06.026.
Kim et al., Transcriptional repression by zinc finger peptides. Exploring the potential for applications in gene therapy. J Biol Chem. Nov. 21, 1997;272(47):29795-800.
Kitamura et al., Uracil DNA glycosylase counteracts APOBEC3G-induced hypermutation of hepatitis B viral genomes: excision repair of covalently closed circular DNA. PLoS Pathog. 2013;9(5):el003361. doi: 10.1371/journal.ppat.1003361. Epub May 16, 2013.
Klauser et al., An engineered small RNA-mediated genetic switch based on a ribozyme expression platform. Nucleic Acids Res. May 1, 2013;41(10):5542-52. doi: 10.1093/nar/gkt253. Epub Apr. 12, 2013.
Klein et al., Cocrystal structure of a class I preQ1 riboswitch reveals a pseudoknot recognizing an essential hypermodified nucleobase. Nat Struct Mol Biol. Mar. 2009;16(3):343-4. doi: 10.1038/nsmb.1563.Epub Feb. 22, 2009.
Kleinstiver et al., Broadening the targeting range of Staphylococcus aureus CRISPR-Cas9 by modifying PAM recognition. Nat Biotechnol. Dec. 2015;33(12):1293-1298. doi: 10.1038/nbt.3404. Epub Nov. 2, 2015.
Kleinstiver et al., Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature. Jul. 23, 2015;523(7561):481-5. doi: 10.1038/nature14592. Epub Jun. 22, 2015.
Kleinstiver et al., High-fidelity CRISPR-Cas9 nucleases with no detectable genome-wide off-target effects. Nature. Jan. 28, 2016;529(7587):490-5. doi: 10.1038/nature16526. Epub Jan. 6, 2016.
Kleinstiver et al., Monomeric site-specific nucleases for genome editing. Proc Natl Acad Sci U S A. May 22, 2012;109(21):8061-6. doi: 10.1073/pnas.1117984109. Epub May 7, 2012.
Klippel et al., Isolation and characterization of unusual gin mutants. EMBO J. Dec. 1, 1988;7(12):3983-9.
Klippel et al., The DNA invertase Gin of phage Mu: formation of a covalent complex with DNA via a phosphoserine at amino acid position 9. EMBO J. Apr. 1988;7(4): 1229-37.
Kobori et al., Deep Sequencing Analysis of Aptazyme Variants Based on a Pistol Ribozyme. ACS Synth Biol. Jul. 21, 2017;6(7):1283-1288. doi: 10.1021/acssynbio.7b00057. Epub Apr. 14, 2017.
Kohli et al., Local sequence targeting in the AID/APOBEC family differentially impacts retroviral restriction and antibody diversification. J Biol Chem. Dec. 24, 2010;285(52):40956-64. doi: 10.1074/jbc.Ml 10.177402. Epub Oct. 6, 2010.
Komor et al., CRISPR-Based Technologies for the Manipulation of Eukaryotic Genomes. Cell. Jan. 12, 2017;168(l-2):20-36. doi: 10.1016/j.cell.2016.10.044.
Komor et al., Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity. Sci Adv. Aug. 30, 2017;3(8):eaao4774. doi: 10.1126/sciadv.aao4774. eCollection Aug. 2017.
Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature. Apr. 20, 2016;533(7603):420-4. doi: 10.1038/nature17946.
Koonin et al., Diversity, classification and evolution of CRISPR-Cas systems. Curr Opin Microbiol. 2017;37:67?78. doi:10.1016/j.mib.2017.05.008.
Kouzminova et al., Patterns of chromosomal fragmentation due to uracil-DNA incorporation reveal a novel mechanism of replication-dependent double-stranded breaks. Mol Microbiol. Apr. 2008;68(1):202-15. doi: 10.1111/j.1365-2958.2008.06149.x.
Kowal et al., Exploiting unassigned codons in Micrococcus luteus for tRNA-based amino acid mutagenesis. Nucleic Acids Res. Nov. 15, 1997;25(22):4685-9.
Kumar et al., Structural and functional consequences of the mutation of a conserved arginine residue in alphaA and alphaB crystallins. J Biol Chem. Aug. 20, 1999;274(34):24137-41.
Kundu et al., Leucine to proline substitution by SNP at position 197 in Caspase-9 gene expression leads to neuroblastoma: a bioinformatics analysis. 3 Biotech. 2013; 3:225-34.
Kunz et al., DNA Repair in mammalian cells: Mismatched repair: variations on a theme. Cell Mol Life Sci. Mar. 2009;66(6):1021-38. doi: 10.1007/s00018-009-8739-9.
Kury et al., De Novo Disruption of the Proteasome Regulatory Subunit PSMD12 Causes a Syndromic Neurodevelopmental Disorder. Am J Hum Genet. Feb. 2, 2017;100(2):352-363. doi: 10.1016/j.ajhg.2017.01.003. Epub Jan. 26, 2017.
Kuscu et al., CRISPR-STOP: gene silencing through base-editing-induced nonsense mutations. Nat Methods. Jul. 2017;14(7):710-712. doi: 10.1038/nmeth.4327. Epub Jun. 5, 2017.
Kuscu et al., Genome-wide analysis reveals characteristics of off-target sites bound by the Cas9 endonuclease. Nat Biotechnol. Jul. 2014;32(7):677-83. doi: 10.1038/nbt.2916. Epub May 18, 2014.
Kwon et al., Chemical basis of glycine riboswitch cooperativity. RNA. Jan. 2008;14(1):25-34. Epub Nov. 27, 2007.
Köhrer et al., A possible approach to site-specific insertion of two different unnatural amino acids into proteins in mammalian cells via nonsense suppression. Chem Biol. Nov. 2003;10(11):1095-102.
Köhrer et al., Complete set of orthogonal 21st aminoacyl-tRNA synthetase-amber, ochre and opal suppressor tRNA pairs: concomitant suppression of three different termination codons in an mRNA in mammalian cells. Nucleic Acids Res. Dec. 1, 2004;32(21):6200-11. Print 2004.
Landrum et al., ClinVar: public archive of interpretations of clinically relevant variants. Nucleic Acids Res. Jan. 4, 2016;44(D1):D862-8. doi: 10.1093/nar/gkvl222. Epub Nov. 17, 2015.
Langer et al., Chemical and Physical Structure of Polymers as Carriers for Controlled Release of Bioactive Agents: A Review. Journal of Macromolecular Science, 2006;23(1):61-126. DOI: 10.1080/07366578308079439.
Langer et al., New methods of drug delivery. Science. Sep. 28, 1990;249(4976):1527-33.
Larson et al., CRISPR interference (CRISPRi) for sequence-specific control of gene expression. Nat Protoc. Nov. 2013;8(11):2180-96. doi: 10.1038/nprot.2013.132. Epub Oct. 17, 2013.
Lau et al., Molecular basis for discriminating between normal and damaged bases by the human alkyladenine glycosylase, AAG. Proc Natl Acad Sci USA. Dec. 5, 2000;97(25): 13573-8.
Lavergne et al., Defects in type IIA von Willebrand disease: a cysteine 509 to arginine substitution in the mature von Willebrand factor disrupts a disulphide loop involved in the interaction with platelet glycoprotein Ib-IX. Br J Haematol. Sep. 1992;82(1):66-72.
Lawrence et al., Supercharging proteins can impart unusual resilience. J Am Chem Soc. Aug. 22, 2007; 129(33): 10110-2. Epub Aug. 1, 2007.
Lazar et al., Transforming growth factor alpha: mutation of aspartic acid 47 and leucine 48 results in different biological activities. Mol Cell Biol. Mar. 1988;8(3):1247-52.
Ledford, Gene-editing hack yields pinpoint precision. Nature, Apr. 20, 2016. http://www.nature.com/news/gene-editing-hack-yields-pinpoint-precision-1.19773.
Lee et al., A chimeric thyroid hormone receptor constitutively bound to DNA requires retinoid X receptor for hormone-dependent transcriptional activation in yeast. Mol Endocrinol. Sep. 1994;8(9): 1245-52.
Lee et al., An allosteric self-splicing ribozyme triggered by a bacterial second messenger. Science. Aug. 13, 2010;329(5993):845-8. doi: 10.1126/science.1190713.
Lee et al., Failure to detect DNA-guided genome editing using Natronobacterium gregoryi Argonaute. Nat Biotechnol. Nov. 28, 2016;35(1): 17-18. doi: 10.1038/nbt.3753.
Lee et al., PIK3CA gene is frequently mutated in breast carcinomas and hepatocellular carcinomas. Oncogene. Feb. 17, 2005;24(8):1477-80.
Lee et al., Recognition of liposomes by cells: in vitro binding and endocytosis mediated by specific lipid headgroups and surface charge density. Biochim Biophys Acta. Jan. 31, 1992;1103(2):185-97.
Lee et al., Ribozyme Mediated gRNA Generation for In Vitro and In Vivo CRISPR/Cas9 Mutagenesis. PLoS One. Nov. 10, 2016;11(11):e0166020. doi: 10.1371/journal.pone.0166020.eCollection 2016.
Lei et al., Efficient targeted gene disruption in Xenopus embryos using engineered transcription activator-like effector nucleases (TALENs). Proc Natl Acad Sci U S A. Oct. 23, 2012; 109(43): 17484-9. Doi: 10.1073/pnas. 1215421109. Epub Oct. 8, 2012.
Lenk et al., Pathogenic mechanism of the FIG4 mutation responsible for Charcot-Marie-Tooth disease CMT4J. PLoS Genet. Jun. 2011;7(6):e1002104. doi: 10.1371/journal.pgen.1002104. Epub Jun. 2, 2011.
Levy et al., Inhibition of calcification of bioprosthetic heart valves by local controlled-release diphosphonate. Science. Apr. 1, 19852;228(4696):190-2.
Lewis et al., A serum-resistant cytofectin for cellular delivery of antisense oligodeoxynucleotides and plasmid DNA. Proc Natl Acad Sci U S A. Apr. 16, 1996;93(8):3176-81.
Lewis et al., Building the Class 2 CRISPR-Cas Arsenal. Mol Cell 2017;65(3);377-379.
Lewis et al., Codon 129 polymorphism of the human prion protein influences the kinetics of amyloid formation. J Gen Virol. Aug. 2006;87(Pt 8):2443-9.
Li et al., Base editing with a Cpf1-cytidine deaminase fusion. Nat Biotechnol. Apr. 2018;36(4):324-327. doi: 10.1038/nbt.4102. Epub Mar. 19, 2018.
Li et al., Current approaches for engineering proteins with diverse biological properties. Adv Exp Med Biol. 2007;620:18-33.
Li et al., Generation of Targeted Point Mutations in Rice by a Modified CRISPR/Cas9 System. Mol Plant. Mar. 6, 2017;10(3):526-529. doi: 10.1016/j.molp.2016.12.001. Epub Dec. 8, 2016.
Li et al., Highly efficient and precise base editing in discarded human tripronuclear embryos. Protein Cell. Aug. 19, 2017. doi: 10.1007/s13238-017-0458-7. [Epub ahead of print].
Li et al., Modularly assembled designer TAL effector nucleases for targeted gene knockouand gene replacement in eukaryotes. Nucleic Acids Res. Aug. 2011;39(14):6315-25. doi: 10.1093/nar/gkr188. Epub Mar. 31, 2011.
Li et al., Multiplex and homologous recombination-mediated genome editing in Arabidopsis and Nicotiana benthamiana using guide RNA and Cas9. Nat Biotechnol. Aug. 2013;31(8):688-91. doi: 10.1038/nbt.2654.
Li et al., TAL nucleases (TALNs): hybrid proteins composed of TAL effectors and FokI DNA-cleavage domain. Nucleic Acids Res. Jan. 2011;39(1):359-72. doi: 10.1093/nar/gkq704. Epub Aug. 10, 2010.
Liang et al., Rapid and highly efficient mammalian cell engineering via Cas9 protein transfection. Send to; J Biotechnol. Aug. 20, 2015;208:44-53. doi: 10.1016/j.jbiotec.2015.04.024.
Lieber et al., Mechanism and regulation of human non-homologous DNA end-joining. Nat Rev Mol Cell Biol. Sep. 2003;4(9):712-20.
Lilley, D.M. The Varkud Satellite Ribozyme. RNA. Feb. 2004;10(2):151-8.doi: 10.1261/rna.5217104.
Lin et al., Enhanced homology-directed human genome engineering by controlled timing of CRISPR/Cas9 delivery. Elife. Dec. 15, 2014;3:e04766. doi: 10.7554/eLife.04766.
Link et al., Engineering ligand-responsive gene-control elements: lessons learned from natural riboswitches. Gene Ther. Oct. 2009;16(10):1189-201. doi: 10.1038/gt.2009.81. Epub Jul. 9, 2009. Review.
Liu et al., C2c1-sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism. Molecular Cell Jan. 2017;65(2):310-22.
Liu et al., Apolipoprotein E and Alzheimer disease: risk, mechanisms and therapy. Nat Rev Neurol. Feb. 2013;9(2):106-18. doi: 10.1038/nrneurol.2012.263. Epub Jan. 8, 2013.
Liu et al., Balancing AID and DNA repair during somatic hypermutation. Trends Immunol. Apr. 2009;30(4):173-81. doi: 10.1016/j.it.2009.01.007.
Liu et al., Cell-penetrating peptide-mediated delivery of TALEN proteins via bioconjugation for genome engineering. PLoS One. Jan. 2, 20140;9(1):e85755. doi: 10.1371/joumal.pone.0085755. eCollection 2014.
Liu et al., Design of polydactyl zinc-finger proteins for unique addressing within complex genomes. Proc Natl Acad Sci U S A. May 27, 1997;94(11):5525-30.
Liu et al., Distance determination by GIY-YIG intron endonucleases: discrimination between repression and cleavage functions. Nucleic Acids Res. Mar. 31, 2006;34(6): 1755-64. Print 2006.
Liu et al., Engineering a tRNA and aminoacyl-tRNA synthetase for the site-specific incorporation of unnatural amino acids into proteins in vivo. Proc Natl Acad Sci U S A. Sep. 16, 1997;94(19):10092-7.
Liu et al., Fast Colorimetric Sensing of Adenosine and Cocaine Based on a General Sensor Design Involving Aptamers and Nanoparticles. Angew Chem. Dec. 16, 2006;45(l):90-4. DOI: 10.1002/anie.200502589.
Liu et al., Fast Colorimetric Sensing of Adenosine and Cocaine Based on a General Sensor Design Involving Aptamers and Nanoparticles. Angew Chem. 2006; 118(1):96-100.
Liu et al., Functional Nucleic Acid Sensors. Chem Rev. May 2009; 109(5): 1948-98. doi: 10.1021/cr030183i.
Lombardo et al., Gene editing in human stem cells using zinc finger nucleases and integrase-defective lentiviral vector delivery. Nat Biotechnol. Nov. 2007;25(11):1298-306. Epub Oct. 28, 2007.
Losey et al., Crystal structure of Staphylococcus sureus tRNA adenosine deaminase tadA in complex with RNA. Nature Struct. Mol. Biol. Feb. 2006;13(2): 153-9.
Lu et al., Precise Editing of a Target Base in the Rice Genome Using a Modified CRISPR/Cas9 System. Mol Plant. Mar. 6, 2017;10(3):523-525. doi: 10.1016/j.molp.2016.11.013. Epub Dec. 6, 2016.
Lundberg et al., Delivery of short interfering RNA using endosomolytic cell-penetrating peptides. FASEB J. Sep. 2007;21(11):2664-71. Epub Apr. 26, 2007.
Lundquist et al., Site-directed mutagenesis and characterization of uracil-DNA glycosylase inhibitor protein. Role of specific carboxylic amino acids in complex formation with Escherichia coli uracil-DNA glycosylase. J Biol Chem. Aug. 22, 1997;272(34):21408-19.
Lyons et al., Efficient Recognition of an Unpaired Lesion by a DNA Repair Glycosylase. J. Am. Chem. Soc., 2009;131(49):17742-3. DOI: 10.1021/ja908378y.
Ma et al., Single-Stranded DNA Cleavage by Divergent CRISPR-Cas9 Enzymes. Mol Cell. Nov. 5, 2015;60(3):398-407. doi: 10.1016/j.molcel.2015.10.030.
Ma et al., Targeted AID-mediated mutagenesis (TAM) enables efficient genomic diversification in mammalian cells. Nature Methods. Oct. 2016; 13:1029-35. doi:10.1038/nmeth.4027.
Maeder et al., CRISPR RNA-guided activation of endogenous human genes. Nat Methods. Oct. 2013;10(10):977-9. doi: 10.1038/nmeth.2598. Epub Jul. 25, 2013.
Maeder et al., Rapid “open-source” engineering of customized zinc-finger nucleases for highly efficient gene modification. Mol Cell. Jul. 25, 2008;31(2):294-301. doi:10.1016/j.molcel.2008.06.016.
Maeder et al., Robust, synergistic regulation of human gene expression using TALE activators. Nat Methods. Mar. 2013;10(3):243-5. doi: 10.1038/nmeth.2366. Epub Feb. 10, 2013.
Mahfouz et al., De novo-engineered transcription activator-like effector (TALE) hybrid nuclease with novel DNA binding specificity creates double-strand breaks. Proc Natl Acad Sci U S A. Feb. 8, 2011;108(6):2623-8. doi: 10.1073/pnas. 1019533108. Epub Jan. 24, 2011.
Makarova et al., Prokaryotic homologs of Argonaute proteins are predicted to function as key components of a novel system of defense against mobile genetic elements. Biology Direct 2009;4:29.
Makarova et al., An updated evolutionary classification of CRISPR-Cas systems. Nat Rev Microbiol. Nov. 2015;13(11):722-36. doi: 10.1038/nrmicro3569. Epub Sep. 28, 2015.
Makarova et al., Evolution and classification of the CRISPR-Cas systems. Nat Rev Microbiol. Jun. 2011;9(6):467-77. doi: 10.1038/nrmicro2577. Epub May 9, 2011.
Mali et al., Cas9 as a versatile tool for engineeringbiology. Nat Methods. Oct. 2013;10(10):957-63. doi: 10.1038/nmeth.2649.
Mali et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nat Biotechnol. Sep. 2013;31(9):833-8. doi: 10.1038/nbt.2675. Epub Aug. 1, 2013.
Mali et al., RNA-guided human genome engineering via Cas9. Science. Feb. 15, 2013;339(6121):823-6. doi: 10.1126/science. 1232033. Epub Jan. 3, 2013.
Mandal et al., Riboswitches Control Fundamental Biochemical Pathways in Bacillus Subtilis and Other Bacteria. Cell. May 30, 2003;113(5):577-86. doi: 10.1016/s0092-8674(03)00391-x.
Mani et al., Design, engineering, and characterization of zinc finger nucleases. Biochem Biophys Res Commun. Sep. 23, 2005;335(2):447-57.
Marioni et al., DNA methylation age of blood predicts all-cause mortality in later life. Genome Biol. Jan. 30, 2015;16:25. doi: 10.1186/s13059-015-0584-6.
Marrafhini et al., CRISPR interference limits horizontal gene transfer in staphylococci by targeting DNA. Science. Dec. 19, 2008;322(5909):1843-5. doi: 10.1126/science. 1165771.
Maruyama et al., Increasing the efficiency of precise genome editing with CRISPR-Cas9 by inhibition of nonhomologous end joining. Nat Biotechnol. May 2015;33(5):538-42. doi: 10.1038/nbt.3190. Epub Mar. 23, 2015.
Mei et al., Recent Progress in CRISPR/Cas9 Technology. J Genet Genomics. Feb. 20, 2016;43(2):63-75. doi: 10.1016/j.jgg.2016.01.001. Epub Jan. 18, 2016.
Meng et al., Targeted gene inactivation in zebrafish using engineered zinc-finger nucleases. Nat Biotechnol. Jun. 2008;26(6):695-701. doi: 10.1038/nbt1398. Epub May 25, 2008.
Mercer et al., Chimeric TALE recombinases with programmable DNA sequence specificity. Nucleic Acids Res. Nov. 2012;40(21):11163-72. doi: 10.1093/nar/gks875. Epub Sep. 26, 2012.
Meyer et al., Breathing life into polycations: functionalization with pH-responsive endosomolytic peptides and polyethylene glycol enables siRNA delivery. J Am Chem Soc. Mar. 19, 2008;130(11):3272-3. doi: 10.1021/ja710344v. Epub Feb. 21, 2008.
Meyer et al., Confirmation of a second natural preQi aptamer class in Streptococcaceae bacteria. RNA. Apr. 2008;14(4):685-95. doi: 10.1261/rna.937308. Epub Feb. 27, 2008.
Midoux et al., Chemical vectors for gene delivery: a current review on polymers, peptides and lipids containing histidine or imidazole as nucleic acids carriers. Br J Pharmacol. May 2009;157(2):166-78. doi: 10.1111/j.l476-5381.2009.00288.x.
Miller et al., A Tale nuclease architecture for efficient genome editing. Nat Biotechnol. Feb. 2011;29(2): 143-8. doi:10.1038/nbt.1755. Epub Dec. 22, 2010.
Miller et al., An improved zinc-finger nuclease architecture for highly specific genome editing. Nat Biotechnol. Jul. 2007;25(7):778-85. Epub Jul. 1, 2007.
Minoche et al., Evaluation of genomic high-throughput sequencing data generated on Illumina HiSeq and genome analyzer systems. Genome Biol. Nov. 8, 2011;12(11):R112. doi: 10.1186/GB-2011-12-11-r112.
Minoretti et al., A W148R mutation in the human FOXD4 gene segregating with dilated cardiomyopathy, obsessive-compulsive disorder, and suicidality. Int J Mol Med. Mar. 2007;19(3):369-72.
Mir et al., Two Active Site Divalent Ions in the Crystal Structure of the Hammerhead Ribozyme Bound to a Transition State Analogue. Biochemistry. . . Feb. 2, 2016;55(4):633-6. doi: 10.1021/acs.biochem.5b01139. Epub Jan. 19, 2016.
Mojica et al., Intervening sequences of regularly spaced prokaryotic repeats derive from foreign genetic elements. J Mol Evol. Feb. 2005;60(2):174-82.
Mol et al., Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA. Cell. Sep. 8, 1995;82(5):701-8.
Monahan et al., Site-specific incorporation of unnatural amino acids into receptors expressed in Mammalian cells. Chem Biol. Jun. 2003;10(6):573-80.
Montange et al., Structure of the S-adenosylmethionine riboswitch regulatory mRNA element. Nature. Jun. 29, 2006;441(7097):1172-5.
Moore et al., Improved somatic mutagenesis in zebrafish using transcription activator-like effector nucleases (TALENs). PloS One. 2012;7(5):e37877. Doi: 10.1371/journal.pone.0037877. Epub May 24, 2012.
Mootz et al., Conditional protein splicing: a new tool to control protein structure and function in vitro and in vivo. J Am Chem Soc. Sep. 3, 2003;125(35):10561-9.
Mootz et al., Protein splicing triggered by a small molecule. J Am Chem Soc. Aug. 7, 2002;124(31):9044-5.
Morbitzer et al., Assembly of custom TALE-type DNA binding domains by modular cloning. Nucleic Acids Res. Jul. 2011;39(13):5790-9. doi: 10.1093/nar/gkrl51. Epub Mar. 18, 2011.
Morris et al., A peptide carrier for the delivery of biologically active proteins into mammalian cells. Nat Biotechnol. Dec. 2001;19(12):1173-6.
Moscou et al., A simple cipher governs DNA recognition by TAL effectors. Science. Dec. 11, 2009;326(5959):1501. doi: 10.1126/science. 1178817.
Mullins et al., Transgenesis in nonmurine species. Hypertension. Oct. 1993;22(4):630-3.
Mussolino et al., A novel TALE nuclease scaffold enables high genome editing activity in combination with low toxicity. Nucleic Acids Res. Nov. 2011;39(21):9283-93. Doi: 10.1093/nar/gkr597. Epub Aug. 3, 2011.
Mussolino et al., TALE nucleases: tailored genome engineering made easy. Curr Opin Biotechnol. Oct. 2012;23(5):644-50. doi: 10.1016/j.copbio.2012.01.013. Epub Feb. 17, 2012.
Nahvi et al., Coenzyme B12 riboswitches are widespread genetic control elements in prokaryotes. Nucleic Acids Res. Jan. 2, 2004;32(1):143-50.
Narayanan et al., Clamping down on weak terminal base pairs: oligonucleotides with molecular caps as fidelity-enhancing elements at the 5′- and 3′-terminal residues. Nucleic Acids Res. May 20, 2004;32(9):2901-11. Print 2004.
Navaratnam et al., An overview of cytidine deaminases. Int J Hematol. Apr. 2006;83(3): 195-200.
NCBI Reference Sequence: NM_002427.3. Wu et al., May 3, 2014. 5 pages.
Neel et al., Riboswitches: Classification, function and in silico approach, International Journal of Pharma Sciences and Research. 2010;1(9):409-420.
Nelson et al., Filamentous phage DNA cloning vectors: a noninfective mutant with a nonpolar deletion in gene III. Virology. 1981; 108(2): 338-50.
Ni et al., A PCSK9-binding antibody that structurally mimics the EGF(A) domain of LDL-receptor reduces LDL cholesterol in vivo. J Lipid Res. 2011;52:76-86.
Ni et al., Nucleic acid aptamers: clinical applications and promising new horizons. Curr Med Chem. 2011;18(27):4206-14. Review.
Nishida et al., Targeted nucleotide editing using hybrid prokaryotic and vertebrate adaptive immune systems. Science. Sep. 16, 2016;353(6305):1248. pii: aaf8729. doi: 10.1126/science.aaf8729. Epub Aug. 4, 2016.
Nishimasu et al., Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell. Feb. 27, 2014;156(5):935-49. doi: 10.1016/j.cell.2014.02.001. Epub Feb. 13, 2014.
Nishimasu et al., Crystal Structure of Staphylococcus aureus Cas9. Cell. Aug. 27, 2015;162(5):1113-26. doi: 10.1016/j.cell.2015.08.007.
Nomura et al., Controlling Mammalian Gene Expression by Allosteric Hepatitis Delta Virus Ribozymes. ACS Synth Biol. Dec. 20, 2013;2(12):684-9. doi: 10.1021/sb400037a. Epub May 22, 2013.
Nomura et al., Synthetic mammalian riboswitches based on guanine aptazyme. Chem Commun (Camb). Jul. 21, 2012;48(57):7215-7. doi: 10.1039/c2cc33140c. Epub Jun. 13, 2012.
Noris et al., A phenylalanine-55 to serine amino-acid substitution in the human glycoprotein IX leucine-rich repeat is associated with Bernard-Soulier syndrome. Br J Haematol. May 1997;97(2):312-20.
O'Connell et al., Programmable RNA recognition and cleavage by CRISPR/Cas9. Nature. Dec. 11, 2014;516(7530):263-6. doi: 10.1038/naturel3769. Epub Sep. 28, 2014.
Oakes et al., Protein engineering of Cas9 for enhanced function. Methods Enzymol. 2014;546:491-511.
Offord, Advances in Genome Editing. The Scientist, Apr. 20, 2016. http://www.the-scientist.com/?articles.view/articleNo/45903/title/Advances-in-Genome-Editing/.
Osborn et al., TALEN-based gene correction for epidermolysis bullosa. Mol Ther. Jun. 2013;21(6):1151-9. doi: 10.1038/mt.2013.56. Epub Apr. 2, 2013.
Pan et al., Biological and biomedical applications of engineered nucleases. Mol Biotechnol. Sep. 2013;55(1):54-62. doi: 10.1007/s12033-012-9613-9.
Parker et al., Admixture mapping identifies a quantitative trait locus associated with FEV1/FVC in the COPDGene Study. Genet Epidemiol. Nov. 2014;38(7):652-9. doi: 10.1002/gepi.21847. Epub Aug. 11, 2014.
Pattanayak et al., Determining the specificities of TALENs, Cas9, and other genome-editing enzymes. Methods Enzymol. 2014;546:47-78. doi: 10.1016/B978-0-12-801185-0.00003-9.
Pattanayak et al., High-throughput profiling of off-target DNA cleavage reveals RNA-programmed Cas9 nuclease specificity. Nat Biotechnol. Sep. 2013;31(9):839-43. doi: 10.1038/nbt.2673. Epub Aug. 11, 2013.
Pattanayak et al., Revealing off-target cleavage specificities of zinc-finger nucleases by in vitro selection. Nat Methods. Aug. 7, 2011;8(9):765-70. doi: 10.1038/nmeth.1670.
Pavletich et al., Zinc finger-DNA recognition: crystal structure of a Zif268-DNA complex at 2.1 A. Science. May 10, 1991;252(5007):809-17.
Pearl, Structure and function in the uracil-DNA glycosylase superfamily. Mutat Res. Aug. 30, 2000;460(3-4): 165-81.
Peck et al., Directed evolution of a small-molecule-triggered intein with improved splicing properties in mammalian cells. Chem Biol. May 27, 2011;18(5):619-30. doi: 10.1016/j.chembiol.2011.02.014.
Pelletier, CRISPR-Cas systems for the study of the immune function. Nov. 15, 2016. https://doi.org/10.1002/9780470015902.a0026896.
Pennisi et al., The CRISPR craze. Science. Aug. 23, 2013;341(6148):833-6. doi: 10.1126/science.341.6148.833.
Pennisi et al., The tale of the TALEs. Science. Dec. 14, 2012;338(6113): 1408-11. doi: 10.1126/science.338.6113.1408.
Perez et al., Establishment of HIV-1 resistance in CD4+ T cells by genome editing using zinc-finger nucleases. Nat Biotechnol. Jul. 2008;26(7):808-16. Doi: 10.1038/nbtl410. Epub Jun. 29, 2008.
Perez-Pinera et al., Advances in targeted genome editing. Curr Opin Chem Biol. Aug. 2012;16(3-4):268-77. doi: 10.1016/j.cbpa.2012.06.007. Epub Jul. 20, 2012.
Perez-Pinera et al., RNA-guided gene activation by CRISPR-Cas9-based transcription factors. Nat Methods. Oct. 2013;10(10):973-6. doi: 10.1038/nmeth.2600. Epub Jul. 25, 2013.
Petek et al., Frequent endonuclease cleavage at off-target locations in vivo. Mol Ther. May 2010;18(5):983-6. Doi: 10.1038/mt.2010.35. Epub Mar. 9, 2010.
Petolino et al., Editing Plant Genomes: a new era of crop improvement. Plant Biotechnol J. Feb. 2016;14(2):435-6. doi: 10.1111/pbi.12542.
Phillips, The challenge of gene therapy and DNA delivery. J Pharm Pharmacol. Sep. 2001;53(9): 1169-74.
Plasterk et al., DNA inversions in the chromosome of Escherichia coli and in bacteriophage Mu: relationship to other site-specific recombination systems. Proc Natl Acad Sci U S A. Sep. 1983;80(17):5355-8.
Plosky et al., CRISPR-Mediated Base Editing without DNA Double-Strand Breaks. Mol Cell. May 16, 2016;62(4):477-8. doi: 10.1016/j.molcel.2016.05.006.
Pluciennik et al., PCNA function in the activation and strand direction of MutL? endonuclease in mismatch repair. Proc Natl Acad Sci U S A. Sep. 14, 2010;107(37):16066-71. doi: 10.1073/pnas. 1010662107. Epub Aug. 16, 2010.
Poller et al., A leucine-to-proline substitution causes a defective alpha 1-antichymotrypsin allele associated with familial obstructive lung disease. Genomics. Sep. 1993;17(3):740-3.
Porteus, Design and testing of zinc finger nucleases for use in mammalian cells. Methods Mol Biol. 2008;435:47-61. doi: 10.1007/978-1-59745-232-8_4.
Pourcel et al., CRISPR elements in Yersinia pestis acquire new repeats by preferential uptake of bacteriophage DNA, and provide additional tools for evolutionary studies. Microbiology. Mar. 2005;151(Pt 3):653-63.
Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology 2013;31(9):833-8.
Prorocic et al., Zinc-finger recombinase activities in vitro. Nucleic Acids Res. Nov. 2011;39(21):9316-28. doi: 10.1093/nar/gkr652. Epub Aug. 17, 2011.
Proudfoot et al., Zinc finger recombinases with adaptable DNA sequence specificity. PLoS One. Apr. 29, 2011;6(4):e19537. doi: 10.1371/journal.pone.0019537.
Prykhozhij et al., CRISPR multitargeter: a web tool to find common and unique CRISPR single guide RNA targets in a set of similar sequences. PLoS One. Mar. 5, 2015;10(3):e0119372. doi: 10.1371/journal.pone.0119372. eCollection 2015.
Putnam et al., Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase. J Mol Biol. Mar. 26, 1999;287(2):331-46.
Qi et al., Engineering naturally occurring trans-acting non-coding RNAs to sense molecular signals. Nucleic Acids Res. Jul. 2012;40(12):5775-86. doi: 10.1093/nar/gks168. Epub Mar. 1, 2012.
Qi et al., Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression. Cell. Feb. 28, 2013;152(5): 1173-83. doi: 10.1016/j.cell.2013.02.022.
Rakonjac et al., Roles of PIII in filamentous phage assembly. J Mol Biol. 1998; 282(1)25-41.
Ramakrishna et al., Gene disruption by cell-penetrating peptide-mediated delivery of Cas9 protein and guide RNA. Genome Res. Jun. 2014;24(6): 1020-7. doi: 10.1101/gr.171264.113. Epub Apr. 2, 2014.
Ramirez et al., Engineered zinc finger nickases induce homology-directed repair with reduced mutagenic effects. Nucleic Acids Res. Jul. 2012;40(12):5560-8. doi: 10.1093/nar/gks179. Epub Feb. 28, 2012.
Ramirez et al., Unexpected failure rates for modular assembly of engineered zinc fingers. Nat Methods. May 2008;5(5):374-5. Doi: 10.1038/nmeth0508-374.
Ran et al., Double Nicking by RNA-guided CRISPR Cas9 for Enhanced Genome Editing Specificity. Cell. Sep. 12, 2013;154(6):1380-9. doi: 10.1016/j.cell.2013.08.021. Epub Aug. 26, 2013.
Ran et al., Genome engineering using the CRISPR-Cas9 system. Nat Protoc. Nov. 2013;8(11):2281-308. doi: 10.1038/nprot.2013.143. Epub Oct. 24, 2013.
Ran et al., In vivo genome editing using Staphylococcus aureus Cas9. Nature. Apr. 9, 2015;520(7546):186-91. doi: 10.1038/nature14299. Epub Apr. 1, 2015.
Rath et al., Fidelity of end joining in mammalian episomes and the impact of Metnase on joint processing. BMC Mol Biol. Mar. 22, 2014;15:6. doi: 10.1186/1471-2199-15-6.
Ravishankar et al., X-ray analysis of a complex of Escherichia coli uracil DNA glycosylase (EcUDG) with a proteinaceous inhibitor. The structure elucidation of a prokaryotic UDG. Nuclei Acids Res. 26 (21): 4880-4887 (1998).
Ray et al., Homologous recombination: ends as the means. Trends Plant Sci. Oct. 2002;7(10):435-40.
Rebuzzini et al., New mammalian cellular systems to study mutations introduced at the break site by non-homologous end-joining. DNA Repair (Amst). May 2, 2005;4(5):546-55.
Rees et al., Improving the DNA specificity and applicability of base editing through protein engineering and protein delivery. Nat Commun. Jun. 6, 2017;8:15790. doi: 10.1038/ncomms15790.
Ren et al., In-line Alignment and Mg2? Coordination at the Cleavage Site of the env22 Twister Ribozyme. Nat Commun. Nov. 20, 2014;5:5534. doi: 10.1038/ncomms6534.
Ren et al., Pistol Ribozyme Adopts a Pseudoknot Fold Facilitating Site-Specific In-Line Cleavage. Nat Chem Biol. Sep. 2016;12(9):702-8. doi: 10.1038/nchembio.2125. Epub Jul. 11, 2016.
Reyon et al., FLASH assembly of TALENs for high-throughput genome editing. Nat Biotechnol. May 2012;30(5):460-5. doi: 10.1038/nbt.2170.
Richardson et al., Enhancing homology-directed genome editing by catalytically active and inactive CRISPR-Cas9 using asymmetric donor DNA. Nat Biotechnol. Mar. 2016;34(3):339-44. doi: 10.1038/nbt.3481. Epub Jan. 20, 2016.
Richter et al., Function and regulation of clustered regularly interspaced short palindromic repeats (CRISPR) / CRISPR associated (Cas) systems. Viruses. Oct. 19, 2012;4(10):2291-311. doi: 10.3390/v4102291.
Riechmann et al.,. The C-terminal domain of To1A is the coreceptor for filamentous phage infection of E. coli. Cell. 1997; 90(2):351-60. PMID:9244308.
Rong et al., Homologous recombination in human embryonic stem cells using CRISPR/Cas9 nickase and a long DNA donor template. Protein Cell. Apr. 2014;5(4):258-60. doi: 10.1007/s13238-014-0032-5.
Rowland et al., Regulatory mutations in Sin recombinase support a structure-based model of the synaptosome. Mol Microbiol. Oct. 2009;74(2):282-98. doi: 10.1111/j.1365-2958.2009.06756.x. Epub Jun. 8, 2009.
Rudolph et al., Synthetic riboswitches for the conditional control of gene expression in Streptomyces coelicolor. Microbiology. Jul. 2013;159(Pt 7):1416-22. doi: 10.1099/mic.0.067322-0. Epub May 15, 2013.
Sadelain et al., Safe harbours for the integration of new DNA in the human genome. Nat Rev Cancer. Dec. 1, 2011;12(1):51-8. doi: 10.1038/nrc3179.
Sage et al., Proliferation of functional hair cells in vivo in the absence of the retinoblastoma protein. Science. Feb. 18, 2005;307(5712): 1114-8. Epub Jan. 13, 2005.
Saleh-Gohari et al., Conservative homologous recombination preferentially repairs DNA double-strand breaks in the S phase of the cell cycle in human cells. Nucleic Acids Res. Jul. 13, 2004;32(12):3683-8. Print 2004.
Samal et al., Cationic polymers and their therapeutic potential. Chem Soc Rev. Nov. 7, 2012;41(21):7147-94. doi: 10.1039/c2cs35094g. Epub Aug. 10, 2012.
Sander et al., CRISPR-Cas systems for editing, regulating and targeting genomes. Nat Biotechnol. Apr. 2014;32(4):347-55. doi: 10.1038/nbt.2842. Epub Mar. 2, 2014.
Sander et al., In silico abstraction of zinc finger nuclease cleavage profiles reveals an expanded landscape of off-target sites. Nucleic Acids Res. Oct. 2013;41(19):e181. doi: 10.1093/nar/gkt716. Epub Aug. 14, 2013.
Sander et al., Targeted gene disruption in somatic zebrafish cells using engineered TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):697-8. doi: 10.1038/nbt.1934.
Sang, Prospects for transgenesis in the chick. Meeh Dev. Sep. 2004;121(9):1179-86.
Sanjana et al., A transcription activator-like effector toolbox for genome engineering. Nat Protoc. Jan. 5, 2012;7(1):171-92. doi: 10.1038/nprot.2011.431.
Santiago et al., Targeted gene knockout in mammalian cells by using engineered zinc-finger nucleases. Proc Natl Acad Sci USA. Apr. 15, 2008;105(15):5809-14. doi: 10.1073/pnas.0800940105. Epub Mar. 21, 2008.
Sapranauskas et al., The Streptococcus thermophilus CRISPR/Cas system provides immunity in Escherichia coli. Nucleic Acids Res. Nov. 2011;39(21):9275-82. doi: 10.1093/nar/gkr606. Epub Aug. 3, 2011.
Saraconi et al., The RNA editing enzyme APOBEC1 induces somatic mutations and a compatible mutational signature is present in esophageal adenocarcinomas. Genome Biol. Jul. 31, 2014;15(7):417. doi: 10.1186/s13059-014-0417-z.
Sashital et al., Mechanism of foreign DNA selection in a bacterial adaptive immune system. Mol Cell. Jun. 8, 2012;46(5):606-15. doi: 10.1016/j.molcel.2012.03.020. Epub Apr. 19, 2012.
Saudek et al., A preliminary trial of the programmable implantable medication system for insulin delivery. N Engl J Med. Aug. 31, 1989;321(9):574-9.
Schriefer et al., Low pressure DNA shearing: a method for random DNA sequence analysis. Nucleic Acids Res. Dec. 25, 1990;18(24):7455-6.
Schwank et al., Functional repair of CFTR by CRISPR/Cas9 in intestinal stem cell organoids of cystic fibrosis patients. Cell Stem Cell. Dec. 5, 2013;13(6):653-8. doi:10.1016/j.stem.2013.11.002.
Schwartz et al., Post-translational enzyme activation in an animal via optimized conditional protein splicing. Nat Chem Biol. Jan. 2007;3(1):50-4. Epub Nov. 26, 2006.
Schwarze et al., In vivo protein transduction: delivery of a biologically active protein into the mouse. Science. Sep. 3, 1999;285(5433):1569-72.
Sclimenti et al., Directed evolution of a recombinase for improved genomic integration at a native human sequence. Nucleic Acids Res. Dec. 15, 2001;29(24):5044-51.
Sefton et al., Implantable pumps. Crit Rev Biomed Eng. 1987;14(3):201-40.
Segal et al., Toward controlling gene expression at will: selection and design of zinc finger domains recognizing each of the 5′-GNN-3′ DNA target sequences. Proc Natl Acad Sci U SA. Mar. 16, 1999;96(6):2758-63.
Sells et al., Delivery of protein into cells using polycationic liposomes. Biotechniques. Jul. 1995;19(1):72-6, 78.
Semenova et al., Interference by clustered regularly interspaced short palindromic repeat (Crispr) is governed by a seed sequence. Proc Natl Acad Sci U S A. Jun. 21, 2011;108(25):10098-103. doi: 10.1073/pnas.1104144108. Epub Jun. 6, 2011.
Semple et al., Rational design of cationic lipids for siRNA delivery. Nat Biotechnol. Feb. 2010;28(2): 172-6. doi: 10.1038/nbt.l602. Epub Jan. 17, 2010.
Serganov et al., Coenzyme recognition and gene regulation by a flavin mononucleotide riboswitch. Nature. Mar. 12, 2009;458(7235):233-7. doi: 10.1038/nature07642. Epub Jan. 25, 2009.
Serganov et al., Structural basis for discriminative regulation of gene expression by adenine-and guanine-sensing mRNAs. Chem Biol. Dec. 2004;11(12):1729-41.
Serganov et al., Structural basis for gene regulation by a thiamine pyrophosphate-sensing riboswitch. Nature. Jun. 29, 2006;441(7097):1167-71. Epub May 21, 2006.
Seripa et al., The missing ApoE allele. Ann Hum Genet. Jul. 2007;71(Pt 4):496-500. Epub Jan. 22, 2007.
Shah et al., Inteins: nature's gift to protein chemists. Chem Sci. 2014;5(1):446-461.
Shah et al., Kinetic control of one-pot trans-splicing reactions by using a wild-type and designed split intein. Angew Chem Int Ed Engl. Jul. 11, 2011;50(29):6511-5. doi: 10.1002/anie.201102909. Epub Jun. 8, 2011.
Shah et al., Target-specific variants of Flp recombinase mediate genome engineering reactions in mammalian cells. FEBS J. Sep. 2015;282(17):3323-33. doi: 10.1111/febs. 13345. Epub Jul. 1, 2015.
Shalem et al., Genome-scale CRISPR-Cas9 knockout screening in human cells. Science. Jan. 3, 2014;343(6166):84-7. doi: 10.1126/science. 1247005. Epub Dec. 12, 2013.
Sharbeen et al., Ectopic restriction of DNA repair reveals that UNG2 excises AID-induced uracils predominantly or exclusively during G1 phase. J Exp Med. May 7, 2012;209(5):965-74. doi: 10.1084/jem.20112379. Epub Apr. 23, 2012.
Sharma et al., Efficient introduction of aryl bromide functionality into proteins in vivo. FEBS Lett. Feb. 4, 2000;467(1):37-40.
Shcherbakova et al., Near-infrared fluorescent proteins for multicolor in vivo imaging. Nat Methods. Aug. 2013;10(8):751-4. doi: 10.1038/nmeth.2521. Epub Jun. 16, 2013.
Shee et al., Engineered proteins detect spontaneous DNA breakage in human and bacterial cells. Elife. Oct. 29, 2013;2:e01222. doi: 10.7554/eLife.01222.
Sheridan, First CRISPR-Cas patent opens race to stake out intellectual property. Nat Biotechnol. 2014;32(7):599-601.
Sheridan, Gene therapy finds its niche. Nat Biotechnol. Feb. 2011;29(2):121-8. doi: 10.1038/nbt.1769.
Shimantani et al., Targeted base editing in rice and tomato using a CRISPR-Cas9 cytidine deaminase fusion. Nat Biotechnol. May 2017;35(5):441-443. doi: 10.1038/nbt.3833. Epub Mar. 27, 2017.
Shimojima et al., Spinocerebellar ataxias type 27 derived from a disruption of the fibroblast growth factor 14 gene with mimicking phenotype of paroxysmal non-kinesigenic dyskinesia. Brain Dev. Mar. 2012;34(3):230-3. doi: 10.1016/j.braindev.2011.04.014. Epub May 19, 2011.
Shmakov et al., Discovery and Functional Characterization of Diverse Class 2 CRISPR Cas Systems. Molecular Cell Nov. 2015;60(3):385-97.
Siebert et al., An improved PCR method for walking in uncloned genomic DNA. Nucleic Acids Res. Mar. 25, 1995;23(6): 1087-8.
Simonelli et al., Base excision repair intermediates are mutagenic in mammalian cells. Nucleic Acids Res. Aug. 2, 2005;33(14):4404-11. Print 2005.
Sirk et al., Expanding the zinc-finger recombinase repertoire: directed evolution and mutational analysis of serine recombinase specificity determinants. Nucleic Acids Res. Apr. 2014;42(7):4755-66. doi: 10.1093/nar/gkt1389. Epub Jan. 21, 2014.
Sjoblom et al., The consensus coding sequences of human breast and colorectal cancers. Science. Oct. 13, 2006;314(5797):268-74. Epub Sep. 7, 2006.
Skretas et al., Regulation of protein activity with small-molecule-controlled inteins. Protein Sci. Feb. 2005;14(2):523-32. Epub Jan. 4, 2005.
Slaymaker et al., Rationally engineered Cas9 nucleases with improved specificity. Science. Jan. 1, 2016;351(6268):84-8. doi: 10.1126/science.aad5227. Epub Dec. 1, 2015.
Smith et al., Expression of a dominant negative retinoic acid receptor .gamma. in Xenopus embryos leads to partial resistance to retinoic acid. Roux Arch Dev Biol. Mar. 1994;203(5):254-265. doi: 10.1007/BF00360521.
Smith, Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface. Science. Jun. 14, 1985;228(4705):1315-7.
Stenglein et al., APOBEC3 proteins mediate the clearance of foreign DNA from human cells. Nat Struct Mol Biol. Feb. 2010;17(2):222-9. doi: 10.1038/nsmb.1744. Epub Jan. 10, 2010.
Stephens et al., The landscape of cancer genes and mutational processes in breast cancer. Nature Jun. 2012;486:400-404. doi: 10.1038/naturel 1017.
Sternberg et al., DNA interrogation by the CRISPR RNA-guided endonuclease Cas9. Nature.Mar. 6, 2014;507(7490):62-7. doi: 10.1038/naturel3011. Epub Jan. 29, 2014.
Stevens et al., Design of a Split Intein with Exceptional Protein-Splicing Activity. J Am Chem Soc. Feb. 24, 2016;138(7):2162-5. doi: 10.1021/jacs.5b13528. Epub Feb. 8, 2016.
Sudarsan et al., An mRNA structure in bacteria that controls gene expression by binding lysine. Genes Dev. Nov. 1, 2003; 17(21):2688-97.
Suess et al., A theophylline responsive riboswitch based on helix slipping controls gene expression in vivo. Nucleic Acids Res. Mar. 5, 2004;32(4):1610-4.
Sun et al., Optimized TAL effector nucleases (TALENs) for use in treatment of sickle cell disease. Mol Biosyst. Apr. 2012;8(4):1255-63. doi: 10.1039/c2mb05461b. Epub Feb. 3, 2012.
Swarts et al., Argonaute of the archaeon Pyrococcus furiosus is a DNA-guided nuclease that targets cognate DNA. Nucleic Acids Res. May 26, 2015;43(10):5120-9. doi: 10.1093/nar/gkv415. Epub Apr. 29, 2015.
Swarts et al., DNA-guided DNA interference by a prokaryotic Argonaute. Nature. Mar. 13, 2014;507(7491):258-61. doi: 10.1038/nature12971. Epub Feb. 16, 2014.
Swarts et al., The evolutionary journey of Argonaute proteins. Nat Struct Mol Biol. Sep. 2014;21(9):743-53. doi: 10.1038/nsmb.2879.
Szczepek et al., Structure-based redesign of the dimerization interface reduces the toxicity of zinc-finger nucleases. Nat Biotechnol. Jul. 2007;25(7):786-93. Epub Jul. 1, 2007.
Tagalakis et al., Lack of RNA-DNA oligonucleotide (chimeraplast) mutagenic activity in mouse embryos. Mol Reprod Dev. Jun. 2005;71(2):140-4.
Tang et al., Aptazyme-embedded guide RNAs enable ligand-responsive genome editing and transcriptional activation. Nat Commun. Jun. 28, 2017;8:15939. doi: 10.1038/ncomms15939.
Tebas et al., Gene editing of CCR5 in autologous CD4 T cells of persons infected with HIV. N Engl J Med. Mar. 6, 2014;370(10):901-10. doi: 10.1056/NEJMoa1300662.
Tessarollo et al., Targeted mutation in the neurotrophin-3 gene results in loss of muscle sensory neurons. Proc Natl Acad Sci U S A. Dec. 6, 1994;91(25): 11844-8.
Tesson et al., Knockout rats generated by embryo microinjection of TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):695-6. doi: 10.1038/nbt.1940.
Thompson et al., Cellular uptake mechanisms and endosomal trafficking of supercharged proteins. Chem Biol. Jul. 27, 2012;19(7):831-43. doi: 10.1016/j.chembiol.2012.06.014.
Thompson et al., Engineering and identifying supercharged proteins for macromolecule delivery into mammalian cells. Methods Enzymol. 2012;503:293-319. doi: 10.1016/B978-0-12396962-0.00012-4.
Thorpe et al., Functional correction of episomal mutations with short DNA fragments and RNA-DNA oligonucleotides. J Gene Med. Mar.-Apr. 2002;4(2):195-204.
Thyagarajan et al., Mammalian genomes contain active recombinase recognition sites. Gene. Feb. 22, 2000;244(1-2):47-54.
Thyagarajan et al., Site-specific genomic integration in mammalian cells mediated by phage phiC31 integrase. Mol Cell Biol. Jun. 2001;21(12):3926-34.
Trumalai et al., Recognition of core-type DNA sites by lambda integrase. J Mol Biol. Jun. 12, 1998;279(3):513-27.
Tourdot et al., A general strategy to enhance immunogenicity of low-affinity HLA-A2. 1-associated peptides: implication in the identification of cryptic tumor epitopes. Eur J Immunol. Dec. 2000;30(12):3411-21.
Trausch et al., The structure of a tetrahydrofolate-sensing riboswitch reveals two ligand binding sites in a single aptamer. Structure. Oct. 12, 2011;19(10): 1413-23. doi: 10.1016/j.str.2011.06.019. Epub Sep. 8, 2011.
Truong et al., Development of an intein-mediated split-Cas9 system for gene therapy. Nucleic Acids Res. Jul. 27, 2015;43(13):6450-8. doi: 10.1093/nar/gkv601. Epub Jun. 16, 2015. With Supplementary Data.
Tsai et al., Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editing. Nat Biotechnol. Jun. 2014;32(6):569-76. doi: 10.1038/nbt.2908. Epub Apr. 25, 2014.
Tsai et al., GUIDE-seq enables genome-wide profiling of off-target cleavage by CRISPR-Cas nucleases. Nat Biotechnol. Feb. 2015;33(2):187-97. doi: 10.1038/nbt.3117. Epub Dec. 16, 2014.
Turan et al., Recombinase-mediated cassette exchange (RMCE)--a rapidly-expanding toolbox for targeted genomic modifications. Gene. Feb. 15, 2013;515(1): 1-27. doi: 10.1016/j.gene.2012.11.016. Epub Nov. 29, 2012.
Turan et al., Recombinase-mediated cassette exchange (RMCE): traditional concepts and current challenges. J Mol Biol. Mar. 25, 2011;407(2): 193-221. doi: 10.1016/j.jmb.2011.01.004. Epub Jan. 15, 2011.
Turan et al., Site-specific recombinases: from tag-and-target- to tag-and-exchange-based genomic modifications. FASEB J. Dec. 2011;25(12):4088-107. doi: 10.1096/fj.11-186940. Epub Sep. 2, 2011. Review.
UniProt Submission; UniProt, Accession No. P01011. Last modified Jun. 11, 2014, version 2. 15 pages.
UniProt Submission; UniProt, Accession No. P01011. Last modified Sep. 18, 2013, version 2. 15 pages..
UniProt Submission; UniProt, Accession No. P04264. Last modified Jun. 11, 2014, version 6. 15 pages.
UniProt Submission; UniProt, Accession No. P04275. Last modified Jul. 9, 2014, version 107. 29 pages.
Urnov et al., Genome editing with engineered zinc finger nucleases. Nat Rev Genet. Sep. 2010;11(9):636-46. doi: 10.1038/nrg2842.
Urnov et al., Highly efficient endogenous human gene correction using designed zinc-finger nucleases. Nature. Jun. 2, 2005;435(7042):646-51. Epub Apr. 3, 2005.
Vagner et al., Efficiency of homologous DNA recombination varies along the Bacillus subtilis chromosome. J Bacteriol. Sep. 1988;170(9):3978-82.
Van Duyne et al., Teaching Cre to follow directions. Proc Natl Acad Sci U S A. Jan. 6, 2009;106(1):4-5. doi: 10.1073/pnas.0811624106. Epub Dec. 31, 2008.
Van Swieten et al., A mutation in the fibroblast growth factor 14 gene is associated with autosomal dominant cerebellar ataxia [corrected]. Am J Hum Genet. Jan. 2003;72(1):191-9. Epub Dec. 13, 2002.
Vanamee et al., FokI requires two specific DNA sites for cleavage. J Mol Biol. May 25, 2001;309(1):69-78.
Vitreschak et al., Regulation of the vitamin B12 metabolism and transport in bacteria by a conserved RNA structural element. RNA. Sep. 2003;9(9): 1084-97.
Wacey et al., Disentangling the perturbational effects of amino acid substitutions in the DNA-binding domain of p53. Hum Genet. Jan. 1999;104(1):15-22.
Wadia et al., Modulation of cellular function by TAT mediated transduction of full length proteins. Curr Protein Pept Sci. Apr. 2003;4(2):97-104.
Wadia et al., Transducible TAT-HA fusogenic peptide enhances escape of TAT-fusion proteins after lipid raft macropinocytosis. Nat Med. Mar. 2004;10(3):310-5. Epub Feb. 8, 2004.
Wah et al., Structure of FokI has implications for DNA cleavage. Proc Natl Acad Sci U S A. Sep. 1, 1998;95(18):10564-9.
Wals et al., Unnatural amino acid incorporation in E. coli: current and future applications in the design of therapeutic proteins. Front Chem. Apr. 1, 2014;2:15. doi: 10.3389/fchem.2014.00015. eCollection 2014.
Wang et al., CRISPR-Cas9 Targeting of PCSK9 in Human Hepatocytes In Vivo-Brief Report. Arterioscler Thromb Vase Biol. May 2016;36(5):783-6. doi: 10.1161/ATVBAHA.116.307227. Epub Mar. 3, 2016.
Wang et al., Efficient delivery of genome-editing proteins using bioreducible lipid nanoparticles. Proc Natl Acad Sci USA. Feb. 29, 2016. pii: 201520244. [Epub ahead of print].
Wang et al., Enhanced base editing by co-expression of free uracil DNA glycosylase inhibitor. Cell Res. Oct. 2017;27(1):1289-92. doi: 10.1038/cr.2017.111. Epub Aug. 29, 2017.
Wang et al., Genetic screens in human cells using the CRISPR-Cas9 system. Science. Jan. 3, 2014;343(6166):80-4. doi: 10.1126/science.1246981. Epub Dec. 12, 2013.
Wang et al., Nucleation, propagation and cleavage of target RNAs in Ago silencing complexes. Nature. Oct. 8, 2009;461(7265):754-61. doi: 10.1038/nature08434.
Wang et al., One-step generation of mice carrying mutations in multiple genes by CRISPR/Cas-mediated genome engineering. Cell. May 9, 2013;153(4):910-8. doi: 10.1016/j.cell.2013.04.025. Epub May 2, 2013.
Wang et al., Recombinase technology: applications and possibilities. Plant Cell Rep. Mar. 2011;30(3):267-85. doi: 10.1007/s00299-010-0938-1. Epub Oct. 24, 2010.
Wang et al., Riboswitches that sense S-adenosylhomocysteine and activate genes involved in coenzyme recycling. Mol Cell. Mar. 28, 2008;29(6):691-702. doi: 10.1016/j.molcel.2008.01.012.
Wang et al., Targeted gene addition to a predetermined site in the human genome using a ZFN-based nicking enzyme. Genome Res. Jul. 2012;22(7): 1316-26. doi: 10.1101/gr.122879.111. Epub Mar. 20, 2012.
Wang et al., Uracil-DNA glycosylase inhibitor gene of bacteriophage PBS2 encodes a binding protein specific for uracil-DNA glycosylase. J Biol Chem. Jan. 15, 1989;264(2):1163-71.
Warren et al., A chimeric Cre recombinase with regulated directionality. Proc Natl Acad Sci USA. Nov. 25, 2008;105(47):18278-83. doi: 10.1073/pnas.0809949105. Epub Nov. 14, 2008.
Warren et al., Mutations in the amino-terminal domain of lambda-integrase have differential effects on integrative and excisive recombination. Mol Microbiol. Feb. 2005;55(4): 1104-12.
Weber et al., Assembly of designer TAL effectors by Golden Gate cloning. PLoS One. 2011;6(5):e19722. doi:10.1371/journal.pone.0019722. Epub May 19, 2011.
Weinberg et al., New Classes of Self-Cleaving Ribozymes Revealed by Comparative Genomics Analysis. Nat Chem Biol. Aug. 2015;11(8):606-10. doi: 10.1038/nchembio.1846. Epub Jul. 13, 2015.
Weinberg et al., The aptamer core of SAM-IV riboswitches mimics the ligand-binding site of SAM-I riboswitches. RNA. May 2008;14(5):822-8. doi: 10.1261/rna.988608. Epub Mar. 27, 2008.
Weinberger et al., Disease-causing mutations C277R and C277Y modify gating of human C1C-1 chloride channels in myotonia congenita. J Physiol. Aug. 1, 2012;590(Pt 15):3449-64. doi: 0.1113/jphysiol.2012.232785. Epub May 28, 2012.
Wiedenheft et al., RNA-guided genetic silencing systems in bacteria and archaea. Nature. Feb. 15, 2012;482(7385):331-8. doi: 10.1038/nature10886. Review.
Wijesinghe et al., Efficient deamination of 5-methylcytosines in DNA by human APOBEC3A, but not by AID or APOBEC3G. Nucleic Acids Res. Oct. 2012;40(18):9206-17. doi: 10.1093/nar/gks685. Epub Jul. 13, 2012.
Wijnker et al., Managing meiotic recombination in plant breeding. Trends Plant Sci. Dec. 2008;13(12):640-6. doi: 10.1016/j.tplants.2008.09.004. Epub Oct. 22, 2008.
Wilson et al., In Vitro Selection of Functional Nucleic Acids. Annu Rev Biochem. 1999;68:611-47. doi: 10.1146/annurev.biochem.68.1.611.
Winkler et al., An mRNA structure that controls gene expression by binding FMN. Proc Natl Acad Sci U S A. Dec. 10, 2002;99(25):15908-13. Epub Nov. 27, 2002.
Winkler et al., Control of gene expression by a natural metabolite-responsive ribozyme. Nature. Mar. 18, 2004;428(6980):281-6.
Winkler et al., Thiamine derivatives bind messenger RNAs directly to regulate bacterial gene expression. Nature. Oct. 31, 2002;419(6910):952-6. Epub Oct. 16, 2002.
Wolf et al., tadA, an essential tRNA-specific adenosine deaminase from Escherichia coli. EMBO J. Jul. 15, 2002;21(14):3841-51.
Wolfe et al., Analysis of zinc fingers optimized via phage display: evaluating the utility of a recognition code. J Mol Biol. Feb. 5, 1999;285(5):1917-34.
Wood et al., Targeted genome editing across species using ZFNs and TALENs. Science. Jul. 15, 2011;333(6040):307. doi: 10.1126/science.1207773. Epub Jun. 23, 2011.
Wu et al., Correction of a genetic disease in mouse via use of CRISPR-Cas9. Cell Stem Cell. Dec. 5, 2013;13(6):659-62. doi: 10.1016/j.stem.2013.10.016.
Wu et al., Genome-wide binding of the CRISPR endonuclease Cas9 in mammalian cells. Nat Biotechnol. Jul. 2014;32(7):670-6. doi: 10.1038/nbt.2889. Epub Apr. 20, 2014.
Xu et al., Sequence determinants of improved CRISPR sgRNA design. Genome Res. Aug. 2015;25(8): 1147-57. doi: 10.1101/gr. 191452.115. Epub Jun. 10, 2015.
Yahata et al., Unified, Efficient, and Scalable Synthesis of Halichondrins: Zirconium/Nickel-Mediated One-Pot Ketone Synthesis as the Final Coupling Reaction. Angew Chem Int Ed Engl. Aug. 28, 2017;56(36):10796-10800. doi: 10.1002/anie.201705523. Epub Jul. 28, 2017.
Yamamoto et al., Virological and immunological bases for HIV-1 vaccine design. Uirusu 2007;57(2): 133-139. https://doi.org/10.2222/jsv.57.133.
Yamano et al., Crystal Structure of Cpfl in Complex with Guide RNA and Target DNA. Cell May 2016;165(4)949-62.
Yang et al., APOBEC: From mutator to editor. J Genet Genomics. Sep. 20, 2017;44(9):423-437. doi: 10.1016/j.jgg.2017.04.009. Epub Aug. 7, 2017.
Yang et al., Engineering and optimising deaminase fusions for genome editing. Nat Commun. Nov. 2, 2016;7:13330. doi: 10.1038/ncomms13330.
Yang et al., Genome editing with targeted deaminases. BioRxiv. Preprint. First posted online Jul. 28, 2016.
Yang et al., New CRISPR-Cas systems discovered. Cell Res. Mar. 2017;27(3):313-314. doi: 10.1038/cr.2017.21. Epub Feb. 21, 2017.
Yang et al., PAM-dependent Target DNA Recognition and Cleavage by C2C1 CRISPR-Cas endonuclease. Cell Dec. 2016;167(7):1814-28.
Yanover et al., Extensive protein and DNA backbone sampling improves structure-based specificity prediction for C2H2 zinc fingers. Nucleic Acids Res. Jun. 2011;39(11):4564-76. doi: 10.1093/nar/gkr048. Epub Feb. 22, 2011.
Yazaki et al., Hereditary systemic amyloidosis associated with a new apolipoprotein AII stop codon mutation Stop78Arg. Kidney Int. Jul. 2003;64(l): 11-6.
Yin et al., Genome editing with Cas9 in adult mice corrects a disease mutation and phenotype. Nat Biotechnol. Jun. 2014;32(6):551-3. doi: 10.1038/nbt.2884. Epub Mar. 30, 2014.
Young et al., Beyond the canonical 20 amino acids: expanding the genetic lexicon. J Biol Chem. Apr. 9, 2010;285(15):11039-44. doi: 10.1074/jbc.R109.091306. Epub Feb. 10, 2010.
Yuan et al., Laboratory-directed protein evolution. Microbiol Mol Biol Rev. 2005; 69(3):373-92. PMID: 16148303.
Yuan et al., Tetrameric structure of a serine integrase catalytic domain. Structure. Aug. 6, 2008;16(8): 1275-86. doi: 10.1016/j.str.2008.04.018.
Yuen et al., Control of transcription factor activity and osteoblast differentiation in mammalian cells using an evolved small-molecule-dependent intein. J Am Chem Soc. Jul. 12, 2006;128(27):8939-46.
Zelphati et al., Intracellular delivery of proteins with a new lipid-mediated delivery system. J Biol Chem. Sep. 14, 2001;276(37):35103-10. Epub Jul. 10, 2001.
Zetsche et al., A split-Cas9 architecture for inducible genome editing and transcription modulation. Nat Biotechnol. Feb. 2015;33(2): 139-42. doi: 10.1038/nbt.3149.
Zetsche et al., Cpf1 is a single RNA-guided endonuclease of a class 2 CRISPR-Cas system. Cell. Oct. 22 2015;163(3):759-71. doi: 10.1016/j.cell.2015.09.038. Epub Sep. 25, 2015.
Zhang et al., Comparison of non-canonical PAMs for CRISPR/Cas9-mediated DNA cleavage in human cells. Sci Rep. Jun. 2014;4:5405.
Zhang et al., Conditional gene manipulation: Cre-ating a new biological era. J Zhejiang Univ Sci B. Jul. 2012; 13(7):511-24. doi: 10.1631/jzus.B1200042. Review.
Zhang et al., CRISPR/Cas9 for genome editing: progress, implications and challenges. Hum Mol Genet. Sep. 15, 2014;23(R1):R40-6. doi: 10.1093/hmg/ddu125. Epub Mar. 20, 2014.
Zhang et al., Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription. Nat Biotechnol. Feb. 2011;29(2): 149-53. doi: 10.1038/nbt.1775. Epub Jan. 19, 2011.
Zhang et al., Programmable base editing of zebrafish genome using a modified CRISPR-Cas9 system. Nat Commun. Jul. 25, 2017;8(1):118. doi: 10.1038/s41467-017-00175-6.
Zhang et al., Ribozymes and Riboswitches: Modulation of RNA Function by Small Molecules. Biochemistry. Nov. 2, 2010;49(43):9123-31. doi: 10.1021/bi1012645.
Zhang et al., Stabilized plasmid-lipid particles for regional gene therapy: formulation and transfection properties. Gene Ther. Aug. 1999;6(8):1438-47.
Zheng et al., DNA editing in DNA/RNA hybrids by adenosine deaminases that act on RNA. Nucleic Acids Res. Apr. 7, 2017;45(6):3369-3377. doi: 10.1093/nar/gkx050.
Zhong et al., Rational Design of Aptazyme Riboswitches for Efficient Control of Gene Expression in Mammalian Cells. Elife. Nov. 2, 2016;5:el8858. doi: 10.7554/eLife.18858.
Zimmermann et al., Molecular interactions and metal binding in the theophylline-binding core of an RNA aptamer. RNA. May 2000;6(5):659-67.
Zong et al., Precise base editing in rice, wheat and maize with a Cas9-cytidine deaminase fusion. Nat Biotechnol. May 2017;35(5):438-440. doi: 10.1038/nbt.3811. Epub Feb. 27, 2017.
Zorko et al., Cell-penetrating peptides: mechanism and kinetics of cargo delivery. Adv Drug Deliv Rev. Feb. 28, 2005;57(4):529-45. Epub Jan. 22, 2005.
Zou et al., Gene targeting of a disease-related gene in human induced pluripotent stem and embryonic stem cells. Cell Stem Cell. Jul. 2, 2009;5(1):97-110. doi: 10.1016/j.stem.2009.05.023. Epub Jun. 18, 2009.
Zuris et al., Cationic lipid-mediated delivery of proteins enables efficient protein-based genome editing in vitro and in vivo. Nat Biotechnol. 2015;33:73-80.
U.S. Appl. No. 61/836,080.
U.S. Appl. No. 62/498,686.
U.S. Appl. No. 17/160,329, Liu et al., filed Jan. 27, 2021.
U.S. Appl. No. 17/130,812, Liu et al., filed Dec. 22, 2020.
U.S. Appl. No. 17/148,059, Liu et al., filed Jan. 13, 2021.
U.S. Appl. No. 16/976,047, Liu et al., filed Aug. 26, 2020.
U.S. Appl. No. 17/289,665, Liu et al., filed Apr. 28, 2021.
U.S. Appl. No. 16/772,747, Shen et al., filed Jun. 12, 2020.
U.S. Appl. No. 17/425,261, Kim et al., filed Jul. 22, 2021.
U.S. Appl. No. 17/270,396, Liu et al., filed Feb. 22, 2021.
U.S. Appl. No. 17/273,688, Liu et al., filed Mar. 4, 2021.
U.S. Appl. No. 17/288,504, Liu et al., filed Apr. 23, 2021.
U.S. Appl. No. 17/219,590, Liu et al., filed Mar. 31, 2021.
U.S. Appl. No. 17/219,635, Liu et al., filed Mar. 31, 2021.
U.S. Appl. No. 17/219,672, Liu et al., filed Mar. 31, 2021.
U.S. Appl. No. 17/294,287, Liu et al., filed May 14, 2021.
U.S. Appl. No. 17/408,306, Liu et al., filed Aug. 20, 2021.
U.S. Appl. No. 17/436,048, Liu et al., filed Sep. 2, 2021.
[No. Author Listed] “Human genome.” Encyclopedia Britannica. Encyclopedia Brittanica, Inc. Published Feb. 15, 2019. Last accessed online via https://www.britannica.com/science/human-genome on Mar. 19, 2021. 2 pages.
[No. Author Listed] HyPhy—Hypothesis testing using Phylogenies. Last modified Apr. 21, 2017. Accessed online via http://hyphy.org/w/index.php/Main_Page on Apr. 28, 2021.
[No. Author Listed] NCBI Accession No. XP_015843220.1. C ->U editing enzyme APOBEC-1 [Peromyscus maniculatus bairdii], XP002793540. Mar. 21, 2016.
[No. Author Listed] NCBI Accession No. XP_021505673.1. C ->U editing enzyme APOBEC-1 [Meriones unguiculatus], XP002793541. Jun. 27, 2017.
Abremski et al., Bacteriophage P1 site-specific recombination. Purification and properties of the Cre recombinase protein. J Biol Chem. Feb. 10, 1984;259(3):1509-14.
Abudayyeh et al., A cytosine deaminase for programmable single-base RNA editing. Science. Jul. 26, 2019;365(6451):382-386. doi: 10.1126/science.aax7063. Epub Jul. 11, 2019.
Abudayyeh et al., RNA targeting with CRISPR-Cas13. Nature. Oct. 12, 2017;550(7675):280-284. doi: 10.1038/nature24049. Epub Oct. 4, 2017.
Ada et al., Carbohydrate-protein conjugate vaccines. Clin Microbiol Infect. Feb. 2003;9(2):79-85. doi: 10.1046/j.1469-0691.2003.00530.x.
Adamala et al., Programmable RNA-binding protein composed of repeats of a single modular unit. Proc Natl Acad Sci U S A. May 10, 2016;113(19):E2579-88. doi: 10.1073/pnas.l519368113. Epub Apr. 26, 2016.
Adams et al., New biarsenical ligands and tetracysteine motifs for protein labeling in vitro and in vivo: synthesis and biological applications. J Am Chem Soc. May 29, 2002;124(21):6063-76. doi: 10.1021/ja017687n.
Adli, The CRISPR tool kit for genome editing and beyond. Nat Commun. May 15, 2018;9(1):1911. doi: 10.1038/s41467-018-04252-2.
Aguilo et al., Coordination of m(6)A mRNA Methylation and Gene Transcription by ZFP217 Regulates Pluripotency and Reprogramming. Cell Stem Cell. Dec. 3, 2015;17(6):689-704. doi: 10.1016/j.stem.2015.09.005. Epub Oct. 29, 2015.
Ahmad et al., Antibody-mediated specific binding and cytotoxicity of liposome-entrapped doxorubicin to lung cancer cells in vitro. Cancer Res. Sep. 1, 1992;52(17):4817-20.
Aik et al., Structure of human RNA N?-methyladenine demethylase ALKBH5 provides insights into its mechanisms of nucleic acid recognition and demethylation. Nucleic Acids Res. Apr. 2014;42(7):4741-54. doi: 10.1093/nar/gku085. Epub Jan. 30, 2014.
Aird et al., Increasing Cas9-mediated homology-directed repair efficiency through covalent tethering of DNA repair template. Commun Biol. May 31, 2018; 1:54. doi: 10.1038/s42003-018-0054-2.
Akcakaya et al., In vivo CRISPR editing with no detectable genome-wide off-target mutations. Nature. Sep. 2018;561(7723):416-419. doi: 10.1038/s41586-018-0500-9. Epub Sep. 12, 2018. PMID: 30209390; PMCID: PMC6194229.
Akins et al., Mitochondrial plasmids of Neurospora: integration into mitochondrial DNA and evidence for reverse transcription in mitochondria. Cell. Nov. 21, 1986;47(4):505-16. doi: 10.1016/0092-8674(86)90615-x.
Akinsheye et al., Fetal hemoglobin in sickle cell anemia. Blood. Jul. 7, 2011; 118(1): 19-27. doi: 10.1182/blood-2011-03-325258. Epub Apr. 13, 2011.
Alarcón et al., HNRNPA2B1 Is a Mediator of m(6)A-Dependent Nuclear RNA Processing Events. Cell. Sep. 10, 2015;162(6): 1299-308. doi: 10.1016/j.cell.2015.08.011. Epub Aug. 27, 2015.
Alarcón et al., N6-methyladenosine marks primary microRNAs for processing. Nature. Mar. 26, 2015;519(7544):482-5. doi: 10.1038/naturel4281. Epub Mar. 18, 2015.
Alexander, HFE-associated hereditary hemochromatosis. Genet Med. May 2009;11(5):307-13. doi: 10.1097/GIM.0b013e31819d30f2.
Altschul et al., Basic local alignment search tool. J Mol Biol. Oct. 5, 1990;215(3):403-10. doi: 10.1016/S0022-2836(05)80360-2.
Amato et al., Interpreting elevated fetal hemoglobin in pathology and health at the basic laboratory level: new and known ?—gene mutations associated with hereditary persistence of fetal hemoglobin. Int J Lab Hematol. Feb. 2014;36(1):13-9. doi: 10.1111/ijlh.12094. Epub Apr. 29, 2013.
Amrann et al., Tightly regulated tac promoter vectors useful for the expression of unfused and fused proteins in Escherichia coli. Gene. Sep. 30, 1988;69(2):301-15.
Anders et al., Chapter One: In Vitro Enzymology of Cas9. in Methods in Enzymology, eds Doudna et al. 2014:546:1-20.
Anderson, Human gene therapy. Science. May 8, 1992;256(5058):808-13. doi: 10.1126/science. 1589762.
Anzalone et al., Reprogramming eukaryotic translation with ligand-responsive synthetic RNA switches. Nat Methods. May 2016;13(5):453-8. doi: 10.1038/nmeth.3807. Epub Mar. 21, 2016.
Aplan, Causes of oncogenic chromosomal translocation. Trends Genet. Jan. 2006;22(1):46-55. doi: 10.1016/j.tig.2005.10.002. Epub Oct. 28, 2005.
Arakawa et al., A method to convert mRNA into a gRNA library for CRISPR/Cas9 editing of any organism. Sci Adv. Aug. 24, 2016;2(8):e1600699. doi: 10.1126/sciadv. 1600699.
Araki et al., Comparative analysis of right element mutant lox sites on recombination efficiency in embryonic stem cells. BMC Biotechnol. Mar. 31, 2010;10:29. doi: 10.1186/1472-6750-10-29.
Araki et al., Site-specific recombinase, R, encoded by yeast plasmid pSRl. J Mol Biol. May 5, 1992;225(l):25-37. doi: 10.1016/0022-2836(92)91023-i.
Araki et al., Targeted integration of DNA using mutant lox sites in embryonic stem cells. Nucleic Acids Res. Feb. 15, 1997;25(4):868-72. doi: 10.1093/nar/25.4.868.
Arambula et al., Surface display of a massively variable lipoprotein by a Legionella diversity-generating retroelement. Proc Natl Acad Sci USA. May 14, 2013;110(20):8212-7. doi: 10.1073/pnas. 1301366110. Epub Apr. 30, 2013.
Arazoe et al., Targeted Nucleotide Editing Technologies for Microbial Metabolic Engineering. Biotechnol J. Sep. 2018;13(9):e1700596. doi: 10.1002/biot.201700596. Epub Jun. 19, 2018.
Arbab et al., Cloning-free CRISPR. Stem Cell Reports. Nov. 10, 2015;5(5):908-917. doi: 10.1016/j.stemcr.2015.09.022. Epub Oct. 29, 2015.
Arezi et al., Novel mutations in Moloney Murine Leukemia Virus reverse transcriptase increase thermostability through tighter binding to template-primer. Nucleic Acids Res. Feb. 2009;37(2):473-81. doi: 10.1093/nar/gkn952. Epub Dec. 4, 2008.
Asante et al., A naturally occurring variant of the human prion protein completely prevents prion disease. Nature. Jun. 25, 2015;522(7557):478-81. doi: 10.1038/naturel4510. Epub Jun. 10, 2015.
Atkins et al., Ribosomal frameshifting and transcriptional slippage: From genetic steganography and cryptography to adventitious use. Nucleic Acids Res. Sep. 6, 2016;44(15):7007-78. doi: 10.1093/nar/gkw530. Epub Jul. 19, 2016.
Auer et al., Highly efficient CRISPR/Cas9-mediated knock-in in zebrafish by homology-independent DNA repair. Genome Res. Jan. 2014;24(1):142-53. doi: 10.1101/gr. 161638.113. Epub Oct. 31, 2013.
Autieri et al., IRT-1, a novel interferon-gamma-responsive transcript encoding a growth-suppressing basic leucine zipper protein. J Biol Chem. Jun. 12, 1998;273(24):14731-7. doi: 10.1074/jbc.273.24.14731.
Avidan et al., The processivity and fidelity of DNA synthesis exhibited by the reverse transcriptase of bovine leukemia virus. Eur J Biochem. Feb. 2002;269(3):859-67. doi: 10.1046/j.0014-2956.2001.02719.x.
Babacic et al., CRISPR-cas gene-editing as plausible treatment of neuromuscular and nucleotide-repeat-expansion diseases: A systematic review. PLoS One. Feb. 22, 2019;14(2):e0212198. doi: 10.1371/journal.pone.0212198.
Bacman et al., Specific elimination of mutant mitochondrial genomes in patient-derived cells by mitoTALENs. Nat Med. Sep. 2013;19(9):l 111-3. doi: 10.1038/nm.3261. Epub Aug. 4, 2013.
Badran et al., Continuous evolution of Bacillus thuringiensis toxins overcomes insect resistance. Nature. May 5, 2016;533(7601):58-63. doi: 10.1038/nature17938. Epub Apr. 27, 2016.
Badran et al., Development of potent in vivo mutagenesis plasmids with broad mutational spectra. Nat Commun. Oct. 7, 2015;6:8425. doi: 10.1038/ncomms9425.
Bae et al., Microhomology-based choice of Cas9 nuclease target sites. Nat Methods. Jul. 2014;11(7):705-6. doi: 10.1038/nmeth.3015.
Bagyinszky et al., Characterization of mutations in PRNP (prion) gene and their possible roles in neurodegenerative diseases. Neuropsychiatr Dis Treat. Aug. 14, 2018; 14:2067-2085. doi: 10.2147/NDT.S165445.
Balakrishnan et al., Flap endonuclease 1. Annu Rev Biochem. 2013;82:119-38. doi: 10.1146/annurev-biochem-072511-122603. Epub Feb. 28, 2013.
Baldari et al., A novel leader peptide which allows efficient secretion of a fragment of human interleukin 1 beta in Saccharomyces cerevisiae. EMBO J. Jan. 1987;6(1):229-34.
Banerjee et al., Cadmium inhibits mismatch repair by blocking the ATPase activity of the MSH2-MSH6 complex [published correction appears in Nucleic Acids Res. 2005;33(5):1738]. Nucleic Acids Res. 2005;33(4):1410-1419. Published Mar. 3, 2005. doi:10.1093/nar/gki291.
Banerji et al., A lymphocyte-specific cellular enhancer is located downstream of the joining region in immunoglobulin heavy chain genes. Cell. Jul. 1983;33(3):729-40. doi: 10.1016/0092-8674(83)90015-6.
Bannert et al., Retroelements and the human genome: new perspectives on an old relation. Proc Natl Acad Sci U S A. Oct. 5, 2004;101 Suppl 2(Suppl 2):14572-9. doi: 10.1073/pnas.0404838101. Epub Aug. 13, 2004.
Baranauskas et al., Generation and characterization of new highly thermostable and processive M-MuLV reverse transcriptase variants. Protein Eng Des Sei. Oct. 2012;25(10):657-68. doi: 10.1093/protein/gzs034. Epub Jun. 12, 2012.
Barnes et al., The fidelity of Taq polymerase catalyzing PCR is improved by an N-terminal deletion. Gene. Mar. 1, 1992;112(1):29-35. doi: 10.1016/0378-1119(92)90299-5.
Bartlett et al., Efficient expression of protein coding genes from the murine U1 small nuclear RNA promoters. Proc Natl Acad Sci U S A. Aug. 20, 1996;93(17):8852-7. doi: 10.1073/pnas.93.17.8852.
Bartosovic et al., N6-methyladenosine demethylase FTO targets pre-mRNAs and regulates alternative splicing and 3′-end processing. Nucleic Acids Res. Nov. 2, 2017;45(19): 11356-11370. doi: 10.1093/nar/gkx778.
Basturea et al., Substrate specificity and properties of the Escherichia coli 16S rRNA methyltransferase, RsmE. RNA. Nov. 2007;13(11):1969-76. doi: 10.1261/rna.700507. Epub Sep. 13, 2007.
Bebenek et al., Error-prone polymerization by HIV-1 reverse transcriptase. Contribution of template-primer misalignment, miscoding, and termination probability to mutational hot spots. J Biol Chem. May 15, 1993;268(14): 10324-34.
Behr, Gene transfer with synthetic cationic amphiphiles: prospects for gene therapy. Bioconjug Chem. Sep.-Oct. 1994;5(5):382-9. doi: 10.1021/bc00029a002.
Belshaw et al., Controlling programmed cell death with a cyclophilin-cyclosporin-based chemical inducer of dimerization. Chem Biol. Sep. 1996;3(9):731-8. doi: 10.1016/s1074-5521(96)90249-5.
Belshaw et al., Controlling protein association and subcellular localization with a synthetic ligand that induces heterodimerization of proteins. Proc Natl Acad Sci USA. May 14, 1996;93(10):4604-7. doi: 10.1073/pnas.93.10.4604.
Bennett et al., Painful and painless channelopathies. Lancet Neurol. Jun. 2014;13(6):587-99. doi: 10.1016/S1474-4422(14)70024-9. Epub May 6, 2014.
Berger et al., Reverse transcriptase and its associated ribonuclease H: interplay of two enzyme activities controls the yield of single-stranded complementary deoxyribonucleic acid. Biochemistry. May 10, 1983;22(10):2365-72. doi: 10.1021/bi00279a010.
Berkhout et al., Identification of an active reverse transcriptase enzyme encoded by a human endogenous HERV-K retrovirus. J Virol. Mar. 1999;73(3):2365-75. doi: 10.1128/JVI.73.3.2365-2375.1999.
Bernhart et al., Local RNA base pairing probabilities in large sequences. Bioinformatics. Mar. 1, 2006;22(5):614-5. doi: 10.1093/bioinformatics/btk014. Epub Dec. 20, 2005.
Bernstein et al., Role for a bidentate ribonuclease in the initiation step of RNA interference. Nature. Jan. 18, 2001;409(6818):363-6. doi: 10.1038/35053110.
Bertolotti et al., Toward genosafe endonuclease-boosted gene targeting using breakthrough CRISP/Cas9 for next generation stem cell gene therapy culminating in efficient ex VIVO in VIVO gene repair/genomic editing. Molecular Therapy. May 2015;23(Suppl1):S139. Abstract 350. 18th Ann Meeting of the American Society of Gene and Cell Therapy. ASGCT 2015. New Orleans, LA. May 13, 2015-May 16, 2015.
Bertrand et al., Localization of ASH1 mRNA particles in living yeast. Mol Cell. Oct. 1998;2(4):437-45. doi: 10.1016/sl097-2765(00)80143-4.
Bessen et al., High-resolution specificity profiling and off-target prediction for site-specific DNA recombinases. Nat Commun. Apr. 26, 2019;10(1):1937. doi: 10.1038/s41467-019-09987-0.
Bi et al., Pseudo attP sites in favor of transgene integration and expression in cultured porcine cells identified by Streptomyces phage phiC31 integrase. BMC Mol Biol. Sep. 8, 2013; 14:20. doi: 10.1186/1471-2199-14-20.
Bibb et al., Integration and excision by the large serine recombinase phiRv1 integrase. Mol Microbiol. Mar. 2005;55(6): 1896-910. doi: 10.1111/j.1365-2958.2005.04517.x.
Biehs et al., DNA Double-Strand Break Resection Occurs during Non-homologous End Joining in G1 but Is Distinct from Resection during Homologous Recombination. Mol Cell. Feb. 16, 2017;65(4):671-684.e5. doi: 10.1016/j.molcel.2016.12.016. Epub Jan. 26, 2017.
Biswas et al., A structural basis for allosteric control of DNA recombination by lambda integrase. Nature. Jun. 23, 2005;435(7045):1059-66. doi: 10.1038/nature03657.
Blaese et al., Vectors in cancer therapy: how will they deliver? Cancer Gene Ther. Dec. 1995;2(4):291-7.
Blain et al., Nuclease activities of Moloney murine leukemia virus reverse transcriptase. Mutants with altered substrate specificities. J Biol Chem. Nov. 5, 1993;268(31):23585-92.
Blaisonneau et al., A circular plasmid from the yeast Torulaspora delbrueckii. Plasmid. 1997;38(3):202-9. doi: 10.1006/plas.1997.1315.
Blau et al., A proliferation switch for genetically?modified?cells. PNAS Apr. 1, 1997 94 (7) 3076-3081; https://doi.org/10.1073/pnas.94.7.3076.
Bloom et al., Evolving strategies for enzyme engineering. Curr Opin Struct Biol. Aug. 2005;15(4):447-52.
Bodi et al., Yeast m6A Methylated mRNAs Are Enriched on Translating Ribosomes during Meiosis, and under Rapamycin Treatment. PLoS One. Jul. 17, 2015;10(7):e0132090. doi: 10.1371/journal.pone.0132090.
Boersma et al., Selection strategies for improved biocatalysts. FEBS J. May 2007;274(9):2181-95.
Bogdanove et al., Engineering altered protein-DNA recognition specificity. Nucleic Acids Res. Jun. 1, 2018;46(10):4845-4871. doi: 10.1093/nar/gky289.
Bolusani et al., Evolution of variants of yeast site-specific recombinase Flp that utilize native genomic sequences as recombination target sites. Nucleic Acids Res. 2006;34(18):5259-69. Epub Sep. 26, 2006.
Bondeson et al., Inversion of the IDS gene resulting from recombination with IDS-related sequences is a common cause of the Hunter syndrome. Hum Mol Genet. Apr. 1995;4(4):615-21. doi: 10.1093/hmg/4.4.615.
Borchardt et al., Controlling mRNA stability and translation with the CRISPR endoribonuclease Csy4. RNA. Nov. 2015;21(11): 1921-30. doi: 10.1261/rna.051227.115. Epub Sep. 9, 2015.
Boutabout et al., DNA synthesis fidelity by the reverse transcriptase of the yeast retrotransposon Tyl. Nucleic Acids Res. Jun. 1, 2001;29(11):2217-22. doi: 10.1093/nar/29.11.2217.
Box et al., A multi-domain protein system based on the HC fragment of tetanus toxin for targeting DNA to neuronal cells. J Drug Target. Jul. 2003;11(6):333-43. doi: 10.1080/1061186310001634667.
Braun et al., Immunogenic duplex nucleic acids are nuclease resistant. J Immunol. Sep. 15, 1988;141(6):2084-9.
Brown et al., A mammalian protein targeted by G1-arresting rapamycin-receptor complex. Nature. Jun. 30, 1994;369(6483):756-8. doi: 10.1038/369756a0.
Brown et al., Characterization of the genetic elements required for site-specific integration of plasmid pSE211 in Saccharopolyspora erythraea. J Bacteriol. Apr. 1990;172(4):1877-88. doi: 10.1128/jb. 172.4.1877-1888.1990.
Brown et al., Structural insights into the stabilization of MALAT1 noncoding RNA by a bipartite triple helix. Nat Struct Mol Biol. Jul. 2014;21(7):633-40. doi: 10.1038/nsmb.2844. Epub Jun. 22, 2014.
Brzezicha et al., Identification of human tRNA:m5C methyltransferase catalysing intron-dependent m5C formation in the first position of the anticodon of the pre-tRNA Leu (CAA). Nucleic Acids Res. 2006;34(20):6034-43. doi: 10.1093/nar/gk1765. Epub Oct. 27, 2006.
Buchschacher et al., Human immunodeficiency virus vectors for inducible expression of foreign genes. J Virol. May 1992;66(5):2731-9. doi: 10.1128/JVI.66.5.2731-2739.1992.
Buckley et al., Targeting the von Hippel-Lindau E3 ubiquitin ligase using small molecules to disrupt the VHL/HIF-1? interaction. J Am Chem Soc. Mar. 14, 2012;134(10):4465-8. doi: 10.1021/ja209924v. Epub Feb. 27, 2012.
Budker et al., Protein/amphipathic polyamine complexes enable highly efficient transfection with minimal toxicity. Biotechniques. Jul. 1997;23(1):139, 142-7. doi: 10.2144/97231rr02.
Budworth et al., A brief history of triplet repeat diseases. Methods Mol Biol. 2013; 1010:3-17. doi: 10.1007/978-1-62703-411-1_1.
Buskirk et al., In vivo evolution of an RNA-based transcriptional activator. Chem Biol. Jun. 2003;10(6):533-40. doi: 10.1016/s1074-5521(03)00109-1.
Byrne et al., Multiplex gene regulation: a two-tiered approach to transgene regulation in transgenic mice. Proc Natl Acad Sci U S A. Jul. 1989;86(14):5473-7. doi: 10.1073/pnas.86.14.5473.
Cadwell et al., Randomization of genes by PCR mutagenesis. PCR Methods Appl. Aug. 1992;2(1):28-33. doi: 10.1101/gr.2.1.28.
Cai et al., Reconstruction of ancestral protein sequences and its applications. BMC Evol Biol. Sep. 17, 2004;4:33. doi: 10.1186/1471-2148-4-33.
Calame et al., Transcriptional controlling elements in the immunoglobulin and T cell receptor loci. Adv Immunol. 1988;43:235-75. doi: 10.1016/s0065-2776(08)60367-3.
Camarero et al., Biosynthesis of a Head-to-Tail Cyclized Protein with Improved Biological Activity. J. Am. Chem. Soc. May 29, 1999; 121(23):5597-5598. https://doi.org/.1021/ja990929n.
Camper et al., Postnatal repression of the alpha-fetoprotein gene is enhancer independent. Genes Dev. Apr. 1989;3(4):537-46. doi: 10.1101/gad.3.4.537.
Camps et al., Targeted gene evolution in Escherichia coli using a highly error-prone DNA polymerase I. Proc Natl Acad Sci U S A. Aug. 19, 2003;100(17):9727-32. Epub Aug. 8, 2003.
Canchaya et al., Genome analysis of an inducible prophage and prophage remnants integrated in the Streptococcus pyogenes strain SF370. Virology. Oct. 25, 2002;302(2):245-58. doi: 10.1006/viro.2002.1570.
Canver et al., Customizing the genome as therapy for the ?-hemoglobinopathies. Blood. May 26, 2016;127(21):2536-45. doi: 10.1182/blood-2016-01-678128. Epub Apr. 6, 2016.
Carlier et al., Burkholderia cenocepacia H111 Rhy-family protein. Apr. 16, 2015. Retrieved from the Internet via https://www.ebi.ac.uk/ena/browser/api/embl/CDN65395.1?lineLimit=1000. Last retrieved Apr. 26, 2021.
Carlson et al., Negative selection and stringency modulation in phage-assisted continuous evolution. Nat Chem Biol. Mar. 2014;10(3):216-22. doi: 10.1038/nchembio.1453. Epub Feb. 2, 2014. With Supplementary Results.
Carr et al., Genome engineering. Nat Biotechnol. Dec. 2009;27(12):1151-62. doi: 10.1038/nbt.1590.
Carvalho et al., Evolution in health and medicine Sackler colloquium: Genomic disorders: a window into human gene and genome evolution. Proc Natl Acad Sci USA. Jan. 26, 2010;107 Suppl 1(Suppl 1):1765-71. doi: 10.1073/pnas.0906222107. Epub Jan. 13, 2010.
Caspi et al., Distribution of split DnaE inteins in cyanobacteria. Mol Microbiol. Dec. 2003;50(5):1569-77. doi: 10.1046/j.1365-2958.2003.03825.x.
Cattaneo et al., SEL1L affects human pancreatic cancer cell cycle and invasiveness through modulation of PTEN and genes related to cell-matrix interactions. Neoplasia. 2005;7(11):1030-1038.
Ceccaldi et al., Repair Pathway Choices and Consequences at the Double-Strand Break. Trends Cell Biol. Jan. 2016;26(1):52-64. doi: 10.1016/j.tcb.2015.07.009. Epub Oct. 1, 2015.
Chadalavada et al., Wild-type is the optimal sequence of the HDV ribozyme under cotranscriptional conditions. RNA. Dec. 2007;13(12):2189-201. doi: 10.1261/rna.778107. Epub Oct. 23, 2007.
Chalberg et al., Integration specificity of phage phiC31 integrase in the human genome. J Mol Biol. Mar. 17, 2006;357(1):28-48. doi: 10.1016/j.jmb.2005.11.098. Epub Dec. 22, 2005.
Chalberg et al., phiC31 integrase confers genomic integration and long-term transgene expression in rat retina. Invest Ophthalmol Vis Sci. Jun. 2005;46(6):2140-6. doi: 10.1167/iovs.04-1252.
Chan et al., Molecular recording of mammalian embryogenesis. Nature. Jun. 2019;570(7759):77-82. doi: 10.1038/s41586-019-1184-5. Epub May 13, 2019.
Chan et al., Novel selection methods for DNA-encoded chemical libraries. Curr Opin Chem Biol. 2015;26:55-61. doi:10.1016/j.cbpa.2015.02.010.
Chan et al., The choice of nucleotide inserted opposite abasic sites formed within chromosomal DNA reveals the polymerase activities participating in translesion DNA synthesis. DNA Repair (Amst). Nov. 2013;12(ll):878-89. doi: 10.1016/j.dnarep.2013.07.008. Epub Aug. 26, 2013.
Chapman et al., Playing the end game: DNA double-strand break repair pathway choice. Mol Cell. Aug. 24, 2012;47(4):497-510. doi: 10.1016/j.molcel.2012.07.029.
Chaturvedi et al., Stabilization of triple-stranded oligonucleotide complexes: use of probes containing alternating phosphodiester and stereo-uniform cationic phosphoramidate linkages. Nucleic Acids Res. Jun. 15, 1996;24(12):2318-23.
Chen et al., Enhanced proofreading governs CRISPR-Cas9 targeting accuracy. Nature. Oct. 19, 2017;550(7676):407-410. doi: 10.1038/nature24268. Epub Sep. 20, 2017.
Chen et al., A general strategy for the evolution of bond-forming enzymes using yeast display. Proc Natl Acad Sci U S A. Jul. 12, 2011;108(28):11399-404. doi: 10.1073/pnas.1101046108. Epub Jun. 22, 2011.
Chen et al., Highly Efficient Mouse Genome Editing by CRISPR Ribonucleoprotein Electroporation of Zygotes. J Biol Chem. Jul. 8, 2016;291(28):14457-67. doi: 10.1074/jbc.M116.733154. Epub May 5, 2016.
Chen et al., m(6)A RNA methylation is regulated by microRNAs and promotes reprogramming to pluripotency. Cell Stem Cell. Mar. 5, 2015;16(3):289-301. doi: 10.1016/j.stem.2015.01.016. Epub Feb. 12, 2015.
Chew et al., A multifunctional AAV-CRISPR-Cas9 and its host response. Nat Methods. Oct. 2016;13(10):868-74. doi: 10.1038/nmeth.3993. Epub Sep. 5, 2016. Supplementary Information.
Chin, Expanding and reprogramming the genetic code of cells and animals. Annu Rev Biochem. 2014;83:379-408. doi: 10.1146/annurev-biochem-060713-035737. Epub Feb. 10, 2014.
Cho et al., Site-specific recombination of bacteriophage P22 does not require integration host factor. J Bacteriol. Jul. 1999;181(14):4245-9. doi: 10.1128/JB.181.14.4245-4249.1999.
Choe et al., Forging Ahead through Darkness: PCNA, Still the Principal Conductor at the Replication Fork. Mol Cell. Feb. 2, 2017;65(3):380-392. doi: 10.1016/j.molcel.2016.12.020.
Choi et al., N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics. Nat Struct Mol Biol. Feb. 2016;23(2): 110-5. doi: 10.1038/nsmb.3148. Epub Jan. 16, 2016.
Choi et al., Protein trans-splicing and characterization of a split family B-type DNA polymerase from the hyperthermophilic archaeal parasite Nanoarchaeum equitans. J Mol Biol. Mar. 10, 2006;356(5):1093-106. doi: 10.1016/j.jmb.2005.12.036. Epub Dec. 27, 2005.
Choi et at al., Translesion synthesis across abasic lesions by human B-family and Y-family DNA polymerases and Revl J Mol Biol. Nov. 1, 20109;404(1):34-44. doi: 10.1016/j.jmb.2010.09.015. Epub Oct. 1, 2010.
Chong et al., Modulation of protein splicing of the Saccharomyces cerevisiae vacuolar membrane ATPase intein. J Biol Chem. Apr. 24, 1998;273(17): 10567-77. doi: 10.1074/jbc.273.17.10567.
Chong et al., Utilizing the C-terminal cleavage activity of a protein splicing element to purify recombinant proteins in a single chromatographic step. Nucleic Acids Res. Nov. 15, 1998;26(22):5109-15. doi: 10.1093/nar/26.22.5109.
Chong et al., Protein splicing involving the Saccharomyces cerevisiae VMA intein. The steps in the splicing pathway, side reactions leading to protein cleavage, and establishment of an in vitro splicing system. J Biol Chem. Sep. 6, 1996;271(36):22159-68. doi: 10.1074/jbc.271.36.22159.
Chong et al., Protein splicing of the Saccharomyces cerevisiae VMA intein without the endonuclease motifs. J Biol Chem. Jun. 20, 1997;272(25): 15587-90. doi: 10.1074/jbc.272.25.15587.
Chong et al., Single-column purification of free recombinant proteins using a self-cleavable affinity tag derived from a protein splicing element. Gene. Jun. 1, 19979; 192(2):271 -81. doi: 10.1016/s0378-1119(97)00105-4.
Choudhury et al., Engineering RNA endonucleases with customized sequence specificities. Nat Commun. 2012;3:1147. doi: 10.1038/ncomms2154.
Choulika et al., Induction of homologous recombination in mammalian chromosomes by using the I-SceI system of Saccharomyces cerevisiae. Mol Cell Biol. Apr. 1995;15(4):1968-73. doi: 10.1128/MCB.15.4.1968.
Christiansen et al., Characterization of the lactococcal temperate phage TP901-1 and its site-specific integration. J Bacteriol. Feb. 1994; 176(4): 1069-76. doi: 10.1128/jb. 176.4.1069-1076.1994.
Chu et al., Increasing the efficiency of homology-directed repair for CRISPR-Cas9-induced precise gene editing in mammalian cells. Nat Biotech. Feb. 13, 2015;33:543-8. doi: 10.1038/nbt.3198. Epub Mar. 24, 2015.
Chuai et al., DeepCRISPR: optimized CRISPR guide RNA design by deep learning. Genome Biol. Jun. 26, 2018;19(1):80. doi: 10.1186/s 13059-018-1459-4.
Chuai et al., In Silico Meets In Vivo: Towards Computational CRISPR-Based sgRNA Design. Trends Biotechnol. Jan. 2017;35(1):12-21. doi: 10.1016/j.tibtech.2016.06.008. Epub Jul. 11, 2016.
Chuang et al., Novel Heterotypic Rox Sites for Combinatorial Dre Recombination Strategies. G3 (Bethesda). Dec. 29, 2015;6(3):559-71. doi: 10.1534/g3.115.025841.
Chujo et al., Trmt61B is a methyltransferase responsible for 1-methyladenosine at position 58 of human mitochondrial tRNAs. RNA. Dec. 2012;18(12):2269-76. doi: 10.1261/rna.035600.112. Epub Oct. 24, 2012.
Clackson et al., Redesigning an FKBP-ligand interface to generate chemical dimerizers with novel specificity. Proc Natl Acad Sci USA. Sep. 1, 1998;95(18):10437-42. doi: 10.1073/pnas.95.18.10437.
Clement et al., CRISPResso2 provides accurate and rapid genome editing sequence analysis. Nat Biotechnol. Mar. 2019;37(3):224-226. doi: 10.1038/s41587-019-0032-3.
Cokol et al., Finding nuclear localization signals. EMBO Rep. Nov. 2000;1(5):411-5. doi: 10.1093/embo-reports/kvd092.
Cole et al., Reconstructing evolutionary adaptive paths for protein engineering. Methods Mol Biol. 2013;978:115-25. doi: 10.1007/978-1-62703-293-3_8.
Collinge, Prion diseases of humans and animals: their causes and molecular basis. Annu Rev Neurosci. 2001;24:519-50. doi: 10.1146/annurev.neuro.24.1.519.
Conrad et al., A Kaposi's sarcoma virus RNA element that increases the nuclear abundance of intronless transcripts. EMBO J. May 18, 20058;24(10): 1831-41. doi: 10.1038/sj.emboj.7600662. Epub Apr. 28, 2005.
Conticello, The AID/APOBEC family of nucleic acid mutators. Genome Biol. 2008;9(6):229. doi: 10.1186/GB-2008-9-6-229. Epub Jun. 17, 2008.
Cornu et al., Refining strategies to translate genome editing to the clinic. Nat Med. Apr. 3, 2017;23(4):415-423. doi: 10.1038/nm.4313.
Costa et al., Frequent use of the same tertiary motif by self-folding RNAs. EMBO J. Mar. 15, 1995; 14(6): 1276-85.
Cotton et al., Insertion of a Synthetic Peptide into a Recombinant Protein Framework:? A Protein Biosensor. J. Am. Chem. Soc. Jan. 22, 1999; 121(5):1100-1. https://doi.org/10.1021/ja983804b.
Cox, Proteins pinpoint double strand breaks. Elife. Oct. 29, 2013;2:e01561. doi: 10.7554/eLife.01561.
Crabtree et al., Three-part inventions: intracellular signaling and induced proximity. Trends Biochem Sci. Nov. 1996;21(11):418-22. doi: 10.1016/s0968-0004(96)20027-1.
Crick, On protein synthesis. Symp Soc Exp Biol. 1958;12:138-63.
Crystal, Transfer of genes to humans: early lessons and obstacles to success. Science. Oct. 20, 1995;270(5235):404-10. doi: 10.1126/science.270.5235.404.
Cui et al., Consequences of Cas9 cleavage in the chromosome of Escherichia coli. Nucleic Acids Res. May 19, 2016;44(9):4243-51. doi: 10.1093/nar/gkw223. Epub Apr. 8, 2016.
Cui et al., m6A RNA Methylation Regulates the Self-Renewal and Tumorigenesis of Glioblastoma Stem Cells. Cell Rep. Mar. 14, 2017; 18(11):2622-2634. doi: 10.1016/j.cehep.2017.02.059.
Cui et al., Review of CRISPR/Cas9 sgRNA Design Tools. Interdiscip Sci. Jun. 2018;10(2):455-465. doi: 10.1007/s12539-018-0298-z. Epub Apr. 11, 2018.
Cupples et al., A set of lacZ mutations in Escherichia coli that allow rapid detection of each of the six base substitutions. Proc Natl Acad Sci U S A. Jul. 1989;86(14):5345-9.
Dahlgren et al., A novel mutation in ribosomal protein S4 that affects the function of a mutated RF1. Biochimie. Aug. 2000;82(8):683-91.
Dahlman et al., Orthogonal gene knockout and activation with a catalytically active Cas9 nuclease. Nat Biotechnol. Nov. 2015;33(11):1159-61. doi: 10.1038/nbt.3390.
Dandage et al., beditor: A Computational Workflow for Designing Libraries of Guide RNAs for CRISPR-Mediated Base Editing. Genetics. Jun. 2019;212(2):377-385. doi: 10.1534/genetics.119.302089. Epub Apr. 1, 2019.
Dang et al., Optimizing sgRNA structure to improve CRISPR-Cas9 knockout efficiency. Genome Biol. Dec. 15, 2015;16:280. doi: 10.1186/s13059-015-0846-3.
Das et al.,The crystal structure of the monomeric reverse transcriptase from Moloney murine leukemia virus. Structure. May 2004;12(5):819-29. doi: 10.1016/j.str.2004.02.032.
Dassa et al., Fractured genes: a novel genomic arrangement involving new split inteins and a new homing endonuclease family. Nucleic Acids Res. May 2009;37(8):2560-73. doi: 10.1093/nar/gkp095. Epub Mar. 5, 2009.
Dassa et al., Trans protein splicing of cyanobacterial split inteins in endogenous and exogenous combinations. Biochemistry. Jan. 9, 2007;46(1):322-30. doi: 10.1021/bi0611762.
Datsenko et al., One-step inactivation of chromosomal genes in Escherichia coli K-12 using PCR products. Proc Natl Acad Sci U S A. Jun. 6, 2000;97(12):6640-5.
De Felipe et al., Co-translational, intraribosomal cleavage of polypeptides by the foot-and-mouth disease virus 2A peptide. J Biol Chem. Mar. 28, 2003;278(13):11441-8. doi: 10.1074/jbc.M211644200. Epub Jan. 8, 2003.
De Wit et al., The Human CD4+ T Cell Response against Mumps Virus Targets a Broadly Recognized Nucleoprotein Epitope. J Virol. Mar. 5, 2019;93(6):e01883-18. doi: 10.1128/JVI.01883-18.
Dean et al., Genetic restriction of HIV-1 infection and progression to AIDS by a deletion allele of the CKR5 structural gene. Hemophilia Growth and Development Study, Multicenter AIDS Cohort Study, Multicenter Hemophilia Cohort Study, San Francisco City Cohort, ALIVE Study. Science. Sep. 27, 1996;273(5283): 1856-62. doi: 10.1126/science.273.5283.1856.
DeKosky et al., Large-scale sequence and structural comparisons of human naive and antigen-experienced antibody repertoires. Proc Natl Acad Sci U S A. May 10, 2016;113(19):E2636-45. doi: 10.1073/pnas.1525510113. Epub Apr. 25, 2016.
Delebecque et al., Organization of intracellular reactions with rationally designed RNA assemblies. Science. Jul. 22, 2011;333(6041):470-4. doi: 10.1126/science. 1206938. Epub Jun. 23, 2011.
Deng et al., Widespread occurrence of N6-methyladenosine in bacterial mRNA. Nucleic Acids Res. Jul. 27, 2015;43(13):6557-67. doi: 10.1093/nar/gkv596. Epub Jun. 11, 2015.
Deriano et al., Modernizing the nonhomologous end-joining repertoire: alternative and classical NHEJ share the stage. Annu Rev Genet. 2013;47:433-55. doi: 10.1146/annurev-genet-110711-155540. Epub Sep. 11, 2013.
Deussing, Targeted mutagenesis tools for modelling psychiatric disorders. Cell Tissue Res. Oct. 2013;354(1):9-25. doi: 10.1007/s00441-013-1708-5. Epub Sep. 10, 2013.
Dever et al., CRISPR/Cas9 ?-globin gene targeting in human haematopoietic stem cells. Nature. Nov. 17, 2016;539(7629):384-389. doi: 10.1038/nature20134. Epub Nov. 7, 2016.
Dicarlo et al., Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic Acids Res. Apr. 2013;41(7):4336-43. doi: 10.1093/nar/gktl35. Epub Mar. 4, 2013.
Dicarlo et al., Safeguarding CRISPR-Cas9 gene drives in yeast. Nat Biotechnol. Dec. 2015;33(12):1250-1255. doi: 10.1038/nbt.3412. Epub Nov. 16, 2015.
Dickey et al., Single-stranded DNA-binding proteins: multiple domains for multiple functions. Structure. Jul. 2, 2013;21(7):1074-84. doi: 10.1016/j.str.2013.05.013.
Dickinson et al., Experimental interrogation of the path dependence and stochasticity of protein evolution using phage-assisted continuous evolution. Proc Natl Acad Sci USA. May 2013;110(22):9007-12.
Dillon, Regulating gene expression in gene therapy. Trends Biotechnol. May 1993;11(5):167-73. doi: 10.1016/0167-7799(93)90109-M.
Dingwall et al., Nuclear targeting sequences—a consensus? Trends Biochem Sci. Dec. 1991;16(12):478-81. doi: 10.1016/0968-0004(91)90184-w.
Diver et al., Single-Step Synthesis of Cell-Permeable Protein Dimerizers That Activate Signal Transduction and Gene Expression. J. Am. Chem. Soc. Jun. 4, 1997; 119(22):5106-5109. https://doi.org/10.1021/ja963891c.
Doman et al., Evaluation and minimization of Cas9-independent off-target DNA editing by cytosine base editors. Nat Biotechnol. May 2020;38(5):620-628. doi: 10.1038/s41587-020-0414-6. Epub Feb. 10, 2020.
Dominissini et al., Topology of the human and mouse m6A RNA methylomes revealed by m6A-seq. Nature. Apr. 29, 2012;485(7397):201-6. doi: 10.1038/nature11112.
Dorgan et al., An enzyme-coupled continuous spectrophotometric assay for S-adenosylmethionine-dependent methyltransferases. Anal Biochem. Mar. 15, 2006;350(2):249-55. doi: 10.1016/j.ab.2006.01.004. Epub Feb. 7, 2006.
Dorr et al., Reprogramming the specificity of sortase enzymes. Proc Natl Acad Sci USA. Sep. 1, 20146;111(37):13343-8. doi: 10.1073/pnas.l411179111. Epub Sep. 3, 2014.
Dove et al., Conversion of the omega subunit of Escherichia coliRNA polymerase into a transcriptional activator or an activation target. Genes Dev. Mar. 1, 1998;12(5):745-54.
Doyon et al., Directed evolution and substrate specificity profile of homing endonuclease I-Scel. J Am Chem Soc. Feb. 22, 2006;128(7):2477-84.
Drake, A constant rate of spontaneous mutation in DNA-based microbes. Proc Natl Acad Sci USA. Aug. 15, 1991;88(16):7160-4.
Dubois et al., Retroviral RNA Dimerization: From Structure to Functions. Front Microbiol. Mar. 22, 2018;9:527. doi: 10.3389/fmicb.2018.00527.
Dunbar et al., Gene therapy comes of age. Science. Jan. 12, 2018;359(6372):eaan4672. doi: 10.1126/science.aan4672.
Dupuy et al., Le syndrome de De La Chapelle [De La Chapelle syndrome]. Presse Med. Mar. 3, 2001;30(8):369-72. French.
Durai et al., A bacterial one-hybrid selection system for interrogating zinc finger-DNA interactions. Comb Chem High Throughput Screen. May 2006;9(4):301-11.
Durai et al., Zinc finger nucleases: custom-designed molecular scissors for genome engineering of plant and mammalian cells. Nucleic Acids Res. Oct. 26, 2005;33(18):5978-90. doi: 10.1093/nar/gki912.
Edlund et al., Cell-specific expression of the rat insulin gene: evidence for role of two distinct 5′ flanking elements. Science. Nov. 22, 1985;230(4728):912-6. doi: 10.1126/science.3904002.
Eick et al., Robustness of Reconstructed Ancestral Protein Functions to Statistical Uncertainty. Mol Biol Evol. Feb. 1, 2017;34(2):247-261. doi: 10.1093/molbev/msw223.
Engel et al., The emerging role of mRNA methylation in normal and pathological behavior. Genes Brain Behav. Mar. 2018;17(3):e12428. doi: 10.1111/gbb.12428. Epub Nov. 17, 2017.
Engelward et al., Base excision repair deficient mice lacking the Aag alkyladenine DNA glycosylase. Proc Natl Acad Sci USA. Nov. 25, 1997;94(24):13087-92.
England, Unnatural amino acid mutagenesis: a precise tool for probing; protein structure and function. Biochemistry. Sep. 21, 2004;43(37):11623-9.
Enyeart et al., Biotechnological applications of mobile group II introns and their reverse transcriptases: gene targeting, RNA-seq, and non-coding RNA analysis. Mobile DNA 5, 2 (2014). https://doi.org/10.1186/1759-8753-5-2. https://doi.org/10.1186/1759-8753-5-2.
Eriksson et al., Recurrent de novo point mutations in lamin A cause Hutchinson-Gilford progeria syndrome. Nature. May 15, 2003;423(6937):293-8. doi: 10.1038/nature01629. Epub Apr. 25, 2003. PMID: 12714972.
Evans et al., Protein trans-splicing and cyclization by a naturally split intein from the dnaE gene of Synechocystis species PCC6803. J Biol Chem. Mar. 31, 2000;275(13):9091-4. doi: 10.1074/jbc.275.13.9091.
Evans et al., Semisynthesis of cytotoxic proteins using a modified protein splicing element. Protein Sci. Nov. 1998;7(11):2256-64. doi: 10.1002/pro.5560071103.
Evans et al., The cyclization and polymerization of bacterially expressed proteins using modified self-splicing inteins. J Biol Chem. Jun. 25, 1999;274(26): 18359-63. doi: 10.1074/jbc.274.26.18359.
Evans et al., The in vitro ligation of bacterially expressed proteins using an intein from Methanobacterium thermoautotrophicum. J Biol Chem. Feb. 12, 1999;274(7):3923-6. doi: 10.1074/jbc.274.7.3923.
Evers et al., CRISPR knockout screening outperforms shRNA and CRISPRi in identifying essential genes. Nat Biotechnol. Jun. 2016;34(6):631-3. doi: 10.1038/nbt.3536. Epub Apr. 25, 2016.
Falnes et al., DNA repair by bacterial AlkB proteins. Res Microbiol. Oct. 2003;154(8):531-8. doi: 10.1016/S0923-2508(03)00150-5.
Falnes et al., Repair of methyl lesions in DNA and RNA by oxidative demethylation. Neuroscience. Apr. 14, 2007;145(4):1222-32. doi: 10.1016/j.neuroscience.2006.11.018. Epub Dec. 18, 2006.
Fawcett et al., Transposable elements controlling I-R hybrid dysgenesis in D. melanogaster are similar to mammalian LINEs. Cell. Dec. 2, 19866;47(6): 1007-15. doi: 10.1016/0092-8674(86)90815-9.
Feldstein et al., Two sequences participating in the autolytic processing of satellite tobacco ringspot virus complementary RNA. Gene. Oct. 15, 1989;82(1):53-61. doi: 10.1016/0378-1119(89)90029-2.
Feng et al., Crystal structures of the human RNA demethylase Alkbh5 reveal basis for substrate recognition. J Biol Chem. Apr. 25, 2014;289(17):11571-11583. doi: 10.1074/jbc.Ml 13.546168. Epub Mar. 10, 2014.
Feng et al., Human LI retrotransposon encodes a conserved endonuclease required for retrotransposition. Cell. Nov. 29, 1996;87(5):905-16. doi: 10.1016/s0092-8674(00)81997-2.
Feuk, Inversion variants in the human genome: role in disease and genome architecture. Genome Med. Feb. 12, 2010;2(2):11. doi: 10.1186/gm132.
Filippov et al., A novel type of RNase III family proteins in eukaryotes. Gene. Mar. 7, 2000;245(1):213-21. doi: 10.1016/s0378-1119(99)00571-5.
Fire et al., Potent and specific genetic interference by double-stranded RNA in Caenorhabditis elegans. Nature. Feb. 19, 1998;391(6669):806-11. doi: 10.1038/35888.
Fischbach et al., Directed evolution can rapidly improve the activity of chimeric assemblyline enzymes. Proc Natl Acad Sci USA. Jul. 17, 2007;104(29):11951-6. doi: 10.1073/pnas.0705348104. Epub Jul. 9, 2007.
Fitzjohn, Diversitree: comparative phylogenetic analyses of diversification in R. Methods in Evology and Evolution. Dec. 2012;3(6): 1084-92 .doi: 10.1111/j.2041-210X.2012.00234.x.
Flajolet et al., Woodchuck hepatitis virus enhancer I and enhancer II are both involved in N-myc2 activation in woodchuck liver tumors. J Virol. Jul. 1998;72(7):6175-80. doi: 10.1128/JVI.72.7.6175-6180.1998.
Flaman et al., A rapid PCR fidelity assay. Nucleic Acids Res. Aug. 11, 1994;22(15):3259-60. doi: 10.1093/nar/22.15.3259.
Flynn et al., CRISPR-mediated genotypic and phenotypic correction of a chronic granulomatous disease mutation in human iPS cells. Exp Hematol. Oct. 2015;43(10):838-848.e3. doi: 10.1016/j.exphem.2015.06.002. Epub Jun. 19, 2015. Including supplementary figures and data.
Fogg et al., New applications for phage integrases. J Mol Biol. Jul. 29, 2014;426(15):2703-16. doi: 10.1016/j.jmb.2014.05.014. Epub May 22, 2014.
Fogg et al., Genome Integration and Excision by a New Streptomyces Bacteriophage, ?Joe. Appl Environ Microbiol. Feb. 15, 2017;83(5):e02767-16. doi: 10.1128/AEM.02767-16.
Fonfara et al., Phylogeny of Cas9 determines functional exchangeability of dual-RNA and Cas9 among orthologous type II CRISPR-Cas systems. Nucleic Acids Res. Feb. 2014;42(4):2577-90. doi: 10.1093/nar/gkt1074. Epub Nov. 22, 2013. Including Supplementary Information.
Forster et al., Self-cleavage of virusoid RNA is performed by the proposed 55-nucleotide active site. Cell. Jul. 3, 1987;50(1):9-16. doi: 10.1016/0092-8674(87)90657-x.
Forttni et al., Different DNA polymerases are involved in the short- and long-patch base excision repair in mammalian cells. Biochemistry. Mar. 17, 1998;37(11):3575-80. doi: 10.1021/bi972999h.
Fouts et al., Sequencing Bacillus anthracis typing phages gamma and cherry reveals a common ancestry. J Bacteriol. May 2006;188(9):3402-8. doi: 10.1128/JB.188.9.3402-3408.2006.
Freitas et al., Mechanisms and signals for the nuclear import of proteins. Curr Genomics. Dec. 2009;10(8):550-7. doi: 10.2174/138920209789503941.
Fu et al., Promises and Pitfalls of Intracellular Delivery of Proteins. Bioconjugate Chemistry. Aug. 2014;25:1602-8.
Furukawa et al., In vitro selection of allosteric ribozymes that sense the bacterial second messenger c-di-GMP. Methods Mol Biol. 2014;1111:209-20. doi: 10.1007/978-1-62703-755-6_15.
Gaj et al., 3rd. Genome engineering with custom recombinases. Methods Enzymol. 2014;546:79-91. doi: 10.1016/B978-0-12-801185-0.00004-0.
Gajula, Designing an Elusive CoG?GoC CRISPR Base Editor. Trends Biochem Sci. Feb. 2019;44(2):91-94. doi: 10.1016/j.tibs.2018.10.004. Epub Nov. 13, 2018.
Gao et al., Cationic liposome-mediated gene transfer. Gene Ther. Dec. 1995;2(10):710-22.
Gao et al., Self-processing of ribozyme-flanked RNAs into guide RNAs in vitro and in vivo for CRISPR-mediated genome editing. J Integr Plant Biol. Apr. 2014;56(4):343-9. doi: 10.1111/jipb. 12152. Epub Mar. 6, 2014.
Gao et al., Treatment of autosomal dominant hearing loss by in vivo delivery of genome editing agents. Nature. Jan. 11, 2018;553(7687):217-221. doi: 10.1038/nature25164. Epub Dec. 20, 2017.
Gapinske et al., CRISPR-SKIP: programmable gene splicing with single base editors. Genome Biol. Aug. 15, 2018;19(1):107. doi: 10.1186/sl3059-018-1482-5.
Garcia et al., Transglycosylation: a mechanism for RNA modification (and editing?). Bioorg Chem. Jun. 2005;33(3):229-51. doi: 10.1016/j.bioorg.2005.01.001. Epub Feb. 23, 2005.
Garibyan et al., Use of the rpoB gene to determine the specificity of base substitution mutations on the Escherichia coli chromosome. DNA Repair (Amst). May 13, 2003;2(5):593-608.
Gaudelli et al., Programmable base editing of AoT to GoC in genomic DNA without DNA cleavage. Nature. Nov. 23, 2017;551(7681):464-471. doi: 10.1038/nature24644. Epub Oct. 25, 2017. Erratum in: Nature. May 2, 2018.
Gearing, Addgene blog. CRISPR 101: Cas9 nickase design and homology directed repair. 2018. pp. 1-12. https://blog.addgene.org/crispr-101-cas9-nickase-design-and-homlogy-directed-repair. Last retrieved online Jun. 25, 2021.
Gehrke et al., An APOBEC3A-Cas9 base editor with minimized bystander and off-target activities. Nat Biotechnol. Nov. 2018;36(10):977-982. doi: 10.1038/nbt.4199. Epub Jul. 30, 2018.
GenBank Accession No. J01600.1. Brooks et al., E.coli dam gene coding for DNA adenine methylase. Apr. 26, 1993.
GenBank Accession No. U07651.1. Lu, Escherichia coli K12 negative regulator of replication initiation (seqA) gene, complete cds. Jul. 19, 1994.
GenBank Submission; NIH/NCBI, Accession No. AAA66622.1. Martinelli et al., May 18, 1995. 2 pages.
GenBank Submission; NIH/NCBI, Accession No. AGT42196. Farzadfar et al., Nov. 2, 2013. 2 pages.
GenBank Submission; NIH/NCBI, Accession No. APG80656.1. Burstein et al., Dec. 10, 2016. 1 pages.
GenBank Submission; NIH/NCBI, Accession No. AYD60528.1. Ram et al., Oct. 2, 2018. 1 page.
GenBank Submission; NIH/NCBI, Accession No. KR710351.1. Sahni et al., Jun. 1, 2015. 2 pages.
GenBank Submission; NIH/NCBI, Accession No. NP 955579.1. Chen et al., Aug. 13, 2018. 5 pages.
GenBank Submission; NIH/NCBI, Accession No. RFF81513.1. Zhou et al., Aug. 21, 2018. 2 pages.
GenBank Submission; NIH/NCBI, Accession No. SNX31424.1. Weckx, S., Feb. 16, 2018. 2 pages.
GenBank Submission; NIH/NCBI, Accession No. TGH57013. Xu et al., Apr. 9, 2019. 2 pages.
GenBank Submission; NIH/NCBI, Accession No. WP_031386437. No Author Listed., Sep. 23, 2019. 1 page.
GenBank Submission; NIH/NCBI, Accession No. WP_072754838. No Author Listed., Sep. 23, 2019. 1 page.
GenBank Submission; NIH/NCBI, Accession No. WP_095142515.1. No Author Listed., Sep. 23, 2019. 1 page.
GenBank Submission; NIH/NCBI, Accession No. WP_132221894.1. No Author Listed., Sep. 23, 2019. 1 page.
GenBank Submission; NIH/NCBI, Accession No. YP_009283008.1. Bernardini et al., Sep. 23, 2016. 2 pages.
George et al., Adenosine deaminases acting on RNA, RNA editing, and interferon action. J Interferon Cytokine Res. Jan. 2011;31(1):99-117. doi: 10.1089/jir.2010.0097. Epub Dec. 23, 2010. PMID: 21182352; PMCID: PMC3034097.
Gerard et al., Influence on stability in Escherichia coli of the carboxy-terminal structure of cloned Moloney murine leukemia virus reverse transcriptase. DNA. Aug. 1986;5(4):271-9. doi: 10.1089/dna.1986.5.271.
Gerard et al., Purification and characterization of the DNA polymerase and RNase H activities in Moloney murine sarcoma-leukemia virus. J Virol. Apr. 1975;15(4):785-97. doi: 10.1128/JVI. 15.4.785-797.1975.
Gerard et al., The role of template-primer in protection of reverse transcriptase from thermal inactivation. Nucleic Acids Res. Jul. 15, 2002;30(14):3118-29. doi: 10.1093/nar/gkf417.
Gerber et al., An adenosine deaminase that generates inosine at the wobble position of tRNAs. Science. Nov. 5, 1999;286(5442): 1146-9. doi: 10.1126/science.286.5442.1146.
Ghahfarokhi et al., Blastocyst Formation Rate and Transgene Expression are Associated with Gene Insertion into Safe and Non-Safe Harbors in the Cattle Genome. Sci Rep. Nov. 13, 2017;7(1):15432. doi: 10.1038/s41598-017-15648-3.
Gibson et al., Enzymatic assembly of DNA molecules up to several hundred kilobases. Nat Methods. May 2009;6(5):343-5. doi: 10.1038/nmeth.1318. Epub Apr. 12, 2009.
Gil, Position-dependent sequence elements downstream of AAUAAA are required for efficient rabbit beta-globin mRNA 3′end formation. Cell. May 8, 1987;49(3):399-406. doi: 10.1016/0092-8674(87)90292-3.
Glasgow et al.,DNA-binding properties of the Hin recombinase. J Biol Chem. Jun. 15, 1989;264(17):10072-82.
Glassner et al., Generation of a strong mutator phenotype in yeast by imbalanced base excision repair. Proc Natl Acad Sci USA. Aug. 18, 1998;95(17):9997-10002.
Goldberg et al., Epigenetics: a landscape takes shape. Cell. Feb. 23, 2007;128(4):635-8. doi: 10.1016/j.cell.2007.02.006.
Gou et al., Designing single guide RNA for CIRSPR-Cas9 base editor by deep learning. Peer reviewed Thesis/Dissertation. UCLA Electronic Theses and Dissertations. Jan. 1, 2019. Retrieved from the Internet via https://escholarship.org/uc/item/7vf9z54t. Last accessed on Apr. 29, 2021.
Grainge et al., The integrase family of recombinase: organization and function of the active site. Mol Microbiol. Aug. 1999;33(3):449-56.
Gregory et al., Integration site for Streptomyces phage phiBT1 and development of site-specific integrating vectors. J Bacteriol. Sep. 2003;185(17):5320-3. doi: 10.1128/jb.185.17.5320-5323.2003.
Griffiths, Endogenous retroviruses in the human genome sequence. Genome Biol. 2001;2(6):REVIEWS1017.doi: 10.1186/gb-2001-2-6-reviews1017. Epub Jun. 5, 2001.
Grishok et al., Genes and Mechanisms Related to RNA Interference Regulate Expression of the Small Temporal RNAs that Control C. elegans Developmental Timing. Jul. 13, 2001:106(1):P23-4.
Groher et al., Synthetic riboswitches—A tool comes of age. Biochim Biophys Acta. Oct. 2014;1839(10):964-973. doi: 10.1016/j.bbagrm.2014.05.005. Epub May 17, 2014.
Groth et al., Construction of transgenic Drosophila by using the site-specific integrase from phage phiC31. Genetics. Apr. 2004; 166(4): 1775-82. doi: 10.1534/genetics.166.4.1775.
Gruber et al., Strategies for measuring evolutionary conservation of RNA secondary structures. BMC Bioinformatics. Feb. 26, 2008;9:122. doi: 10.1186/1471-2105-9-122.
Grunebaum et al., Recent advances in understanding and managing adenosine deaminase and purine nucleoside phosphorylase deficiencies. Curr Opin Allergy Clin Immunol. Dec. 2013;13(6):630-8. doi: 10.1097/ACI.0000000000000006. cited by applicant .
Gruvnewald et al., Transcriptome-wide off-target RNA editing induced by CRISPR-guided DNA base editors. Nature. May 2019;569(7756):433-437. doi: 10.1038/s41586-019-l 161-z. Epub Apr. 17, 2019.
Gumulya et al., Exploring the past and the future of protein evolution with ancestral sequence reconstruction: the ‘retro’ approach to protein engineering. Biochem J. Jan. 1, 2017 ;474(1):1-19. doi: 10.1042/BCJ20160507.
Guo et al., Facile functionalization of FK506 for biological studies by the thiol-ene ‘click’ reaction. RSC Advances. 2014;22:11400-3.
Gupta et al., Cross-talk between cognate and noncognate RpoE sigma factors and Zn(2+)-binding anti-sigma factors regulates photooxidative stress response in Azospirillum brasilense. Antioxid Redox Signal. Jan. 1, 2014;20(1):42-59. doi: 10.1089/ars.2013.5314. Epub Jul. 19, 2013.
Gupta et al., Sequences in attB that affect the ability of phiC31 integrase to synapse and to activate DNA cleavage. Nucleic Acids Res. 2007;35(10):3407-19. doi: 10.1093/nar/gkm206. Epub May 3, 2007.
Guzman et al., Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. J Bacteriol. 1995;177(14):4121-4130.
Haapaniemi et al., CRISPR-Cas9 genome editing induces a p53-mediated DNA damage response. Nat Med. Jul. 2018;24(7):927-930. doi: 10.1038/s41591-018-0049-z. Epub Jun. 11, 2018.
Haddada et al., Gene therapy using adenovirus vectors. Curr Top Microbiol Immunol. 1995; 199 ( Pt 3):297-306. doi: 10.1007/978-3-642-79586-2_14.
Halmai et al., Targeted CRIPSR/dCas9-mediated reactivation of epigenetically silenced genes suggests limited escape from the inactive X chromosome. 2nd Inti Conf on Epigenetics and Bioengineering. Oct. 4, 2018; Retrieved from the Internet: https://aiche.confex.com/aiche/epibio18/webprogram/paper544785.html. Retrieved Jun. 29, 2020.
Halperin et al., CRISPR-guided DNA polymerases enable diversification of all nucleotides in a tunable window. Nature. Aug. 2018;560(7717):248-252. doi: 10.1038/s41586-018-0384-8. Epub Aug. 1, 2018.
Halvas et al., Role of murine leukemia virus reverse transcriptase deoxyribonucleoside triphosphate-binding site in retroviral replication and in vivo fidelity. J Virol. Nov. 2000;74(22): 10349-58. doi: 10.1128/jvi.74.22.10349-10358.2000.
Handa et al., Template-assisted synthesis of adenine-mutagenized cDNA by a retroelement protein complex. Nucleic Acids Res. Oct. 12, 2018;46(18):9711-9725. doi: 10.1093/nar/gky620.
Hanson et al., Codon optimality, bias and usage in translation and mRNA decay. Nat Rev Mol Cell Biol. Jan. 2018;19(1):20-30. doi: 10.1038/nrm.2017.91. Epub Oct. 11, 2017.
Harms et al., Evolutionary biochemistry: revealing the historical and physical causes of protein properties. Nat Rev Genet. Aug. 2013;14(8):559-71. doi: 10.1038/nrg3540.
Harrington et al., A thermostable Cas9 with increased lifetime in human plasma. Nat Commun. Nov. 10, 2017;8(1): 1424. doi: 10.1038/s41467-017-01408-4.
Hasegawa et al., Spontaneous mutagenesis associated with nucleotide excision repair in Escherichia coli. Genes Cells. May 2008;13(5):459-69. doi: 10.1111/j.1365-2443.2008.01185.x.
Hector et al., CDKL5 variants: Improving our understanding of a rare neurologic disorder. Neurol Genet. Dec. 15, 2017;3(6):e200. doi: 10.1212/NXG.0000000000000200.
Heidenreich et al., Non-homologous end joining as an important mutagenic process in cell cycle-arrested cells. EMBO J. May 1, 2003;22(9):2274-83. doi: 10.1093/emboj/cdg203.
Held et al., In vivo correction of murine hereditary tyrosinemia type I by phiC31 integrase-mediated gene delivery. Mol Ther. Mar. 2005;11(3):399-408. doi: 10.1016/j.ymthe.2004.11.001.
Hendricks et al., The S. cerevisiae Mag1 3-methyladenine DNA glycosylase modulates susceptibility to homologous recombination. DNA Repair (Amst). 2002;1(8):645-659.
Hermonat et al., Use of adeno-associated virus as a mammalian DNA cloning vector: transduction of neomycin resistance into mammalian tissue culture cells. Proc Natl Acad Sci U S A. Oct. 1984;81(20):6466-70. doi: 10.1073/pnas.81.20.6466.
Herschhorn et al., Retroviral reverse transcriptases. Cell Mol Life Sci. Aug. 2010;67(16):2717-47. doi: 10.1007/s00018-010-0346-2. Epub Apr. 1, 2010.
Herzig et al., A Novel Leu92 Mutant of HIV-1 Reverse Transcriptase with a Selective Deficiency in Strand Transfer Causes a Loss of Viral Replication. J Virol. Aug. 2015;89(16):8119-29. doi: 10.1128/JVI.00809-15. Epub May 20, 2015.
Higgs et al., Genetic complexity in sickle cell disease. Proc Natl Acad Sci USA. Aug. 19, 2008;105(33):11595-6. doi: 10.1073/pnas.0806633105. Epub Aug. 11, 2008.
Hille et al., The Biology of CRISPR-Cas: Backward and Forward. Cell. Mar. 8, 2018;172(6): 1239-1259. doi: 10.1016/j.cell.2017.11.032.
Hoang et al., UFBoot2: Improving the Ultrafast Bootstrap Approximation. Mol Biol Evol. Feb. 1, 2018;35(2):518-522. doi: 10.1093/molbev/msx281.
Hoernes et al., Translating the epitranscriptome. Wiley Interdiscip Rev RNA. Jan. 2017;8(1):e1375. doi: 10.1002/wrna.1375. Epub Jun. 27, 2016.
Hollis et al., Phage integrases for the construction and manipulation of transgenic mammals. Reprod Biol Endocrinol. Nov. 7, 2003;1:79. doi: 10.1186/1477-7827-1-79.
Holsinger et al., Signal transduction in T lymphocytes using a conditional allele of Sos. Proc Natl Acad Sci U S A. Oct. 10, 1995;92(21):9810-4. doi: 10.1073/pnas.92.21.9810.
Hoogenboom et al., Natural and designer binding sites made by phage display technology. Immunol Today. Aug. 2000;21(8):371-8.
Hsu et al., DNA targeting specificity of RNA-guided Cas9 nucleases. Nat Biotechnol. Sep. 2013;31(9):827-32. doi: 10.1038/nbt.2647. Epub Jul. 21, 2013. Supplementary Information. 27 pages.
Hu et al., Evolved Cas9 variants with broad PAM compatibility and high DNA specificity. Nature. Apr. 5, 2018;556(7699):57-63. doi: 10.1038/nature26155. Epub Feb. 28, 2018.
Huang et al., Circularly permuted and PAM-modified Cas9 variants broaden the targeting scope of base editors. Nat Biotechnol. Jun. 2019;37(6):626-631. doi: 10.1038/s41587-019-0134-y. Epub May 20, 2019. Including Supplementary Information.
Huggins et al., Flap endonuclease 1 efficiently cleaves base excision repair and DNA replication intermediates assembled into nucleosomes. Mol Cell. Nov. 2002;10(5): 1201-11. doi: 10.1016/81097-2765(02)00736-0.
Hung et al., Protein localization in disease and therapy. J Cell Sci. Oct. 15, 2011;124(Pt 20):3381-92. doi: 10.1242/jcs.089110.
Hwang et al., Web-based design and analysis tools for CRISPR base editing. BMC Bioinformatics. Dec. 27, 2018;19(1):542. doi: 10.1186/s12859-018-2585-4.
Ibba et al., Relaxing the substrate specificity of an aminoacyl-tRNA; synthetase allows in vitro and in vivo synthesis of proteins containing unnatural amino acids. FEBS Lett. May 15, 1995;364(3):272-5.
Ibba et al., Substrate specificity is determined by amino acid binding pocket size in Escherichia coli phenylalanyl-tRNA synthetase. Biochemistry. Jun. 14, 1994;33(23):7107-12.
Ihry et al., p53 inhibits CRISPR-Cas9 engineering in human pluripotent stem cells. Nat Med. Jul. 2018;24(7):939-946. doi: 10.1038/s41591-018-0050-6. Epub Jun. 11, 2018.
Iida et al., A site-specific, conservative recombination system carried by bacteriophage P1. Mapping the recombinase gene cin and the cross-over sites cix for the inversion of the C segment. EMBO J. 1982;1(11): 1445-53.
Iida et al., The Min DNA inversion enzyme of plasmid p15B of Escherichia coli 15T-: a new member of the Din family of site-specific recombinases. Mol Microbiol. Jun. 1990;4(6):991-7. doi: 10.1111/j. 1365-2958.1990.tb00671.x.
Imanishi et al., Detection of N6-methyladenosine based on the methyl-sensitivity of MazF RNA endonuclease. Chem Commun (Camb). Nov. 30, 2017;53(96): 12930-12933. doi: 10.1039/c7cc07699a.
Imburgio et al., Studies of promoter recognition and start site selection by T7 RNA polymerase using a comprehensive collection of promoter variants. Biochemistry. Aug. 29, 2000;39(34):10419-30.
Ingram, A specific chemical difference between the globins of normal human and sickle-cell anaemia haemoglobin. Nature. Oct. 13, 1956;178(4537):792-4. doi: 10.1038/178792a0.
Irion et al., Identification and targeting of the ROSA26 locus in human embryonic stem cells. Nat Biotechnol. Dec. 2007;25(12): 1477-82. doi: 10.1038/nbt1362. Epub Nov. 25, 2007.
Iwai et al., Circular beta-lactamase: stability enhancement by cyclizing the backbone. FEBS Lett. Oct. 8, 1999;459(2): 166-72. doi: 10.1016/s0014-5793(99)01220-x.
Iwai et al., Highly efficient protein trans-splicing by a naturally split DnaE intein from Nostoc punctiforme. FEBS Lett. Mar. 20, 2006;580(7): 1853-8. doi: 10.1016/j.febslet.2006.02.045. Epub Feb. 24, 2006.
Jaffrey et al., Emerging links between m6A and misregulated mRNA methylation in cancer. Genome Med. Jan. 12, 2017;9(1):2. doi: 10.1186/s13073-016-0395-8.
Jardine et al., HIV-1 Vaccines. Priming a broadly neutralizing antibody response to HIV-1 using a germline-targeting immunogen. Science. Jul. 10, 2015;349(6244): 156-61. doi: 10.1126/science.aac5894. Epub Jun. 18, 2015.
Jasin et al., Repair of strand breaks by homologous recombination. Cold Spring Harb Perspect Biol. Nov. 1, 2013;5(11):a012740. doi: 10.1101/cshperspect.a012740.
Jeggo, DNA breakage and repair. Adv Genet. 1998;38:185-218. doi: 10.1016/s0065-2660(08)60144-3.
Jemielity et al., Novel “anti-reverse” cap analogs with superior translational properties. RNA. Sep. 2003;9(9): 1108-22. doi: 10.1261/rna.5430403.
Jeong et al., Measurement of deoxyinosine adduct: Can it be a reliable tool to assess oxidative or nitrosative DNA damage? Toxicol Lett. Oct. 17, 2012;214(2):226-33. doi: 10.1016/j.toxlet.2012.08.013. Epub Aug. 23, 2012.
Jiang et al., CRISPR-Cas9 Structures and Mechanisms. Annu Rev Biophys. May 22, 2017;46:505-529. doi: 10.1146/annurev-biophys-062215-010822. Epub Mar. 30, 2017.
Jin et al., Cytosine, but not adenine, base editors induce genome-wide off-target mutations in rice. Science. Apr. 19, 2019;364(6437):292-295. doi: 10.1126/science.aaw7166. Epub Feb. 28, 2019.
Jiricny, The multifaceted mismatch-repair system. Nat Rev Mol Cell Biol. May 2006;7(5):335-46. doi: 10.1038/nrml907.
Johann et al., GLVR1, a receptor for gibbon ape leukemia virus, is homologous to a phosphate permease of Neurospora crassa and is expressed at high levels in the brain and thymus. J Virol. Mar. 1992;66(3): 1635-40. doi: 10.1128/JVI.66.3.1635-1640.1992.
Johansson et al., RNA Recognition by the MS2 Phage Coat Protein. Seminars in Virology. 1997;8(3): 176-85. https://doi.org/10.1006/smvy.1997.0120.
Johansson et al., Selenocysteine in proteins-properties and biotechnological use. Biochim Biophys Acta. Oct. 30, 2005;1726(1): 1-13. Epub Jun. 1, 2005.
Johns et al., The promise and peril of continuous in vitro evolution. J Mol Evol. Aug. 2005;61(2):253-63. Epub Jun. 27, 2005.9
Joho et al., Identification of a region of the bacteriophage T3 and T7 RNA polymerases that determines promoter specificity. J Mol Biol. Sep. 5, 1990;215(1):31-9.
Joyce et al., Amplification, mutation and selection of catalytic RNA. Gene. Oct. 15, 1989;82(1):83-7. doi: 10.1016/0378-1119(89)90033-4.
Jusiak et al., Comparison of Integrases Identifies Bxb1-GA Mutant as the Most Efficient Site-Specific Integrase System in Mammalian Cells. ACS Synth Biol. Jan. 18, 2019;8(1): 16-24. doi: 10.1021/acssynbio.8b00089. Epub Jan. 9, 2019.
Jyothy et al., Translocation Down syndrome. Indian J Med Sci. Mar. 2002;56(3): 122-6.
Kacian et al., Purification of the DNA polymerase of avian myeloblastosis virus. Biochim Biophys Acta. Sep. 24, 1971;246(3):365-83. doi: 10.1016/0005-2787(71)90773-8.
Kaczmarczyk et al., Manipulating the Prion Protein Gene Sequence and Expression Levels with CRISPR/Cas9. PLoS One. Apr. 29, 2016;11(4):e0154604. doi: 10.1371/journal.pone.0154604.
Kadoch et al., Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell. Mar. 28, 2013;153(1):71-85. doi: 10.1016/j.cell.2013.02.036.
Kahmann et al., G inversion in bacteriophage Mu DNA is stimulated by a site within the invertase gene and a host factor. Cell. Jul. 1985;41(3):771-80. doi: 10.1016/s0092-8674(85)80058-1.
Kalyaanamoorthy et al., ModelFinder: fast model selection for accurate phylogenetic estimates. Nat Methods. Jun. 2017;14(6):587-589. doi: 10.1038/nmeth.4285. Epub May 8, 2017.
Kao et al., Cleavage specificity of Saccharomyces cerevisiae flap endonuclease 1 suggests a double-flap structure as the cellular substrate. J Biol Chem. Apr. 26, 2002;277(17): 14379-89. doi: 10.1074/jbc.M110662200. Epub Feb. 1, 2002.
Karimova et al., Discovery of Nigri/nox and Panto/pox site-specific recombinase systems facilitates advanced genome engineering. Sci Rep. Jul. 22, 2016;6:30130. doi: 10.1038/srep30130.
Karimova et al., Vika/vox, a novel efficient and specific Cre/loxP-like site-specific recombination system. Nucleic Acids Res. Jan. 2013;41(2):e37. doi: 10.1093/nar/gks1037. Epub Nov. 9, 2012.
Katafuchi et al., DNA polymerases involved in the incorporation of oxidized nucleotides into DNA: their efficiency and template base preference. Mutat Res. Nov. 28, 2010;703(1):24-31. doi: 10.1016/j.mrgentox.2010.06.004. Epub Jun. 11, 2010.
Kato et al., Improved purification and enzymatic properties of three forms of reverse transcriptase from avian myeloblastosis virus. J Virol Methods. Dec. 1984;9(4):325-39. doi: 10.1016/0166-0934(84)90058-2.
Katoh et al., MAFFT multiple sequence alignment software version 7: improvements in performance and usability. Mol Biol Evol. Apr. 2013;30(4):772-80. doi: 10.1093/molbev/mst010. Epub Jan. 16, 2013.
Kaufman et al., Translational efficiency of polycistronic mRNAs and their utilization to express heterologous genes in mammalian cells. EMBO J. Jan. 1987;6(1): 187-93.
Kavli et al., Excision of cytosine and thymine from DNA by mutants of human uracil-DNA glycosylase. EMBO J. Jul. 1, 1996; 15(13):3442-7.
Kawarasaki et al., Enhanced crossover SCRATCHY: construction and high-throughput screening of a combinatorial library containing multiple non-homologous crossovers. Nucleic Acids Res. Nov. 1, 2003;31(21):e126.
Keijzers et al., Human exonuclease 1 (EXO1) activity characterization and its function on flap structures. Biosci Rep. Apr. 25, 2015;35(3):e00206. doi: 10.1042/BSR20150058.
Kelman, PCNA: structure, functions and interactions. Oncogene. Feb. 13, 1997;14(6):629-40. doi: 10.1038/sj.onc. 1200886.
Keravala et al., A diversity of serine phage integrases mediate site-specific recombination in mammalian cells. Mol Genet Genomics. Aug. 2006;276(2): 135-46. doi: 10.1007/s00438-006-0129-5. Epub May 13, 2006.
Kessel et al., Murine developmental control genes. Science. Jul. 27, 1990;249(4967):374-9. doi: 10.1126/science.1974085.
Kessler et al., Gene delivery to skeletal muscle results in sustained expression and systemic delivery of a therapeutic protein. Proc Natl Acad Sci U S A. Nov. 26, 1996;93(24): 14082-7. doi: 10.1073/pnas.93.24.14082.
Ketha et al., Application of bioinformatics-coupled experimental analysis reveals a new transport-competent nuclear localization signal in the nucleoprotein of Influenza A virus strain. BMC Cell Biol. Apr. 28, 2008; 9:22. https://doi.org/10.1186/1471-2121-9-22.
Kilcher et al., Brochothrix thermosphacta bacteriophages feature heterogeneous and highly mosaic genomes and utilize unique prophage insertion sites. J Bacteriol. Oct. 2010;192(20):5441-53. doi: 10.1128/JB.00709-10. Epub Aug. 13, 2010.
Kim et al., DJ-1, a novel regulator of the tumor suppressor PTEN. Cancer Cell. 2005;7(3):263-273.
Kim et al., Genome-wide target specificity of CRISPR RNA-guided adenine base editors. Nat Biotechnol. Apr. 2019;37(4):430-435. doi: 10.1038/s41587-019-0050-1. Epub Mar. 4, 2019.
Kim et al., An anionic human protein mediates cationic liposome delivery of genome editing proteins into mammalian cells. Nat Commun. Jul. 2, 2019;10(1):2905. doi: 10.1038/s41467-019-10828-3.
Kim et al., Evaluating and Enhancing Target Specificity of Gene-Editing Nucleases and Deaminases. Annu Rev Biochem. Jun. 20, 2019;88:191-220. doi: 10.1146/annurev-biochem-013118-111730. Epub Mar. 18, 2019.
Kim et al., High cleavage efficiency of a 2A peptide derived from porcine teschovirus-1 in human cell lines, zebrafish and mice. PLoS One. 2011;6(4):el8556. doi: 10.1371/journal.pone.0018556. Epub Apr. 29, 2011.
Kim et al., In vivo high-throughput profiling of CRISPR-Cpf1 activity. Nat Methods. Feb. 2017;14(2): 153-159. doi: 10.1038/nmeth.4104. Epub Dec. 19, 2016.
Kim et al., Mycobacteriophage Bxb1 integrates into the Mycobacterium smegmatis groEL1 gene. Mol Microbiol. Oct. 2003;50(2):463-73. doi: 10.1046/j.l365-2958.2003.03723.x.
Kim et al., Rescue of high-specificity Cas9 variants using sgRNAs with matched 5′ nucleotides. Genome Biol. Nov. 15, 2017;18(1):218. doi: 10.1186/s13059-017-1355-3.
Kim et al., Structural and kinetic characterization of Escherichia coli TadA, the wobble-specific tRNA deaminase. Biochemistry. May 23, 2006;45(20):6407-16. doi: 10.1021/bi0522394. PMID: 16700551.
Klapacz et al., Frameshift mutagenesis and micro satellite instability induced by human alkyladenine DNA glycosylase. Mol Cell. Mar. 26, 2010;37(6):843-53. doi: 10.1016/j.molcel.2010.01.038.
Kleiner et al., In vitro selection of a DNA-templated small-molecule library reveals a class of macrocyclic kinase inhibitors. J Am Chem Soc. Aug. 25, 2010;132(33): 11779-91. doi: 10.1021/jal04903x.
Klement et al., Discrimination between bacteriophage T3 and T7 promoters by the T3 and T7 RNA polymerases depends primarily upon a three base-pair region located 10 to 12 base-pairs upstream from the start site. J Mol Biol. Sep. 5, 1990;215(1):21-9.
Klompe et al., Transposon-encoded CRISPR-Cas systems direct RNA-guided DNA integration. Nature. Jul. 2019;571(7764):219-225. doi: 10.1038/s41586-019-1323-z. Epub Jun. 12, 2017.
Knott et al., Guide-bound structures of an RNA-targeting A-cleaving CRISPR-Cas 13a enzyme. Nat Struct Mol Biol. Oct. 2017;24(10):825-833. doi: 10.1038/nsmb.3466. Epub Sep. 11, 2017.
Kohli et al., A portable hot spot recognition loop transfers sequence preferences from APOBEC family members to activation-induced cytidine deaminase. J Biol Chem. Aug. 21, 2009;284(34):22898-904. doi: 10.1074/jbc.M109.025536. Epub Jun. 26, 2009.
Koike-Yusa et al., Genome-wide recessive genetic screening in mammalian cells with a lentiviral CRISPR-guide RNA library. Nat Biotechnol. Mar. 2014;32(3):267-73. doi: 10.1038/nbt.2800. Epub Dec. 23, 2013.
Kolot et al., Kolot M, Malchin N, Elias A, Gritsenko N, Yagil E. Site promiscuity of coliphage HK022 integrase as a tool for gene therapy. Gene Ther. Jul. 2015;22(7):521-7. doi: 10.1038/gt.2015.9. Epub Mar. 12, 2015.
Kolot et al., Site-specific recombination in mammalian cells expressing the Int recombinase of bacteriophage HK022. Mol Biol Rep. Aug. 1999;26(3):207-13. doi: 10.1023/a:1007096701720.
Komor, Editing the Genome Without Double-Stranded DNA Breaks. ACS Chem Biol. Feb. 16, 2018;13(2):383-388. doi: 10.1021/acschembio.7b00710. Epub Oct. 9, 2017.
Konermann et al., Genome-scale transcriptional activation by an engineered CRISPR-Cas9 complex. Nature. Jan. 29, 2015;517(7536):583-8. doi: 10.1038/nature14136. Epub Dec. 10, 2014.
Kosicki et al., Repair of double-strand breaks induced by CRISPR-Cas9 leads to large deletions and complex rearrangements. Nat Biotechnol. Sep. 2018;36(8):765-771. doi: 10.1038/nbt.4192. Epub Jul. 16, 2018.
Kotewicz et al., Cloning and overexpression of Moloney murine leukemia virus reverse transcriptase in Escherichia coli. Gene. 1985;35(3):249-58. doi: 10.1016/0378-1119(85)90003-4.
Kotewicz et al., Isolation of cloned Moloney murine leukemia virus reverse transcriptase lacking ribonuclease H activity. Nucleic Acids Res. Jan. 11, 1988; 16(1):265-77. doi: 10.1093/nar/16.1.265.
Kotin, Prospects for the use of adeno-associated virus as a vector for human gene therapy. Hum Gene Ther. Jul. 1994;5(7):793-801. doi: 10.1089/hum. 1994.5.7-793.
Kowalski et al., Delivering the Messenger: Advances in Technologies for Therapeutic mRNA Delivery. Mol Ther. Apr. 10, 2019;27(4):710-728. doi: 10.1016/j.ymthe.2019.02.012. Epub Feb. 19, 2019.
Kozak, An analysis of 5′-noncoding sequences from 699 vertebrate messenger RNAs. Nucleic Acids Res. Oct. 26, 1987;15(20):8125-48. doi: 10.1093/nar/15.20.8125.
Kraft et al., Deletions, Inversions, Duplications: Engineering of Structural Variants using CRISPR/Cas in Mice. Cell Rep. Feb. 10, 2015;10(5):833-839. doi: 10.1016/j.celrep.2015.01.016. Epub Feb. 7, 2015.
Kremer et al., Adenovirus and adeno-associated virus mediated gene transfer. Br Med Bull. Jan. 1995;51(1):31-44. doi: 10.1093/oxfordjournals.bmb.a072951.
Krokan et al., Uracil in DNA—occurrence, consequences and repair. Oncogene. Dec. 16, 2002;21(58):8935-48. doi: 10.1038/sj.onc.1205996.
Krokan et al., Base excision repair. Cold Spring Harb Perspect Biol. Apr. 1, 2013;5(4):a012583. doi: 10.1101/cshperspect.a012583.
Krzywkowski et al., Limited reverse transcriptase activity of phi29 DNA polymerase. Nucleic Acids Res. Apr. 20, 2018;46(7):3625-3632. doi: 10.1093/nar/gkyl90.
Kügler et al., Human synapsin 1 gene promoter confers highly neuron-specific long-term transgene expression from an adenoviral vector in the adult rat brain depending on the transduced area. Gene Ther. Feb. 2003;10(4):337-47. doi: 10.1038/sj.gt.3301905.
Kunkel et al., Eukaryotic Mismatch Repair in Relation to DNA Replication. Annu Rev Genet. 2015;49:291-313. doi: 10.1146/annurev-genet-112414-054722.
Kurjan et al., Structure of a yeast pheromone gene (MF alpha): a putative alpha-factor precursor contains four tandem mature alpha-factor. Cell. Oct. 1982;30(3):933-43. doi: 10.1016/0092-8674(82)90298-7.
Kuscu et al., CRISPR-Cas9-AID base editor is a powerful gain-of-function screening tool. Nat Methods. Nov. 29, 2016;13(12):983-984. doi: 10.1038/nmeth.4076.
Kwart et al., Precise and efficient scarless genome editing in stem cells using Correct. Nat Protoc. Feb. 2017;12(2):329-354. doi: 10.1038/nprot.2016.171. Epub Jan. 19, 2017.
Kweon et al., Fusion guide RNAs for orthogonal gene manipulation with Cas9 and Cpf1. Nat Commun. Nov. 23, 2017;8(1):1723. doi: 10.1038/s41467-017-01650-w. Erratum in: Nat Commun. Jan. 16, 2018;9(1):303.
Lada et al., Mutator effects and mutation signatures of editing deaminases produced in bacteria and yeast. Biochemistry (Mose). Jan. 2011;76(1):131-46.
Lakich et al., Inversions disrupting the factor VIII gene are a common cause of severe haemophilia A. Nat Genet. Nov. 1993;5(3):236-41. doi: 10.1038/ng1193-236.
Lauer et al., Construction, characterization, and use of two Listeria monocytogenes site-specific phage integration vectors. J Bacteriol. Aug. 2002;184(15):4177-86. doi: 10.1128/jb.184.15.4177-4186.2002.
Lawyer et al., High-level expression, purification, and enzymatic characterization of full-length Thermus aquaticus DNA polymerase and a truncated form deficient in 5′ to 3′ exonuclease activity. PCR Methods Appl. May 1993;2(4):275-87. doi: 10.1101/gr.2.4.275.
Lazarevic et al., Nucleotide sequence of the Bacillus subtilis temperate bacteriophage SPbetac2. Microbiology (Reading). May 1999;145 ( Pt 5):1055-1067. doi: 10.1099/13500872-145-5-1055.
Le Grice et al., Purification and characterization of recombinant equine infectious anemia virus reverse transcriptase. J Virol. Dec. 1991;65(12):7004-7. doi: 10.1128/JVI.65.12.7004-7007.1991.
Leaver-Fay et al., ROSETTA3: an object-oriented software suite for the simulation and design of macromolecules. Methods Enzymol. 2011;487:545-74. doi: 10.1016/B978-0-12-381270-4.00019-6.
Leconte et al., A population-based experimental model for protein evolution: effects of mutation rate and selection stringency on evolutionary outcomes. Biochemistry. Feb. 26, 2013;52(8): 1490-9. doi: 10.1021/bi3016185. Epub Feb. 14, 2013.
Lee et al., Group I Intron-Based Therapeutics Through Trans-Splicing Reaction. Prog Mol Biol Transl Sci. 2018;159:79-100. doi: 10.1016/bs.pmbts.2018.07.001. Epub Aug. 9, 2018.
Lee et al., Simultaneous targeting of linked loci in mouse embryos using base editing. Sci Rep. Feb. 7, 2019;9(1):1662. doi: 10.1038/s41598-018-33533-5.
Lee et al., Site-specific integration of mycobacteriophage L5: integration-proficient vectors for Mycobacterium smegmatis, Mycobacterium tuberculosis, and bacille Calmette-Guerin. Proc Natl Acad Sci U S A. Apr. 15, 1991;88(8):3111-5. doi: 10.1073/pnas.88.8.3111.
Lee et al., Synthetically modified guide RNA and donor DNA are a versatile platform for CRISPR-Cas9 engineering. Elife. May 2, 2017;6:e25312. doi: 10.7554/eLife.25312.
Lee et al., Targeted chromosomal deletions in human cells using zinc finger nucleases. Genome Res. Jan. 20, 2010: 81-89; Published in Advance Dec. 1, 2009, doi:10.1101/gr.099747.109.
Lee et al., Targeting fidelity of adenine and cytosine base editors in mouse embryos. Nat Commun. Nov. 15, 2018;9(1):4804. doi: 10.1038/s41467-018-07322-7.
Lee et al., Transcriptional regulation and its misregulation in disease. Cell. Mar. 14, 2013;152(6):1237-51. doi: 10.1016/j.cell.2013.02.014.
Lei et al., Site-specificity of serine integrase demonstrated by the attB sequence preference of ?BT1 integrase. FEBS Lett. Apr. 2018;592(8):1389-1399. doi: 10.1002/1873-3468.13023. Epub Mar. 25, 2018.
Lemos et al., CRISPR/Cas9 cleavages in budding yeast reveal templated insertions and strand-specific insertion/deletion profiles. Proc Natl Acad Sci U S A. Feb. 27, 2018;115(9):E2040-E2047. doi: 10.1073/pnas.1716855115. Epub Feb. 13, 2018.
Levy et al., Membrane-associated guanylate kinase dynamics reveal regional and developmental specificity of synapse stability. J Physiol. Mar. 1, 2017;595(5):1699-1709. doi: 10.1113/JP273147. Epub Jan. 18, 2017.
Lew et al., Protein splicing in vitro with a semisynthetic two-component minimal intein. J Biol Chem. Jun. 26, 1998;273(26):15887-90. doi: 10.1074/jbc.273.26.15887.
Lewis et al., Cytosine deamination and the precipitous decline of spontaneous mutation during Earth's history. Proc Natl Acad Sci U S A. Jul. 19, 2016; 113(29):8194-9. doi: 10.1073/pnas.1607580113. Epub Jul. 5, 2016.
Lewis et al., RNA modifications and structures cooperate to guide RNA-protein interactions. Nat Rev Mol Cell Biol. Mar. 2017;18(3):202-210. doi: 10.1038/nrm.2016.163. Epub Feb. 1, 2017.
Li et al., A Radioactivity-Based Assay for Screening Human m6A-RNA Methyltransferase, METTL3-METTL14 Complex, and Demethylase ALKBH5. J Biomol Screen. Mar. 2016;21(3):290-7. doi: 10.1177/1087057115623264. Epub Dec. 23, 2015.
Li et al., Fast and accurate short read alignment with Burrows-Wheeler transform. Bioinformatics. Jul. 15, 2009;25(14):1754-60. doi: 10.1093/bioinformatics/btp324. Epub May 18, 2009.
Li et al., Lagging strand DNA synthesis at the eukaryotic replication fork involves binding and stimulation of FEN-1 by proliferating cell nuclear antigen. J Biol Chem. Sep. 22, 1995;270(38):22109-12. doi: 10.1074/jbc.270.38.22109.
Li et al., Loss of post-translational modification sites in disease. Pac Symp Biocomput. 2010:337-47. doi: 10.1142/9789814295291_0036.
Li et al., Protein trans-splicing as a means for viral vector-mediated in vivo gene therapy. Hum Gene Ther. Sep. 2008;19(9):958-64. doi: 10.1089/hum.2008.009.
Li et al., RSEM: accurate transcript quantification from RNA-Seq data with or without a reference genome. BMC Bioinformatics. Aug. 4, 2011;12:323. doi: 10.1186/1471-2105-12-323.
Li, Mechanisms and functions of DNA mismatch repair. Cell Res. Jan. 2008;18(1):85-98. doi: 10.1038/cr.2007.115.
Liang et al., Correction of ?-thalassemia mutant by base editor in human embryos. Protein Cell. Nov. 2017;8(ll):811-822. doi: 10.1007/s13238-017-0475-6. Epub Sep. 23, 2017.
Liang et al., Homology-directed repair is a major double-strand break repair pathway in mammalian cells. Proc Natl Acad Sci U S A. Apr. 28, 1998;95(9):5172-7. doi: 10.1073/pnas.95.9.5172.
Lienert et al., Two- and three-input TALE-based AND logic computation in embryonic stem cells. Nucleic Acids Res. Nov. 2013;41(21):9967-75. doi: 10.1093/nar/gkt758. Epub Aug. 27, 2013.
Lim et al., Crystal structure of the moloney murine leukemia virus RNase H domain. J Virol. Sep. 2006;80(17):8379-89. doi: 10.1128/JVI.00750-06.
Lin et al., The human REV 1 gene codes for a DNA template-dependent dCMP transferase. Nucleic Acids Res. Nov. 15, 1999;27(22):4468-75. doi: 10.1093/nar/27.22.4468.
Liu et al., Split dnaE genes encoding multiple novel inteins in Trichodesmium erythraeum. J Biol Chem. Jul. 18, 2003;278(29):26315-8. doi: 10.1074/jbc.C300202200. Epub May 24, 2003.
Liu et al., A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation. Nat Chem Biol. Feb. 2014;10(2):93-5. doi: 10.1038/nchembio.1432. Epub Dec. 6, 2013.
Liu et al., Adding new chemistries to the genetic code. Annu Rev Biochem. 2010;79:413-44. doi: 10.1146/annurev.biochem.052308.105824.
Liu et al., Calcineurin is a common target of cyclophilin-cyclosporin A and FKBP-FK506 complexes. Cell. Aug. 23, 1991;66(4):807-15. doi: 10.1016/0092-8674(91)90124-h.
Liu et al., CasX enzymes comprise a distinct family of RNA-guided genome editors. Nature. Feb. 2019;566(7743):218-223. doi: 10.1038/s41586-019-0908-x. Epub Feb. 4, 2019. Author manuscript entitled CRISPR-CasX is an RNA-dominated enzyme active for human genome editing.
Liu et al., Direct Promoter Repression by BCL11A Controls the Fetal to Adult Hemoglobin Switch. Cell. Apr. 5, 2018;173(2):430-442.e17. doi: 10.1016/j.cell.2018.03.016. Epub Mar. 29, 2018.
Liu et al., Editing DNA Methylation in the Mammalian Genome. Cell. Sep. 22, 2016; 167(1):233-247.e17. doi: 10.1016/j.cell.2016.08.056.
Liu et al., Flap endonuclease 1: a central component of DNA metabolism. Annu Rev Biochem. 2004;73:589-615. doi: 10.1146/annurev.biochem.73.012803.092453.
Liu et al., Genetic incorporation of unnatural amino acids into proteins in mammalian cells. Nat Methods. Mar. 2007;4(3):239-44. Epub Feb. 25, 2007.
Liu et al., Highly efficient RNA-guided base editing in rabbit. Nat Commun. Jul. 13, 2018;9(1):2717. doi: 10.1038/s41467-018-05232-2.
Liu et al., N(6)-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions. Nature. Feb. 25, 20156;518(7540):560-4. doi: 10.1038/nature14234.
Liu et al., Probing N6-methyladenosine RNA modification status at single nucleotide resolution in mRNA and long noncoding RNA. RNA. Dec. 2013;19(12): 1848-56. doi: 10.1261/ma.041178.113. Epub Oct. 18, 2013.
Liu et al., Reverse transcriptase of foamy virus. Purification of the enzymes and immunological identification. Arch Virol. 1977;55(3): 187-200. doi: 10.1007/BF01319905.
Liu et al., Reverse transcriptase-mediated tropism switching in Bordetella bacteriophage. Science. Mar. 15, 2002;295(5562):2091-4. doi: 10.1126/science. 1067467.
Liu et al., Saccharomyces cerevisiae flap endonuclease 1 uses flap equilibration to maintain triplet repeat stability. Mol Cell Biol. May 2004;24(9):4049-64. doi: 10.1128/MCB.24.9.4049-4064.2004.
Liu et al., The Molecular Architecture for RNA-Guided RNA Cleavage by Cas13a. Cell. Aug. 10, 2017;170(4):714-726.e10. doi: 10.1016/j.cell.2017.06.050. Epub Jul. 27, 2017.
Loessner et al., Complete nucleotide sequence, molecular analysis and genome structure of bacteriophage A118 of Listeria monocytogenes: implications for phage evolution. Mol Microbiol. Jan. 2000;35(2):324-40. doi: 10.1046/j.1365-2958.2000.01720.x.
Long et al., Postnatal genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy. Science. Jan. 22, 2016;351(6271):400-3. doi: 10.1126/science.aad5725. Epub Dec. 31, 2015.
Lopez-Girona et al., Cereblon is a direct protein target for immunomodulatory and antiproliferative activities of lenalidomide and pomalidomide. Leukemia. Nov. 2012;26(11):2326-35. doi: 10.1038/leu.2012.119. Epub May 3, 2012.
Lorenz et al., ViennaRNA Package 2.0. Algorithms Mol Biol. Nov. 24, 2011;6:26. doi: 10.1186/1748-7188-6-26.
Luan et al., Reverse transcription of R2Bm RNA is primed by a nick at the chromosomal target site: a mechanism for non-LTR retrotransposition. Cell. Feb. 26, 1993;72(4):595-605. doi: 10.1016/0092-8674(93)90078-5.
Luckow et al., High level expression of nonfused foreign genes with Autographa califomica nuclear polyhedrosis virus expression vectors. Virology. May 1989;170(1):31-9. doi: 10.1016/0042-6822(89)90348-6.
Lukacsovich et al., Repair of a specific double-strand break generated within a mammalian chromosome by yeast endonuclease I-SceI. Nucleic Acids Res. Dec. 25, 1994;22(25):5649-57. doi: 10.1093/nar/22.25.5649.
Luke et al., Partial purification and characterization of the reverse transcriptase of the simian immunodeficiency virus TYO-7 isolated from an African green monkey. Biochemistry. Feb. 20, 1990;29(7): 1764-9. doi: 10.1021/bi00459a015.
Lynch, Evolution of the mutation rate. Trends Genet. Aug. 2010;26(8):345-52. doi: 10.1016/j.tig.2010.05.003. Epub Jun. 30, 2010.
Ma et al., Identification of pseudo attP sites for phage phiC31 integrase in bovine genome. Biochem Biophys Res Commun. Jul. 7, 2006;345(3):984-8. doi: 10.1016/j.bbrc.2006.04.145. Epub May 3, 2006.
Ma et al., In vitro protein engineering using synthetic tRNA(A1a) with different anticodons. Biochemistry. Aug. 10, 1993;32(31):7939-45.
Ma et al., PhiC31 integrase induces efficient site-specific recombination in the Capra hircus genome. DNA Cell Biol. Aug. 2014;33(8):484-91. doi: 10.1089/dna.2013.2124. Epub Apr. 22, 2014.
Maas et al., Identification and characterization of a human tRNA-specific adenosine deaminase related to the ADAR family of pre-mRNA editing enzymes. Proc Natl Acad Sci U S A. Aug. 3, 1999;96(16):8895-900. doi: 10.1073/pnas.96.16.8895.
Macbeth et al., Inositol hexakisphosphate is bound in the ADAR2 core and required for RNA editing. Science. Sep. 2, 2005;309(5740): 1534-9. doi: 10.1126/science.1113150.
Macrae et al., Ribonuclease revisited: structural insights into ribonuclease III family enzymes. Curr Opin Struct Biol. Feb. 2007;17(l):138-45. doi: 10.1016/j.sbi.2006.12.002. Epub Dec. 27, 2006.
Magin et al., Corf, the Rev/Rex homologue of HTDV/HERV-K, encodes an arginine-rich nuclear localization signal that exerts a trans-dominant phenotype when mutated. Virology. Aug. 15, 2000;274(1):11-6. doi: 10.1006/viro.2000.0438.
Maji et al., A High-Throughput Platform to Identify Small-Molecule Inhibitors of CRISPR-Cas9. Cell. May 2, 2019;177(4):1067-1079.el9. doi: 10.1016/j.cell.2019.04.009.
Makarova et al., Classification and Nomenclature of CRISPR-Cas Systems: Where from Here? CRISPR J. Oct. 2018;1(5):325-336. doi: 10.1089/crispr.2018.0033.
Makeyev et al., Evolutionary potential of an RNA virus. J Virol. Feb. 2004;78(4):2114-20.
Malashkevich et al., Crystal structure of tRNA adenosine deaminase Tad A from Escherichia coli. Deposited: Mar. 10, 2005 Released: Feb. 21, 2006 doi:10.2210/pdb1z3a/pdb (2006).
Malito et al., Structural basis for lack of toxicity of the diphtheria toxin mutant CRM197. Proc Natl Acad Sci U S A. Apr. 3, 2012;109(14):5229-34. doi: 10.1073/pnas.1201964109. Epub Mar. 19, 2012.
Mandal et al., Efficient ablation of genes in human hematopoietic stem and effector cells using CRISPR/Cas9. Cell Stem Cell. Nov. 6, 2014;15(5):643-52. doi: 10.1016/j.stem.2014.10.004. Epub Nov. 6, 2014.
Marceau, Functions of single-strand DNA-binding proteins in DNA replication, recombination, and repair. Methods Mol Biol. 2012;922:1-21. doi: 10.1007/978-1-62703-032-8_1.
Maresca et al., Obligate ligation-gated recombination (ObLiGaRe): custom-designed nuclease-mediated targeted integration through nonhomologous end joining. Genome Res. Mar. 2013;23(3):539-46. Doi: 10.1101/gr.145441.112. Epub Nov. 14, 2012.
Martinez et al., Hypermutagenesis of RNA using human immunodeficiency virus type 1 reverse transcriptase and biased dNTP concentrations. Proc Natl Acad Sci U S A. Dec. 6, 1994;91(25): 11787-91. doi: 10.1073/pnas.91.25.11787.
Martsolf et al., Complete trisomy 17p a relatively new syndrome. Ann Genet. 1988;31(3):172-4.
Mascola et al., HIV-1 neutralizing antibodies: understanding nature's pathways. Immunol Rev. Jul. 2013;254(l):225-44. doi: 10.1111/imr.12075.
Mathys et al., Characterization of a self-splicing mini-intein and its conversion into autocatalytic N- and C-terminal cleavage elements: facile production of protein building blocks for protein ligation. Gene. Apr. 29, 1999;231(l-2): 1-13. doi: 10.1016/s0378-1119(99)00103-1.
Matsuura et al., A gene essential for the site-specific excision of actinophage r4 prophage genome from the chromosome of a lysogen. J Gen Appl Microbiol. 1995;41(1):53-61.
Matthews, Structures of human ADAR2 bound to dsRNA reveal base-flipping mechanism and basis for site selectivity. Nat Struct Mol Biol. May 2016;23(5):426-33. doi: 10.1038/nsmb.3203. Epub Apr. 11, 2016.
May et al., Emergent lineages of mumps virus suggest the need for a polyvalent vaccine. Int J Infect Dis. Jan. 2018;66:1-4. doi: 10.1016/j.ijid.2017.09.024. Epub Oct. 4, 2017.
McCarroll et al., Copy-number variation and association studies of human disease. Nat Genet. Jul. 2007;39(7 Suppl):S37-42. doi: 10.1038/ng2080.
McDonald et al., Characterization of mutations at the mouse phenylalanine hydroxylase locus. Genomics. Feb. 1, 1997;39(3):402-5. doi: 10.1006/geno. 1996.4508.
McInerney et al., Error Rate Comparison during Polymerase Chain Reaction by DNA Polymerase. Mol Biol Int. 2014;2014:287430. doi: 10.1155/2014/287430. Epub Aug. 17, 2014.
McKenna et al., Recording development with single cell dynamic lineage tracing. Development. Jun. 27, 2019;146(12):dev169730. doi: 10.1242/dev. 169730.
McKenna et al., Whole-organism lineage tracing by combinatorial and cumulative genome editing. Science. Jul. 29, 2016;353(6298):aaf7907. doi: 10.1126/science.aaf7907. Epub May 26, 2016.
McNaughton et al., Mammalian cell penetration, siRNA transfection, and DNA transfection by supercharged proteins. Proc Natl Acad Sci U S A. Apr. 14, 2009;106(15):6111-6. doi: 10.1073/pnas.0807883106. Epub Mar. 23, 2009.
McVey et al., MMEJ repair of double-strand breaks (director's cut): deleted sequences and alternative endings. Trends Genet. Nov. 2008;24(11):529-38. doi: 10.1016/j.tig.2008.08.007. Epub Sep. 21, 2008.
Mead et al., A novel protective prion protein variant that colocalizes with kuru exposure. N Engl J Med. Nov. 19, 2009;361(21):2056-65. doi: 10.1056/NEJMoa0809716.
Meinke et al., Cre Recombinase and Other Tyrosine Recombinases. Chem Rev. Oct. 26, 2016;116(20):12785-12820. doi: 10.1021/acs.chemrev.6b00077. Epub May 10, 2016.
Menendez-Arias, Mutation rates and intrinsic fidelity of retroviral reverse transcriptases. Viruses. Dec. 2009;1(3):1137-65. doi: 10.3390/v1031137. Epub Dec. 4, 2009.
Mertens et al., Site-specific recombination in bacteriophage Mu: characterization of binding sites for the DNA invertase Gin. EMBO J. Apr. 1988;7(4):1219-27.
Meyer et al., Comprehensive analysis of mRNA methylation reveals enrichment in 3′ UTRs and near stop codons. Cell. Jun. 22, 2012; 149(7): 1635-46. doi: 10.1016/j.cell.2012.05.003. Epub May 17, 2012.
Meyer et al., Library generation by gene shuffling. Curr Protoc Mol Biol. Jan. 6, 2014;105:Unit 15.12.. doi: 10.1002/0471142727.mb1512s105.
Meyer et al., The dynamic epitranscriptome: N6-methyladenosine and gene expression control. Nat Rev Mol Cell Biol. May 2014;15(5):313-26. doi: 10.1038/nrm3785. Epub Apr. 9, 2014.
Michel et al., Mitochondrial class II introns encode proteins related to the reverse transcriptases of retroviruses. Nature. Aug. 15-21, 1985;316(6029):641-3. doi: 10.1038/316641a0.
Mihai et al., PTEN inhibition improves wound healing in lung epithelia through changes in cellular mechanics that enhance migration. Am J Physiol Lung Cell Mol Physiol. 2012;302(3):L287-L299.
Mijakovic et al., Bacterial single-stranded DNA-binding proteins are phosphorylated on tyrosine. Nucleic Acids Res. Mar. 20, 2006;34(5):1588-96. doi: 10.1093/nar/gkj514.
Miller et al., Construction and properties of retrovirus packaging cells based on gibbon ape leukemia virus. J Virol. May 1991;65(5):2220-4. doi: 10.1128/JVI.65.5.2220-2224.1991.
Miller, Human gene therapy comes of age. Nature. Jun. 11, 1992;357(6378):455-60. doi: 10.1038/357455a0.
Mills et al., Protein splicing in trans by purified N- and C-terminal fragments of the Mycobacterium tuberculosis RecA intein. Proc Natl Acad Sci USA. Mar. 31, 1998;95(7):3543-8. doi: 10.1073/pnas.95.7.3543.
Mishina et al., Conditional gene targeting on the pure C57BL/6 genetic background. Neurosci Res. Jun. 2007;58(2):105-12. doi: 10.1016/j.neures.2007.01.004. Epub Jan. 18, 2007.
Mitani et al., Delivering therapeutic genes—matching approach and application. Trends Biotechnol. May 1993;11(5):162-6. doi: 10.1016/0167-7799(93)90108-L.
Mitton-Fry et al., Poly(A) tail recognition by a viral RNA element through assembly of a triple helix. Science. Nov. 26, 2010;330(6008): 1244-7. doi: 10.1126/science.1195858.
Miyaoka et al., Systematic quantification of HDR and NHEJ reveals effects of locus, nuclease, and cell type on genome-editing. Sci Rep. Mar. 31, 2016;6:23549. doi: 10.1038/srep23549.
Moede et al., Identification of a nuclear localization signal, RRMKWKK, in the homeodomain transcription factor PDX-1. FEBS Lett. Nov. 19, 1999;461(3):229-34. doi: 10.1016/s0014-5793(99)01446-5.
Mohr et al., A Reverse Transcriptase-Cas1 Fusion Protein Contains a Cas6 Domain Required for Both CRISPR RNA Biogenesis and RNA Spacer Acquisition. Mol Cell. Nov. 15, 2018;72(4):700-714.e8. doi: 10.1016/j.molcel.2018.09.013. Epub Oct. 18, 2018.
Mohr et al., Thermostable group II intron reverse transcriptase fusion proteins and their use in cDNA synthesis and next-generation RNA sequencing. RNA. Jul. 2013;19(7):958-70. doi: 10.1261/ma.039743.113. Epub May 22, 2013.
Mok et al., A bacterial cytidine deaminase toxin enables CRISPR-free mitochondrial base editing. Nature. Jul. 2020;583(7817):631-637. doi: 10.1038/s41586-020-2477-4. Epub Jul. 8, 2020.
Molla et al., CRISPR/Cas-Mediated Base Editing: Technical Considerations and Practical Applications. Trends Biotechnol. Oct. 2019;37(10): 1121-1142. doi: 10.1016/j.tibtech.2019.03.008. Epub Apr. 14, 2019.
Monot et al., The specificity and flexibility of 11 reverse transcription priming at imperfect T-tracts. PLoS Genet. May 2013;9(5):el003499. doi: 10.1371/journal.pgen.1003499. Epub May 9, 2013.
Morita et al., The site-specific recombination system of actinophage TGI. FEMS Microbiol Lett. Aug. 2009;297(2):234-40. doi: 10.1111/j.1574-6968.2009.01683.x.
Muir et al., Expressed protein ligation: a general method for protein engineering. Proc Natl Acad Sci U S A. Jun. 9, 1998;95(12):6705-10. doi: 10.1073/pnas.95.12.6705.
Muller et al., Nucleotide exchange and excision technology (NExT) DNA shuffling: a robust method for DNA fragmentation and directed evolution. Nucleic Acids Res. Aug. 1, 2005;33(13):e117. doi: 10.1093/nar/gni116. PMID: 16061932; PMCID: PMC1182171.
Mumtsidu et al., Structural features of the single-stranded DNA-binding protein of Epstein-Barr virus. J Struct Biol. Feb. 2008;161(2):172-87. doi: 10.1016/j.jsb.2007.10.014. Epub Nov. 1, 2007.
Muzyczka et al., Adeno-associated virus (AAV) vectors: will they work? J Clin Invest. Oct. 1994;94(4):1351. doi: 10.1172/JCI117468.
Myerowiiz et al., The major defect in Ashkenazi Jews with Tay-Sachs disease is an insertion in the gene for the alpha-chain of beta-hexosaminidase. J Biol Chem. Dec. 15, 1988;263(35):18587-9.
Myers et al., Insulin signal transduction and the IRS proteins. Annu Rev Pharmacol Toxicol. 1996;36:615-58. doi: 10.1146/annurev.pa.36.040196.003151.
Nabel et al., Direct gene transfer for immunotherapy and immunization. Trends Biotechnol. May 1993;11(5):211-5. doi: 10.1016/0167-7799(93)90117-R.
Nahar et al., A G-quadruplex motif at the 3′ end of sgRNAs improves CRISPR-Cas9 based genome editing efficiency. Chem Commun (Camb). Mar. 7, 2018;54(19):2377-2380. doi: 10.1039/c7cc08893k. Epub Feb. 16, 2018.
Nakade et al., Microhomology-mediated end-joining-dependent integration of donor DNA in cells and animals using TALENs and CRISPR/Cas9. Nat Commun. Nov. 20, 2014;5:5560. doi: 10.1038/ncomms6560.
Nakamura et al., Codon usage tabulated from international DNA sequence databases: status for the year 2000. Nucleic Acids Res. Jan. 1, 2000;28(1):292. doi: 10.1093/nar/28.1.292.
Naorem et al., DGR mutagenic transposition occurs via hypermutagenic reverse transcription primed by nicked template RNA. Proc Natl Acad Sci USA. Nov. 21, 2017;114(47):E10187-E10195. doi: 10.1073/pnas.l715952114. Epub Nov. 6, 2017.
Nern et al., Multiple new site-specific recombinases for use in manipulating animal genomes. Proc Natl Acad Sci U S A. Aug. 23, 2011; 108(34): 14198-203. doi: 10.1073/pnas.1111704108. Epub Aug. 9, 2011.
Newby et al., Base editing of haematopoietic stem cells rescues sickle cell disease in mice. Nature. Jun. 2, 2021. doi: 10.1038/s41586-021-03609-w. Epub ahead of print.
Nguyen et al., Evolutionary drivers of thermoadaptation in enzyme catalysis. Science. Jan. 20, 2017;355(6322):289-294. doi: 10.1126/science.aah3717. Epub Dec. 22, 2016.
Nguyen et al., IQ-TREE: a fast and effective stochastic algorithm for estimating maximum-likelihood phylogenies. Mol Biol Evol. Jan. 2015;32(1):268-74. doi: 10.1093/molbev/msu300. Epub Nov. 3, 2014.
Nishimasu et al., Engineered CRISPR-Cas9 nuclease with expanded targeting space. Science. Sep. 21, 2018;361(6408):1259-1262. doi: 10.1126/science.aas9129. Epub Aug. 30, 2018.
Nottingham et al., RNA-seq of human reference RNA samples using a thermostable group II intron reverse transcriptase. RNA. Apr. 2016;22(4):597-613. doi: 10.1261/ma.055558.115. Epub Jan. 29, 2016.
Nowak et al., Characterization of single-stranded DNA-binding proteins from the psychrophilic bacteria Desulfotalea psychrophila, Flavobacterium psychrophilum, Psychrobacter arcticus, Psychrobacter cryohalolentis, Psychromonas ingrahamii, Psychroflexus torquis, and Photobacterium profundum. BMC Microbiol. Apr. 14, 2014;14:91. doi: 10.1186/1471-2180-14-91.
Nowak et al., Guide RNA Engineering for Versatile Cas9 Functionality. Nucleic Acids Res. Nov. 16, 2016;44(20):9555-9564. doi: 10.1093/nar/gkw908. Epub Oct. 12, 2016.
Nowak et al., Structural analysis of monomeric retroviral reverse transcriptase in complex with an RNA/DNA hybrid. Nucleic Acids Res. Apr. 1, 2013;41(6):3874-87. doi: 10.1093/nar/gkt053. Epub Feb. 4, 2013.
Numrych et al., A comparison of the effects of single-base and triple-base changes in the integrase arm-type binding sites on the site-specific recombination of bacteriophage lambda. Nucleic Acids Res. Jul. 11, 1990;18(13):3953-9. doi: 10.1093/nar/18.13.3953.
Nyerges et al., A highly precise and portable genome engineering method allows comparison of mutational effects across bacterial species. Proc Natl Acad Sci USA. Mar. 1, 2016;113(9):2502-7. doi: 10.1073/pnas.l520040113. Epub Feb. 16, 2016.
Oakes et al., CRISPR-Cas9 Circular Permutants as Programmable Scaffolds for Genome Modification. Cell. Jan. 10, 2019; 176(1-2):254-267.e16. doi: 10.1016/j.cell.2018.11.052.
Oakes et al., Profiling of engineering hotspots identifies an allosteric CRISPR-Cas9 switch. Nat Biotechnol. Jun. 2016;34(6):646-51. doi: 10.1038/nbt.3528. Epub May 2, 2016.
Odsbu et al., Specific N-terminal interactions of the Escherichia coli SeqA protein are required to form multimers that restrain negative supercoils and form foci. Genes Cells. Nov. 2005; 10(11): 1039-49.
Oeemig et al., Solution structure of DnaE intein from Nostoc punctiforme: structural basis for the design of a new split intein suitable for site-specific chemical modification. FEBS Lett. May 6, 2009;583(9):1451-6.
Oh et al., Positional cloning of a gene for Hermansky-Pudlak syndrome, a disorder of cytoplasmic organelles. Nat Genet. Nov. 1996;14(3):300-6. doi: 10.1038/ng1196-300.
Ohe et al., Purification and properties of xanthine dehydrogenase from Streptomyces cyanogenus. J Biochem. Jul. 1979;86(1):45-53.
Olivares et al., Site-specific genomic integration produces therapeutic Factor IX levels in mice. Nat Biotechnol. Nov. 2002;20(11):1124-8. doi: 10.1038/nbt753. Epub Oct. 15, 2002.
Olorunniji et al., Purification and In Vitro Characterization of Zinc Finger Recombinases. Methods Mol Biol. 2017;1642:229-245. doi: 10.1007/978-1-4939-7169-5_15.
Olorunniji et al., Site-specific recombinases: molecular machines for the Genetic Revolution. Biochem J. Mar. 15, 2016;473(6):673-84. doi: 10.1042/BJ20151112.
O'Maille et al., Structure-based combinatorial protein engineering (SCOPE). J Mol Biol. Aug. 23, 2002;321(4):677-91.
Orlando et al., Zinc-finger nuclease-driven targeted integration into mammalian genomes using donors with limited chromosomal homology. Nucleic Acids Res. Aug. 2010;38(15):e152. doi: 10.1093/nar/gkq512. Epub Jun. 8, 2010.
Orthwein et al., A mechanism for the suppression of homologous recombination in G1 cells. Nature. Dec. 17, 2015;528(7582):422-6. doi: 10.1038/nature16142. Epub Dec. 9, 2015.
Ortiz-Urda et al., Stable nonviral genetic correction of inherited human skin disease. Nat Med. Oct. 2002;8(10):1166-70. doi: 10.1038/nm766. Epub Sep. 16, 2002. Erratum in: Nat Med. Feb. 2003;9(2):237.
Osborn et al., Base Editor Correction of col. 7A1 in Recessive Dystrophic Epidermolysis Bullosa Patient-Derived Fibroblasts and iPSCs. J Invest Dermatol. Feb. 2020;140(2):338-347.e5. doi: 10.1016/j.jid.2019.07.701. Epub Aug. 19, 2019.
Ostermeier et al., A combinatorial approach to hybrid enzymes independent of DNA homology. Nat Biotechnol. Dec. 1999;17(12):1205-9.
Ostertag et al., Biology of mammalian L1 retrotransposons. Annu Rev Genet. 2001;35:501-38. doi: 10.1146/annurev.genet.35.102401.091032.
Otomo et al., Improved segmental isotope labeling of proteins and application to a larger protein. J Biomol NMR. Jun. 1999;14(2):105-14. doi: 10.1023/a:1008308128050.
Otomo et al., NMR observation of selected segments in a larger protein: central-segment isotope labeling through intein-mediated ligation. Biochemistry. Dec. 7, 1999;38(49):16040-4. doi: 10.1021/bi991902j.
Otto et al., The probability of fixation in populations of changing size. Genetics. Jun. 1997;146(2):723-33.
Packer et al., Methods for the directed evolution of proteins. Nat Rev Genet. Jul. 2015;16(7):379-94. doi: 10.1038/nrg3927. Epub Jun. 9, 2015.
Packer et al., Phage-assisted continuous evolution of proteases with altered substrate specificity. Nat Commun. Oct. 16, 2017;8(1):956. doi: 10.1038/s41467-017-01055-9.
Paige et al., RNA mimics of green fluorescent protein. Science. Jul. 29, 2011;333(6042):642-6. doi: 10.1126/science.1207339.
Paiva et al., Targeted protein degradation: elements of PROTAC design. Curr Opin Chem Biol. Jun. 2019;50:111-119. doi: 10.1016/j.cbpa.2019.02.022. Epub Apr. 17, 2019.
Paquet et al., Efficient introduction of specific homozygous and heterozygous mutations using CRISPR/Cas9. Nature. May 5, 2016;533(7601): 125-9. doi: 10.1038/nature17664. Epub Apr. 27, 2016.
Park et al., Digenome-seq web tool for profiling CRISPR specificity. Nat Methods. May 30, 2017;14(6):548-549. doi: 10.1038/nmeth.4262.
Park et al., Highly efficient editing of the ?-globin gene in patient-derived hematopoietic stem and progenitor cells to treat sickle cell disease. Nucleic Acids Res. Sep. 5, 2019;47(15):7955-7972. doi: 10.1093/nar/gkz475.
Park et al., Sendai virus, an RNA virus with no risk of genomic integration, delivers CRISPR/Cas9 for efficient gene editing. Mol Ther Methods Clin Dev. Aug. 24, 2016;3:16057. doi: 10.1038/mtm.2016.57.
Patel et al., Flap endonucleases pass 5′-flaps through a flexible arch using a disorder-thread-order mechanism to confer specificity for free 5′-ends. Nucleic Acids Res. May 2012;40(10):4507-19. doi: 10.1093/nar/gks051. Epub Feb. 8, 2012.
Pawson et al., Protein phosphorylation in signaling—50 years and counting. Trends Biochem Sci. Jun. 2005;30(6):286-90. doi: 10.1016/j.tibs.2005.04.013.
Pellenz et al., New human chromosomal safe harbor sites for genome engineering with CRISPR/Cas9, TAL effector and homing endonucleases. Aug. 20, 2018. bioRxiv doi: https://doi.org/10.1101/396390.
Perach et al., Catalytic features of the recombinant reverse transcriptase of bovine leukemia virus expressed in bacteria. Virology. Jun. 20, 1999;259(1):176-89. doi: 10.1006/viro.1999.9761.
Perler et al., Protein splicing and autoproteolysis mechanisms. Curr Opin Chem Biol. Oct. 1997;1(3):292-9. doi: 10.1016/s1367-5931(97)80065-8.
Perler et al., Protein splicing elements: inteins and exteins—a definition of terms and recommended nomenclature. Nucleic Acids Res. Apr. 11, 1994;22(7):1125-7. doi: 10.1093/nar/22.7.1125.
Perler, InBase, the New England Biolabs Intein Database. Nucleic Acids Res. Jan. 1, 1999;27(1):346-7. doi: 10.1093/nar/27.1.346.
Perler, Protein splicing of inteins and hedgehog autoproteolysis: structure, function, and evolution. Cell. Jan. 9, 1998;92(1):1-4. doi: 10.1016/s0092-8674(00)80892-2.
Petersen-Mahrt et al., AID mutates E. coli suggesting a DNA deamination mechanism for antibody diversification. Nature. Jul. 4, 2002;418(6893):99-103.
Peyrottes et al., Oligodeoxynucleoside phosphoramidates (P-NH2): synthesis and thermal stability of duplexes with DNA and RNA targets. Nucleic Acids Res. May 15, 1996;24(10):1841-8.
Pfeiffer et al., Mechanisms of DNA double-strand break repair and their potential to induce chromosomal aberrations. Mutagenesis. Jul. 2000;15(4):289-302. doi: 10.1093/mutage/15.4.289.
Pickart et al., Ubiquitin: structures, functions, mechanisms. Biochim Biophys Acta. Nov. 29, 2004;1695(1-3):55-72. doi: 10.1016/j.bbamcr.2004.09.019.
Pinkert et al., An albumin enhancer located 10 kb upstream functions along with its promoter to direct efficient, liver-specific expression in transgenic mice. Genes Dev. May 1987;1(3):268-76. doi: 10.1101/gad.1.3.268.
Pirakitikulr et al., PCRless library mutagenesis via oligonucleotide recombination in yeast. Protein Sci. Dec. 2010;19(12):2336-46. doi: 10.1002/pro.513.
Popp et al., Sortagging: a versatile method for protein labeling. Nat Chem Biol. Nov. 2007;3(11):707-8. doi: 10.1038/nchembio.2007.31. Epub Sep. 23, 2007.
Posnick et al., Imbalanced base excision repair increases spontaneous mutation and alkylation sensitivity in Escherichia coli. J Bacteriol. Nov. 1999;181(21):6763-71.
Pospísilová et al., Hydrolytic cleavage of N6-substituted adenine derivatives by eukaryotic adenine and adenosine deaminases. Biosci Rep. 2008;28(6):335-347. doi:10.1042/BSR20080081.
Prasad et al., Rev1 is a base excision repair enzyme with 5′-deoxyribose phosphate lyase activity. Nucleic Acids Res. Dec. 15, 2016;44(22): 10824-10833. doi: 10.1093/nar/gkw869. Epub Sep. 28, 2016.
Pruschy et al., Mechanistic studies of a signaling pathway activated by the organic dimerizer FK1012. Chem Biol. Nov. 1994;1(3):163-72. doi: 10.1016/1074-5521(94)90006-x.
Pu et al., Evolution of a split RNA polymerase as a versatile biosensor platform. Nat Chem Biol. Apr. 2017;13(4):432-438. doi: 10.1038/nchembio.2299. Epub Feb. 13, 2017.
Qu et al., Global mapping of binding sites for phic31 integrase in transgenic maden-darby bovine kidney cells using ChIP-seq. Hereditas. Jan. 14, 2019;156:3. doi: 10.1186/s41065-018-0079-z.
Queen et al., Immunoglobulin gene transcription is activated by downstream sequence elements. Cell. Jul. 1983;33(3):741-8. doi: 10.1016/0092-8674(83)90016-8.
Radany et al., Increased spontaneous mutation frequency in human cells expressing the phage PBS2-encoded inhibitor of uracil-DNA glycosylase. Mutat Res. Sep. 15, 2000;461(1):41-58. doi: 10.1016/s0921-8777(00)00040-9.
Raina et al., PROTAC-induced BET protein degradation as a therapy for castration-resistant prostate cancer. Proc Natl Acad Sci USA. Jun. 28, 2016;113(26):7124-9. doi: 10.1073/pnas.1521738113. Epub Jun. 6, 2016.
Ramamurthy et al., Identification of immunogenic B-cell epitope peptides of rubella virus E1 glycoprotein towards development of highly specific immunoassays and/or vaccine. Conference Abstract. 2019.
Ranzau et al., Genome, Epigenome, and Transcriptome Editing via Chemical Modification of Nucleobases in Living Cells. Biochemistry. Feb. 5, 2019;58(5):330-335. doi: 10.1021/acs.biochem.8b00958. Epub Dec. 12, 2018.
Rashel et al., A novel site-specific recombination system derived from bacteriophage phiMR11. Biochem Biophys Res Commun. Apr. 4, 2008;368(2): 192-8. doi: 10.1016/j.bbrc.2008.01.045. Epub Jan. 22, 2008.
Rasila et al., Critical evaluation of random mutagenesis by error-prone polymerase chain reaction protocols, Escherichia coli mutator strain, and hydroxylamine treatment. Anal Biochem. May 1, 2009;388(1):71-80. doi: 10.1016/j.ab.2009.02.008. Epub Feb. 10, 2009.
Raskin et al., Substitution of a single bacteriophage T3 residue in bacteriophage T7 RNA polymerase at position 748 results in a switch in promoter specificity. J Mol Biol. Nov. 20, 1992;228(2):506-15.
Raskin et al., T7 RNA polymerase mutants with altered promoter specificities. Proc Natl Acad Sci U S A. Apr. 15, 1993;90(8):3147-51.
Rauch et al., Programmable RNA Binding Proteins for Imaging and Therapeutics. Biochemistry. Jan. 30, 2018;57(4):363-364. doi: 10.1021/acs.biochem.7b01101. Epub Nov. 17, 2017.
Ray et al., A compendium of RNA-binding motifs for decoding gene regulation. Nature. Jul. 11, 2013;499(7457): 172-7. doi: 10.1038/nature12311.
Rebar et al., Phage display methods for selecting zinc finger proteins with novel DNA-binding specificities. Methods Enzymol. 1996;267:129-49.
Rees et al., Analysis and minimization of cellular RNA editing by DNA adenine base editors. Sci Adv. May 8, 2019;5(5):eaax5717. doi: 10.1126/sciadv.aax5717.
Rees et al., Base editing: precision chemistry on the genome and transcriptome of living cells. Nat Rev Genet. Dec. 2018;19(12):770-788. doi: 10.1038/s41576-018-0059-1.
Rees et al., Development of hRad51-Cas9 nickase fusions that mediate HDR without double-stranded breaks. Nat Commun. May 17, 2019;10(1):2212. doi: 10.1038/s41467-019-09983-4.
Remy et al., Gene transfer with a series of lipophilic DNA-binding molecules. Bioconjug Chem. Nov.-Dec. 1994;5(6):647-54. doi: 10.1021/bc00030a021.
Ribeiro et al., Protein Engineering Strategies to Expand CRISPR-Cas9 Applications. Int J Genomics. Aug. 2, 2018;2018:1652567. doi: 10.1155/2018/1652567.
Ringrose et al., The Kw recombinase, an integrase from Kluyveromyces waltii. Eur J Biochem. Sep. 15, 1997;248(3):903-12. doi: 10.1111/j.1432-1033.1997.00903.x.
Risso et al., Hyperstability and substrate promiscuity in laboratory resurrections of Precambrian ?-lactamases. J Am Chem Soc. Feb. 27, 2013;135(8):2899-902. doi: 10.1021/ja311630a. Epub Feb. 14, 2013.
Ritchie et al., limma powers differential expression analyses for RNA-sequencing and microarray studies. Nucleic Acids Res. Apr. 20, 2015;43(7):e47. doi: 10.1093/nar/gkv007. Epub Jan. 20, 2015.
Robertson et al.,DNA repair in mammalian cells: Base excision repair: the long and short of it. Cell Mol Life Sci. Mar. 2009;66(6):981-93. doi: 10.1007/s00018-009-8736-z.
Robinson et al., The protein tyrosine kinase family of the human genome. Oncogene. Nov. 20, 2000;19(49):5548-57. doi: 10.1038/sj.onc. 1203957.
Rogozin et al., Evolution and diversification of lamprey antigen receptors: evidence for involvement of an AID-APOBEC family cytosine deaminase. Nat Immunol. Jun. 2007;8(6):647-56. doi: 10.1038/ni1463. Epub Apr. 29, 2007.
Roth et al., A widespread self-cleaving ribozyme class is revealed by bioinformatics. Nat Chem Biol. Jan. 2014;10(1):56-60. doi: 10.1038/nchembio.1386. Epub Nov. 17, 2013.
Roth et al., Purification and characterization of murine retroviral reverse transcriptase expressed in Escherichia coli. J Biol Chem. Aug. 5, 1985;260(16):9326-35.
Rouet et al., Expression of a site-specific endonuclease stimulates homologous recombination in mammalian cells. Proc Natl Acad Sci U S A. Jun. 21, 1994;91(13):6064-8. doi: 10.1073/pnas.91.13.6064.
Rouet et al., Introduction of double-strand breaks into the genome of mouse cells by expression of a rare-cutting endonuclease. Mol Cell Biol. Dec. 1994;14(12):8096-106. doi: 10.1128/mcb.14.12.8096.
Rouet et al., Receptor-Mediated Delivery of CRISPR-Cas9 Endonuclease for Cell-Type-Specific Gene Editing. J Am Chem Soc. May 30, 2018;140(21):6596-6603. doi: 10.1021/jacs.8b01551. Epub May 18, 2018.
Roundtree et al.,YTHDC1 mediates nuclear export of N6-methyladenosine methylated mRNAs. Elife. Oct. 6, 2017;6:e31311. doi: 10.7554/eLife.31311.
Rowland et al., Sin recombinase from Staphylococcus aureus: synaptic complex architecture and transposon targeting. Mol Microbiol. May 2002;44(3):607-19. doi: 10.1046/j.1365-2958.2002.02897.x.
Rowley, Chromosome translocations: dangerous liaisons revisited. Nat Rev Cancer. Dec. 2001;1(3):245-50. doi: 10.1038/35106108.
Rubio et al., An adenosine-to-inosine tRNA-editing enzyme that can perform C-to-U deamination of DNA. Proc Natl Acad Sci USA. May 8, 2007;104(19):7821-6. doi: 10.1073/pnas.0702394104. Epub May 1, 2007. PMID: 17483465; PMCID: PMC1876531.
Rubio et al., Transfer RNA travels from the cytoplasm to organelles. Wiley Interdiscip Rev RNA. Nov.-Dec. 2011;2(6):802-17. doi: 10.1002/wrna.93. Epub Jul. 11, 2011.
Rufer et al., Non-contact positions impose site selectivity on Cre recombinase. Nucleic Acids Res. Jul. 1, 2002;30(13):2764-71. doi: 10.1093/nar/gkf399.
Rutherford et al., Attachment site recognition and regulation of directionality by the serine integrases. Nucleic Acids Res. Sep. 2013;41(17):8341-56. doi: 10.1093/nar/gkt580. Epub Jul. 2, 2013.
Ryu et al., Adenine base editing in mouse embryos and an adult mouse model of Duchenne muscular dystrophy. Nat Biotechnol. Jul. 2018;36(6):536-539. doi: 10.1038/nbt.4148. Epub Apr. 27, 2018.
Sadowski, The Flp recombinase of the 2-microns plasmid of Saccharomyces cerevisiae. Prog Nucleic Acid Res Mol Biol. 1995;51:53-91.
Sakuma et al., MMEJ-assisted gene knock-in using TALENs and CRISPR-Cas9 with the PITCh systems. Nat Protoc. Jan. 2016;11(1):1 18-33. doi: 10.1038/nprot.2015.140. Epub Dec. 17, 2015.
Sale et al., Y-family DNA polymerases and their role in tolerance of cellular DNA damage. Nat Rev Mol Cell Biol. Feb. 23, 2012; 13(3):141-52. doi: 10.1038/nrm3289.
Samulski et al., Helper-free stocks of recombinant adeno-associated viruses: normal integration does not require viral gene expression. J Virol. Sep. 1989;63(9):3822-8. doi: 10.1128/JVI.63.9.3822-3828.1989.
Sang et al., A unique uracil-DNA binding protein of the uracil DNA glycosylase superfamily. Nucleic Acids Res. Sep. 30, 2015;43(17):8452-63. doi: 10.1093/nar/gkv854. Epub Aug. 24, 2015.
Santoro et al., Directed evolution of the site specificity of Cre recombinase. Proc Natl Acad Sci U S A. Apr. 2, 2002;99(7):4185-90. Epub Mar. 19, 2002.
Saparbaev et al., Excision of hypoxanthine from DNA containing dIMP residues by the Escherichia coli, yeast, rat, and human alkylpurine DNA glycosylases. Proc Natl Acad Sci U S A. Jun. 21, 1994;91(13):5873-7. doi: 10.1073/pnas.91.13.5873.
Sarkar et al., HIV-1 proviral DNA excision using an evolved recombinase. Science. Jun. 29, 2007;316(5833):1912-5. doi: 10.1126/science. 1141453.
Sasidharan et al., The selection of acceptable protein mutations. PNAS; Jun. 12, 2007; 104(24):10080-5. www.pnas.org/cgi/doi/10.1073.pnas.0703737104.
Satomura et al., Precise genome-wide base editing by the CRISPR Nickase system in yeast. Sci Rep. May 18, 2017;7(1):2095. doi: 10.1038/s41598-017-02013-7.
Sauer et al., DNA recombination with a heterospecific Cre homolog identified from comparison of the pac-c1 regions of P1-related phages. Nucleic Acids Res. Nov. 18, 2004;32(20):6086-95. doi: 10.1093/nar/gkh941.
Savic et al., Covalent linkage of the DNA repair template to the CRISPR-Cas9 nuclease enhances homology-directed repair. Elife. May 29, 2018;7:e33761. doi: 10.7554/eLife.33761.
Saville et al., A site-specific self-cleavage reaction performed by a novel RNA in Neurospora mitochondria. Cell. May 18, 1990;61(4):685-96. doi: 10.1016/0092-8674(90)90480-3.
Savva et al., The structural basis of specific base-excision repair by uracil-DNA glycosylase. Nature. Feb. 9, 1995;373(6514):487-93. doi: 10.1038/373487a0.
Schaaper et al., Base selection, proofreading, and mismatch repair during DNA replication in Escherichia coli. J Biol Chem. Nov. 15, 1993;268(32):23762-5.
Schaaper et al., Spectra of spontaneous mutations in Escherichia coli strains defective in mismatch correction: the nature of in vivo DNA replication errors. Proc Natl Acad Sci U S A. Sep. 1987;84(17):6220-4.
Schaefer et al., Understanding RNA modifications: the promises and technological bottlenecks of the ‘epitranscriptome’. Open Biol. May 2017;7(5): 170077. doi: 10.1098/rsob. 170077.
chechner et al., Multiplexable, locus-specific targeting of long RNAs with CRISPR-Display. Nat Methods. Jul. 2015;12(7):664-70. doi: 10.1038/nmeth.3433. Epub Jun. 1, 2015. Author manuscript entitled CRISPR Display: A modular method for locus-specific targeting of long noncoding RNAs and synthetic RNA devices in vivo.
Schek et al., Definition of the upstream efficiency element of the simian virus 40 late polyadenylation signal by using in vitro analyses. Mol Cell Biol. Dec. 1992;12(12):5386-93. doi: 10.1128/mcb.12.12.5386.
Schenk et al., MPDU1 mutations underlie a novel human congenital disorder of glycosylation, designated type If. J Clin Invest. Dec. 2001;108(11):1687-95. doi: 10.1172/JCI13419.
Schmitz et al., Behavioral abnormalities in prion protein knockout mice and the potential relevance of PrP(C) for the cytoskeleton. Prion. 2014;8(6):381-6. doi: 10.4161/19336896.2014.983746.
Scholler et al., Interactions, localization, and phosphorylation of the m6A generating METTL3-METTL14-WTAP complex. RNA. Apr. 2018;24(4):499-512. doi: 10.1261/ma.064063.117. Epub Jan. 18, 2018.
Schultz et al., Expression and secretion in yeast of a 400-kDa envelope glycoprotein derived from Epstein-Barr virus. Gene. 1987;54(1):113-23. doi: 10.1016/0378-1119(87)90353-2.
Schultz et al., Oligo-2′-fluoro-2′-deoxynucleotide N3′→P5′ phosphoramidates: synthesis and properties. Nucleic Acids Res. Aug. 1, 1996;24(15):2966-73.
Scott et al., Production of cyclic peptides and proteins in vivo. Proc Natl Acad Sci U S A. Nov. 23, 1999;96(24):13638-43. doi: 10.1073/pnas.96.24.13638.
Sebastían-Martín et al., Transcriptional inaccuracy threshold attenuates differences in RNA-dependent DNA synthesis fidelity between retroviral reverse transcriptases. Sci Rep. Jan. 12, 2018;8(1):627. doi: 10.1038/s41598-017-18974-8.
Seed, An LFA-3 cDNA encodes a phospholipid-linked membrane protein homologous to its receptor CD2. Nature. Oct. 29-Nov. 4, 1987;329(6142):840-2. doi: 10.1038/329840a0.
Serrano-Heras et al., Protein p56 from the Bacillus subtilis phage phi29 inhibits DNA-binding ability of uracil-DNA glycosylase. Nucleic Acids Res. 2007;35(16):5393-401. Epub Aug. 13, 2007.
Setten et al., The current state and future directions of RNAi-based therapeutics. Nat Rev Drug Discov. Jun. 2019;18(6):421-446. doi: 10.1038/s41573-019-0017-4.
Severinov et al., Expressed protein ligation, a novel method for studying protein-protein interactions in transcription. J Biol Chem. Jun. 26, 1998;273(26):16205-9. doi: 10.1074/jbc.273.26.16205.
Sha et al., Monobodies and other synthetic binding proteins for expanding protein science. Protein Sci. May 2017;26(5):910-924. doi: 10.1002/pro.3148. Epub Mar. 24, 2017.
Shah et al., Protospacer recognition motifs: mixed identities and functional diversity. RNA Biol. May 2013;10(5):891-9. doi: 10.4161/rna.23764. Epub Feb. 12, 2013.
Shalem et al., High-throughput functional genomics using CRISPR-Cas9. Nat Rev Genet. May 2015;16(5):299-311. doi: 10.1038/nrg3899. Epub Apr. 9, 2015.
Sharer et al., The ARF-like 2 (ARL2)-binding protein, BART. Purification, cloning, and initial characterization. J Biol Chem. Sep. 24, 1999;274(39):27553-61. doi: 10.1074/jbc.274.39.27553.
Sharon et al., Functional Genetic Variants Revealed by Massively Parallel Precise Genome Editing. Cell. Oct. 4, 2018;175(2):544-557.e16. doi: 10.1016/j.cell.2018.08.057. Epub Sep. 20, 2018.
Shaw et al., Implications of human genome architecture for rearrangement-based disorders: the genomic basis of disease. Hum Mol Genet. Apr. 1, 2004;13 Spec No. 1:R57-64. doi: 10.1093/hmg/ddh073. Epub Feb. 5, 2004.
Shen et al., Predictable and precise template-free CRISPR editing of pathogenic variants. Nature. Nov. 2018;563(7733):646-651. doi: 10.1038/s41586-018-0686-x. Epub Nov. 7, 2018.
Shen, Data processing, Modeling and Analysis scripts for CRISPR-inDelphi. GitHub—maxwshen/indelphi-dataprocessinganalysis at 6b68e3cec73c9358fef6e5f178a935f3c2a4118f. Apr. 10, 2018. Retrieved online via https://github.com/maxwshen/indelphi-sataprocessinganalysis/tree/6b68e3cec73c9358fef6e5f178a935f3c2a4118f Last retrieved on Jul. 26, 2021. 2 pages.
Sherwood et al., Discovery of directional and nondirectional pioneer transcription factors by modeling DNase profile magnitude and shape. Nat Biotechnol. Feb. 2014;32(2):171-178. doi: 10.1038/nbt.2798. Epub Jan. 19, 2014.
Shi et al., Structural basis for targeted DNA cytosine deamination and mutagenesis by APOBEC3A and APOBEC3B. Nat Struct Mol Biol. Feb. 2017;24(2):131-139. doi: 10.1038/nsmb.3344. Epub Dec. 19, 2016.
Shi et al., YTHDF3 facilitates translation and decay of N6-methyladenosine-modified RNA. Cell Res. Mar. 2017;27(3):315-328. doi: 10.1038/cr.2017.15. Epub Jan. 20, 2017.
Shin et al., CRISPR/Cas9 targeting events cause complex deletions and insertions at 17 sites in the mouse genome. Nat Commun. May 31, 2017;8:15464. doi: 10.1038/ncomms15464.
Shindo et al., A Comparison of Two Single-Stranded DNA Binding Models by Mutational Analysis of APOBEC3G. Biology (Basel). Aug. 2, 2012;1(2):260-76. doi: 10.3390/biology1020260.
Shingledecker et al., Molecular dissection of the Mycobacterium tuberculosis RecA intein: design of a minimal intein and of a trans-splicing system involving two intein fragments. Gene. Jan. 30, 1998;207(2):187-95. doi: 10.1016/s0378-1119(97)00624-0.
Shmakov et al., Diversity and evolution of class 2 CRISPR-Cas systems. Nat Rev Microbiol. Mar. 2017;15(3):169-182. doi: 10.1038/nrmicro.2016.184. Epub Jan. 23, 2017.
Shultz et al., A genome-wide analysis of FRT-like sequences in the human genome. PLoS One. Mar. 23, 2011;6(3):e18077. doi: 10.1371/journal.pone.0018077.
Silas et al., Direct CRISPR spacer acquisition from RNA by a natural reverse transcriptase-Cas1 fusion protein. Science. Feb. 26, 2016;351(6276):aad4234. doi: 10.1126/science.aad4234.
Silva et al., Selective disruption of the DNA polymerase III α-β complex by the umuD gene products. Nucleic Acids Res. Jul. 2012;40(12):5511-22. doi: 10.1093/nar/gks229. Epub Mar. 9, 2012.
Singh et al., Cross-talk between diverse serine integrases. J Mol Biol. Jan. 23, 2014;426(2):318-31. doi: 10.1016/j.jmb.2013.10.013. Epub Oct. 22, 2013.
Singh et al., Real-time observation of DNA recognition and rejection by the RNA-guided endonuclease Cas9. Nat Commun. Sep. 14, 2016;7:12778. doi: 10.1038/ncomms12778.
Sivalingam et al., Biosafety assessment of site-directed transgene integration in human umbilical cord-lining cells. Mol Ther. Jul. 2010;18(7):1346-56. doi: 10.1038/mt.2010.61. Epub Apr. 27, 2010.
Sledz et al., Structural insights into the molecular mechanism of the m(6)A writer complex. Elife. Sep. 14, 2016;5:e18434. doi: 10.7554/eLife.18434.
Slupphaug et al., A nucleotide-flipping mechanism from the structure of human uracil-DNA glycosylase bound to DNA. Nature. Nov. 7, 1996;384(6604):87-92. doi: 10.1038/384087a0.
Smargon et al., Cas13b Is a Type VI-B CRISPR-Associated RNA-Guided RNase Differentially Regulated by Accessory Proteins Csx27 and Csx28. Mol Cell. Feb. 16, 2017;65(4):618-630.e7. doi: 10.1016/j.molce1.2016.12.023. Epub Jan. 5, 2017.
Smith et al., Production of human beta interferon in insect cells infected with a baculovirus expression vector. Mol Cell Biol. Dec. 1983;3(12):2156-65. doi: 10.1128/mcb.3.12.2156.
Smith et al., Single-step purification of polypeptides expressed in Escherichia coli as fusions with glutathione S-transferase. Gene. Jul. 15, 1988;67(1):31-40. doi: 10.1016/0378-1119(88)90005-4.
Smith, Phage-encoded Serine Integrases and Other Large Serine Recombinases. Microbiol Spectr. Aug. 2015;3(4). doi: 10.1128/microbiolspec.MDNA3-0059-2014.
Sommerfelt et al., Receptor interference groups of 20 retroviruses plating on human cells. Virology. May 1990;176(1):58-69. doi: 10.1016/0042-6822(90)90230-o.
Song et al., Adenine base editing in an adult mouse model of tyrosinaemia. Nat Biomed Eng. Jan. 2020;4(1):125-130. doi: 10.1038/s41551-019-0357-8. Epub Feb. 25, 2019.
Southworth et al., Control of protein splicing by intein fragment reassembly. EMBO J. Feb. 16, 1998;17(4):918-26. doi: 10.1093/emboj/17.4.918.
Southworth et al., Purification of proteins fused to either the amino or carboxy terminus of the Mycobacterium xenopi gyrase A intein. Biotechniques. Jul. 1999;27(1):110-4, 116, 118-20. doi: 10.2144/99271st04.
Spencer et al., A general strategy for producing conditional alleles of Src-like tyrosine kinases. Proc Natl Acad Sci U S A. Oct. 10, 1995;92(21):9805-9. doi: 10.1073/pnas.92.21.9805.
Spencer et al., Controlling signal transduction with synthetic ligands. Science. Nov. 12, 1993;262(5136):1019-24. doi: 10.1126/science.7694365.
Spencer et al., Functional analysis of Fas signaling in vivo using synthetic inducers of dimerization. Curr Biol. Jul. 1, 1996;6(7):839-47. doi: 10.1016/s0960-9822(02)00607-3.
Srivastava et al., An inhibitor of nonhomologous end-joining abrogates double-strand break repair and impedes cancer progression. Cell. Dec. 21, 2012;151(7):1474-87. doi: 10.1016/j.cell.2012.11.054.
tadtman, Selenocysteine. Annu Rev Biochem. 1996;65:83-100.
Stamos et al., Structure of a Thermostable Group II Intron Reverse Transcriptase with Template-Primer and Its Functional and Evolutionary Implications. Mol Cell. Dec. 7, 2017;68(5):926-939.e4. doi: 10.1016/j.molcel.2017.10.024. Epub Nov. 16, 2017.
Steele et al., The prion protein knockout mouse: a phenotype under challenge. Prion. Apr. 2007-Jun;1(2):83-93. doi: 10.4161/pri.1.2.4346. Epub Apr. 25, 2007.
Stella et al., Structure of the Cpf1 endonuclease R-loop complex after target DNA cleavage. Nature. Jun. 22, 2017;546(7659):559-563. doi: 10.1038/nature22398. Epub May 31, 2017.
Stenson et al., The Human Gene Mutation Database: towards a comprehensive repository of inherited mutation data for medical research, genetic diagnosis and next-generation sequencing studies. Hum Genet. Jun. 2017;136(6):665-677. doi: 10.1007/s00439-017-1779-6. Epub Mar. 27, 2017.
Sternberg et al., Conformational control of DNA target cleavage by CRISPR-Cas9. Nature. Nov. 5, 2015;527(7576): 110-3. doi: 10.1038/nature15544. Epub Oct. 28, 2015.
Sterne-Weiler et al., Exon identity crisis: disease-causing mutations that disrupt the splicing code. Genome Biol. Jan. 23, 2014;15(1):201. doi: 10.1186/gb4150.
Stevens et al., A promiscuous split intein with expanded protein engineering applications. Proc Natl Acad Sci U S A. Aug. 8, 2017; 114(32):8538-8543. doi: 10.1073/pnas.1701083114. Epub Jul. 24, 2017.
Stockwell et al., Probing the role of homomeric and heteromeric receptor interactions in TGF-beta signaling using small molecule dimerizers. Curr Biol. Jun. 18, 1998;8(13):761-70. doi: 10.1016/s0960-9822(98)70299-4.
Strecker et al., RNA-guided DNA insertion with CRISPR-associated transposases. Science. Jul. 5, 2019;365(6448):48-53. doi: 10.1126/science.aax9181. Epub Jun. 6, 2019.
Strutt et al., RNA-dependent RNA targeting by CRISPR-Cas9. Elife. Jan. 5, 2018;7:e32724. doi: 10.7554/eLife.32724.
Su et al., Human DNA polymerase ? has reverse transcriptase activity in cellular environments. J Biol Chem. Apr. 12, 2019;294(15):6073-6081. doi: 10.1074/jbc.RA119.007925. Epub Mar. 6, 2019.
Sudarsan et al., Riboswitches in eubacteria sense the second messenger cyclic di-GMP. Science. Jul. 18, 2008;321(5887):411-3. doi: 10.1126/science.1159519.
Sun et al., The CRISPR/Cas9 system for gene editing and its potential application in pain research. Transl Periop & Pain Med. Aug. 3, 2016;l(3):22-33.
Surun et al., High Efficiency Gene Correction in Hematopoietic Cells by Donor-Template-Free CRISPR/Cas9 Genome Editing. Mol Ther Nucleic Acids. Mar. 2, 2018;10:-8. doi: 10.1016/j.omtn.2017.11.001. Epub Nov. 10, 2017.
Suzuki et al., In vivo genome editing via CRISPR/Cas9 mediated homology-independent targeted integration. Nature. Dec. 1, 2016;540(7631):144-149. doi: 10.1038/nature20565. Epub Nov. 16, 2016.
Suzuki et al., VCre/VloxP and SCre/SloxP: new site-specific recombination systems for genome engineering. Nucleic Acids Res. Apr. 2011;39(8):e49. doi: 10.1093/nar/gkql280. Epub Feb. 1, 2011.
Tabebordbar et al., In vivo gene editing in dystrophic mouse muscle and muscle stem cells. Science. Jan. 22, 2016;351(6271):407-411. doi: 10.1126/science.aad5177. Epub Dec. 31, 2015.
Tahara et al., Potent and Selective Inhibitors of 8-Oxoguanine DNA Glycosylase. J Am Chem Soc. Feb. 14, 2018;140(6):2105-2114. doi: 10.1021/jacs.7b09316. Epub Feb. 5, 2018.
Tajiri et al., Functional cooperation of MutT, MutM and MutY proteins in preventing mutations caused by spontaneous oxidation of guanine nucleotide in Escherichia coli. Mutat Res. May 1995;336(3):257-67. doi: 10.1016/0921-8777(94)00062-b.
Takimoto et al., Stereochemical basis for engineered; pyrrolysyl-tRNA synthetase and the efficient in vivo incorporation of; structurally divergent non-native amino acids. ACS Chem Biol. Jul. 2011; 15;6(7):733-43. doi: 10.1021/cb200057a. Epub May 5, 2011.
Tambunan et al., Vaccine Design for H5N1 Based on B- and T-cell Epitope Predictions. Bioinform Biol Insights. Apr. 28, 2016;10:27-35. doi: 10.4137/BBI.S38378.
Tanenbaum et al., A protein-tagging system for signal amplification in gene expression and fluorescence imaging. Cell. Oct. 23, 2014;159(3):635-46. doi: 10.1016/j.cell.2014.09.039. Epub Oct. 9, 2014.
Tanese et al., Expression of enzymatically active reverse transcriptase in Escherichia coli. Proc Natl Acad Sci U S A. Aug. 1985;82(15):4944-8. doi: 10.1073/pnas.82.15.4944.
Tang et al., Evaluation of Bioinformatic Programmes for the Analysis of Variants within Splice Site Consensus Regions. Adv Bioinformatics. 2016;2016:5614058. doi: 10.1155/2016/5614058. Epub May 24, 2016.
Tang et al., Rewritable multi-event analog recording in bacterial and mammalian cells. Science. Apr. 13, 2018;360(6385):eaap8992. doi: 10.1126/science.aap8992. Epub Feb. 15, 2018.
Tassabehji, Williams-Beuren syndrome: a challenge for genotype-phenotype correlations. Hum Mol Genet. Oct. 15, 2003;12 Spec No. 2:R229-37. doi: 10.1093/hmg/ddg299. Epub Sep. 2, 2003.
Taube et al., Reverse transcriptase of mouse mammary tumour virus: expression in bacteria, purification and biochemical characterization. Biochem J. Feb. 1, 1998;329 ( Pt 3)(Pt 3):579-87. doi: 10.1042/bj3290579. Erratum in: Biochem J Jun. 15, 1998;332(Pt 3):808.
Tee et al., Polishing the craft of genetic diversity creation in directed evolution. Biotechnol Adv. Dec. 2013;31(8):1707-21. doi: 10.1016/j.biotechadv.2013.08.021. Epub Sep. 6, 2013.
Telenti et al., The Mycobacterium xenopi GyrA protein splicing element: characterization of a minimal intein. J Bacteriol. Oct. 1997;179(20):6378-82. doi: 10.1128/jb.179.20.6378-6382.1997.
Telesnitsky et al., RNase H domain mutations affect the interaction between Moloney murine leukemia virus reverse transcriptase and its primer-template. Proc Natl Acad Sci U S A. Feb. 15, 1993;90(4): 1276-80. doi: 10.1073/pnas.90.4.1276.
Thomson et al., Mutational analysis of loxP sites for efficient Cre-mediated insertion into genomic DNA. Genesis. Jul. 2003;36(3): 162-7. doi: 10.1002/gene.10211.
Thuronyi et al., Continuous evolution of base editors with expanded target compatibility and improved activity. Nat Biotechnol. Sep. 2019;37(9): 1070-1079. doi: 10.1038/s41587-019-0193-0. Epub Jul. 22, 2019.
Thyagarajan et al., Creation of engineered human embryonic stem cell lines using phiC31 integrase. Stem Cells. Jan. 2008;26(1):119-26. doi: 10.1634/stemcells.2007-0283. Epub Oct. 25, 2007.
Tinland et al., The T-DNA-linked VirD2 protein contains two distinct functional nuclear localization signals. Proc Natl Acad Sci U S A. Aug. 15, 1992;89(16):7442-6. doi: 10.1073/pnas.89.16.7442.
Tom et al., Mechanism whereby proliferating cell nuclear antigen stimulates flap endonuclease 1. J Biol Chem. Apr. 7, 2000;275(14): 10498-505. doi: 10.1074/jbc.275.14.10498.
Tone et al., Single-stranded DNA binding protein Gp5 of Bacillus subtilis phage ?29 is required for viral DNA replication in growth-temperature dependent fashion. Biosci Biotechnol Biochem. 2012;76(12):2351-3. doi: 10.1271/bbb. 120587. Epub Dec. 7, 2012.
Toor et al., Crystal structure of a self-spliced group II intron. Science. Apr. 4, 2008;320(5872):77-82. doi: 10.1126/science.1153803.
Toro et al., On the Origin and Evolutionary Relationships of the Reverse Transcriptases Associated With Type III CRISPR-Cas Systems. Front Microbiol. Jun. 15, 2018;9:1317. doi: 10.3389/fmicb.2018.01317.
Toro et al., The Reverse Transcriptases Associated with CRISPR-Cas Systems. Sci Rep. Aug. 2, 2017;7(1):7089. doi: 10.1038/s41598-017-07828-y.
Torres et al., Non-integrative lentivirus drives high-frequency cre-mediated cassette exchange in human cells. PLoS One. 2011;6(5):e19794. doi: 10.1371/journal.pone.0019794. Epub May 23, 2011.
Townsend et al., Role of HFE in iron metabolism, hereditary haemochromatosis, anaemia of chronic disease, and secondary iron overload. Lancet. Mar. 2, 2002;359(9308):786-90. doi: 10.1016/S0140-6736(02)07885-6.
Tracewell et al., Directed enzyme evolution: climbing fitness peaks one amino acid at a time. Curr Opin Chem Biol. Feb. 2009;13(1):3-9. doi: 10.1016/j.cbpa.2009.01.017. Epub Feb. 25, 2009.
Tratschin et al., A human parvovirus, adeno-associated virus, as a eucaryotic vector: transient expression and encapsidation of the procaryotic gene for chloramphenicol acetyltransferase. Mol Cell Biol. Oct. 1984;4(10):2072-81. doi: 10.1128/mcb.4.10.2072.
Traxler et al., A genome-editing strategy to treat ?-hemoglobinopathies that recapitulates a mutation associated with a benign genetic condition. Nat Med. Sep. 2016;22(9):987-90. doi: 10.1038/nm.4170. Epub Aug. 15, 2016.
Trudeau et al., On the Potential Origins of the High Stability of Reconstructed Ancestral Proteins. Mol Biol Evol. Oct. 2016;33(10):2633-41. doi: 10.1093/molbev/msw138. Epub Jul. 12, 2016.
Tsai et al., CIRCLE-seq: a highly sensitive in vitro screen for genome-wide CRISPR-Cas9 nuclease off-targets. Nat Methods. Jun. 2017;14(6):607-614. doi: 10.1038/nmeth.4278. Epub May 1, 2017.
Tsang et al., Specialization of the DNA-cleaving activity of a group I ribozyme through in vitro evolution. J Mol Biol. Sep. 13, 1996;262(1):31-42. doi: 10.1006/jmbi. 1996.0496.
Tsutakawa et al., Human flap endonuclease structures, DNA double-base flipping, and a unified understanding of the FEN1 superfamily. Cell. Apr. 15, 2011; 145(2): 198-211. doi: 10.1016/j.cell.2011.03.004.
Tycko et al., Pairwise library screen systematically interrogates Staphylococcus aureus Cas9 specificity in human cells. bioRxiv. doi: https://doi.org/10.1101/269399 Posted Feb. 22, 2018.
Uniprot Consortium, UniProt: the universal protein knowledgebase. Nucleic Acids Res. Mar. 16, 2018;46(5):2699. doi: 10.1093/nar/gky092.
UNIPROTKB Submission; Accession No. F0NH53. May 3, 2011. 4 pages.
UNIPROTKB Submission; Accession No. F0NN87. May 3, 2011. 4 pages.
UNIPROTKB Submission; Accession No. T0D7A2. Oct. 16, 2013. 10 pages.
Urasaki et al., Functional dissection of the To12 transposable element identified the minimal cis-sequence and a highly repetitive sequence in the subterminal region essential for transposition. Genetics. Oct. 2006;174(2):639-49. doi: 10.1534/genetics. 106.060244. Epub Sep. 7, 2006.
Van Brunt et al., Genetically Encoded Azide Containing Amino Acid in Mammalian Cells Enables Site-Specific Antibody-Drug Conjugates Using Click Cycloaddition Chemistry. Bioconjug Chem. Nov. 18, 2015;26(11):2249-60. doi: 10.1021/acs.bioconjchem.5b00359. Epub Sep. 11, 2015.
Van Brunt et al., Molecular Farming: Transgenic Animals as Bioreactors. Biotechnology (N Y). 1988;6(10):1149-1154. doi: 10.1038/nbt1088-1149.
Van Overbeek et al., DNA Repair Profiling Reveals Nonrandom Outcomes at Cas9-Mediated Breaks. Mol Cell. Aug. 18, 2016;63(4):633-646. doi: 10.1016/j.molcel.2016.06.037. Epub Aug. 4, 2016.
Van Wijk et al., Identification of 51 novel exons of the Usher syndrome type 2A (USH2A) gene that encode multiple conserved functional domains and that are mutated in patients with Usher syndrome type II. Am J Hum Genet. Apr. 2004;74(4):738-44. doi: 10.1086/383096. Epub Mar. 10, 2004.
Varga et al., Progressive vascular smooth muscle cell defects in a mouse model of Hutchinson-Gilford progeria syndrome. Proc Natl Acad Sci USA. Feb. 28, 2006;103(9):3250-5. doi: 10.1073/pnas.0600012103. Epub Feb. 21, 2006.
Vellore et al., A group II intron-type open reading frame from the thermophile Bacillus (Geobacillus) stearothermophilus encodes a heat-stable reverse transcriptase. Appl Environ Microbiol. Dec. 2004;70(12):7140-7. doi: 10.1128/AEM.70.12.7140-7147.2004.
Verma, The reverse transcriptase. Biochim Biophys Acta. Mar. 21, 1977;473(1): 1-38. doi: 10.1016/0304-419x(77)90005-1.
Vigne et al., Third-generation adenovectors for gene therapy. Restor Neurol Neurosci. Jan. 1, 1995;8(1):35-6. doi: 10.3233/RNN-1995-81208.
Vik et al., Endonuclease V cleaves at inosines in RNA. Nat Commun. 2013;4:2271. doi: 10.1038/ncomms3271.
Vilenchik et al., Endogenous DNA double-strand breaks: production, fidelity of repair, and induction of cancer. Proc Natl Acad Sci U S A. Oct. 28, 2003;100(22):12871-6. doi: 10.1073/pnas.2135498100. Epub Oct. 17, 2003.
Voigt et al., Rational evolutionary design: the theory of in vitro protein evolution. Adv Protein Chem. 2000;55:79-160.
Vriend et al., Nick-initiated homologous recombination: Protecting the genome, one strand at a time. DNA Repair (Amst). Feb. 2017;50:1-13. doi: 10.1016/j.dnarep.2016.12.005. Epub Dec. 29, 2016.
Wang et al. CRISPR-Cas9 and CRISPR-Assisted Cytidine Deaminase Enable Precise and Efficient Genome Editing in Klebsiella pneumoniae. Appl Environ Microbiol. 2018;84(23):e01834-18. Published Nov. 15, 2018. doi:10.1128/AEM.01834-18.
Wang et al., AID upmutants isolated using a high-throughput screen highlight the immunity/cancer balance limiting DNA deaminase activity. Nat Struct Mol Biol. Jul. 2009;16(7):769-76. doi: 10.1038/nsmb.1623. Epub Jun. 21, 2009.
Wang et al., Continuous directed evolutions of proteins with improved soluble expression. Nature Chemical Biology. Nat Publishing Group. Aug. 20, 2018; 14(10):972-980.
Wang et al., Evolution of new nonantibody proteins via iterative somatic hypermutation. Proc Natl Acad Sci U S A. Nov. 30, 2004;101(48):16745-9. Epub Nov. 19, 2004.
Wang et al., Expanding the genetic code. Annu Rev Biophys Biomol; Struct. 2006;35:225-49. Review.
Wang et al., Highly efficient CRISPR/HDR-mediated knock-in for mouse embryonic stem cells and zygotes. Biotechniques. 2015:59,201-2;204;206-8.
Wang et al., N(6)-methyladenosine Modulates Messenger RNA Translation Efficiency. Cell. Jun. 4, 2015;161(6): 1388-99. doi: 10.1016/j.cell.2015.05.014.
Wang et al., N6-methyladenosine-dependent regulation of messenger RNA stability. Nature. Jan. 2, 2014;505(7481): 117-20. doi: 10.1038/nature12730. Epub Nov. 27, 2013.
Wang et al., Programming cells by multiplex genome engineering and accelerated evolution. Nature. Aug. 13, 2009;460(7257):894-8. Epub Jul. 26, 2009.
Wang et al., Reading RNA methylation codes through methyl-specific binding proteins. RNA Biol. 2014;11(6):669-72. doi: 10.4161/rna.28829. Epub Apr. 24, 2014.
Wang et al., Staphylococcus aureus protein SAUGI acts as a uracil-DNA glycosylase inhibitor. Nucleic Acids Res. Jan. 2014;42(2):1354-64. doi: 10.1093/nar/gkt964. Epub Oct. 22, 2013.
Wang et al., Structural basis of N(6)-adenosine methylation by the METTL3-METTL14 complex. Nature. Jun. 23, 2016;534(7608):575-8. doi: 10.1038/nature18298. Epub May 25, 2016.
Watowich, The erythropoietin receptor: molecular structure and hematopoietic signaling pathways. J Investig Med. Oct. 2011;59(7): 1067-72. doi: 10.2310/JIM.0b013e31820fb28c.
Waxman et al., Regulating excitability of peripheral afferents: emerging ion channel targets. Nat Neurosci. Feb. 2014;17(2):153-63. doi: 10.1038/nn.3602. Epub Jan. 28, 2014.
Weill et al., DNA polymerases in adaptive immunity. Nat Rev Immunol. Apr. 2008;8(4):302-12. doi: 10.1038/nri2281. Epub Mar. 14, 2008.
Weinert et al., Unbiased detection of CRISPR off-targets in vivo using DISCOVER-Seq. Science. Apr. 19, 2019;364(6437):286-289. doi: 10.1126/science.aav9023. Epub Apr. 18, 2019.
Wen et al., Inclusion of a universal tetanus toxoid CD4(+) T cell epitope P2 significantly enhanced the immunogenicity of recombinant rotavirus ?VP8* subunit parenteral vaccines. Vaccine. Jul. 31, 2014;32(35):4420-4427. doi: 10.1016/j.vaccine.2014.06.060. Epub Jun. 21, 2014.
West et al., Gene expression in adeno-associated virus vectors: the effects of chimeric mRNA structure, helper virus, and adenovirus VAI RNA. Virology. Sep. 1987;160(1):38-47. doi: 10.1016/0042-6822(87)90041-9.
Wharton et al., A new-specificity mutant of 434 repressor that defines an amino acid-base pair contact. Nature. Apr. 30-May 6, 1987;326(6116):888-91.
Wharton et al., Changing the binding specificity of a repressor by redesigning an alpha-helix. Nature. Aug. 15-21, 1985;316(6029):601-5.
Wheeler et al., The thermostability and specificity of ancient proteins. Curr Opin Struct Biol. Jun. 2016;38:37-43. doi: 10.1016/j.sbi.2016.05.015. Epub Jun. 9, 2016.
Wienert et al., KLF1 drives the expression of fetal hemoglobin in British HPFH. Blood. Aug. 10, 2017;130(6):803-807. doi: 10.1182/blood-2017-02-767400. Epub Jun. 28, 2017.
Williams et al., Assessing the accuracy of ancestral protein reconstruction methods. PLoS Comput Biol. Jun. 23, 2006;2(6):e69. doi: 10.1371/journal.pcbi.0020069. Epub Jun. 23, 2006.
Wilson et al., Assessing annotation transfer for genomics: quantifying the relations between protein sequence, structure and function through traditional and probabilistic scores. J Mol Biol 2000;297:233-49.
Wilson et al., Formation of infectious hybrid virions with gibbon ape leukemia virus and human T-cell leukemia virus retroviral envelope glycoproteins and the gag and pol proteins of Moloney murine leukemia virus. J Virol. May 1989;63(5):2374-8. doi: 10.1128/JVI.63.5.2374-2378.1989.
Wilson et al., Kinase dynamics. Using ancient protein kinases to unravel a modern cancer drug's mechanism. Science. Feb. 20, 2015;347(6224):882-6. doi: 10.1126/science.aaa1823.
Winoto et al., A novel, inducible and T cell-specific enhancer located at the 3′ end of the T cell receptor alpha locus. EMBO J. Mar. 1989;8(3):729-33.
Winter et al., Drug Development. Phthalimide conjugation as a strategy for in vivo target protein degradation. Science. Jun. 19, 2015;348(6241): 1376-81. doi:; 10.1126/science.aabl433. Epub May 21, 2015.
Winter et al., Targeted exon skipping with AAV-mediated split adenine base editors. Cell Discov. Aug. 20, 2019;5:41. doi: 10.1038/s41421-019-0109-7.
Wold, Replication protein A: a heterotrimeric, single-stranded DNA-binding protein required for eukaryotic DNA metabolism. Annu Rev Biochem. 1997;66:61-92. doi: 10.1146/annurev.biochem.66.1.61.
Wong et al., A statistical analysis of random mutagenesis methods used for directed protein evolution. J Mol Biol. Jan. 27, 2006;355(4):858-71. Epub Nov. 17, 2005.
Wong et al., The Diversity Challenge in Directed Protein Evolution. Comb Chem High Throughput Screen. May 2006;9(4):271-88.
Wood et al., A genetic system yields self-cleaving inteins for bioseparations. Nat Biotechnol. Sep. 1999;17(9):889-92. doi: 10.1038/12879.
Wright et al., Continuous in vitro evolution of catalytic function. Science. Apr. 25, 1997;276(5312):614-7.
Wright et al., Rational design of a split-Cas9 enzyme complex. Proc Natl Acad Sci U S A. Mar. 10, 2015;112(10):2984-9. doi: 10.1073/pnas.1501698112. Epub Feb. 23, 2015.
Wu et al., Human single-stranded DNA binding proteins: guardians of genome stability. Acta Biochim Biophys Sin (Shanghai). Jul. 2016;48(7):671-7. doi: 10.1093/abbs/gmw044. Epub May 23, 2016.
Wu et al., Protein trans-splicing and functional mini-inteins of a cyanobacterial dnaB intein. Biochim Biophys Acta. Sep. 8, 1998;1387(1-2):422-32. doi: 10.1016/s0167-4838(98)00157-5.
Wu et al., Protein trans-splicing by a split intein encoded in a split DnaE gene of Synechocystis sp. PCC6803. Proc Natl Acad Sci U S A. Aug. 4, 1998;95(16):9226-31. doi: 10.1073/pnas.95.16.9226.
Wu et al., Readers, writers and erasers of N6-methylated adenosine modification. Curr Opin Struct Biol. Dec. 2017;47:67-76. doi: 10.1016/j.sbi.2017.05.011. Epub Jun. 16, 2017.
Xiang et al., RNA m6A methylation regulates the ultraviolet-induced DNA damage response. Nature. Mar. 23, 2017;543(7646):573-576. doi: 10.1038/nature21671. Epub Mar. 15, 2017.
Xiao et al., Genetic incorporation of multiple unnatural amino acids into proteins in mammalian cells. Angew Chem Int Ed Engl. Dec. 23, 2013;52(52): 14080-3. doi: 10.1002/anie.201308137. Epub Nov. 8, 2013.
Xiao et al., Nuclear m(6)A Reader YTHDC1 Regulates mRNA Splicing. Mol Cell. Feb. 18, 2016;61(4):507-519. doi: 10.1016/j.molcel.2016.01.012. Epub Feb. 11, 2016.
Xie et al., Adjusting the attB site in donor plasmid improves the efficiency of ?C31 integrase system. DNA Cell Biol. Jul. 2012;31(7): 1335-40. doi: 10.1089/dna.2011.1590. Epub Apr. 10, 2012.
Xiong et al., Origin and evolution of retroelements based upon their reverse transcriptase sequences. EMBO J. Oct. 1990;9(10):3353-62.
Xu et al., Chemical ligation of folded recombinant proteins: segmental isotopic labeling of domains for NMR studies. Proc Natl Acad Sci U S A. Jan. 19, 1999;96(2):388-93. doi: 10.1073/pnas.96.2.388.
Xu et al., Accuracy and efficiency define Bxb1 integrase as the best of fifteen candidate serine recombinases for the integration of DNA into the human genome. BMC Biotechnol. Oct. 20, 2013;13:87. doi: 10.1186/1472-6750-13-87.
Xu et al., Protein splicing: an analysis of the branched intermediate and its resolution by succinimide formation. EMBO J. Dec. 1, 1994; 13(23):5517-22.
Xu et al., PTMD: A Database of Human Disease-associated Post-translational Modifications. Genomics Proteomics Bioinformatics. Aug. 2018; 16(4):244-251. doi: 10.1016/j.gpb.2018.06.004. Epub Sep. 21, 2018.
Xu et al., Structures of human ALKBH5 demethylase reveal a unique binding mode for specific single-stranded N6-methyladenosine RNA demethylation. J Biol Chem. Jun. 20, 2014;289(25):17299-311. doi: 10.1074/jbc.M114.550350. Epub Apr. 28, 2014.
Xu et al., The mechanism of protein splicing and its modulation by mutation. EMBO J. Oct. 1, 1996;15(19):5146-53.
Yamamoto et al., The ons and offs of inducible transgenic technology: a review. Neurobiol Dis. Dec. 2001;8(6):923-32.
Yamazaki et al., Segmental Isotope Labeling for Protein NMR Using Peptide Splicing. J. Am. Chem. Soc. May 22, 1998; 120(22):5591-2. https://doi.org/10.1021/ja980776o.
Yan et al., Cas13d Is a Compact RNA-Targeting Type VI CRISPR Effector Positively Modulated by a WYL-Domain-Containing Accessory Protein. Mol Cell. Apr. 19, 2018;70(2):327-339.e5. doi: 10.1016/j.molcel.2018.02.028. Epub Mar. 15, 2018.
Yang et al., Construction of an integration-proficient vector based on the site-specific recombination mechanism of enterococcal temperate phage phiFCl. J Bacteriol. Apr. 2002;184(7):1859-64. doi: 10.1128/jb.184.7.1859-1864.2002.
Yang et al., Increasing targeting scope of adenosine base editors in mouse and rat embryos through fusion of TadA deaminase with Cas9 variants. Protein Cell. Sep. 2018;9(9):814-819. doi: 10.1007/s13238-018-0568-x.
Yang et al., One-step generation of mice carrying reporter and conditional alleles by CRISPR/Cas-mediated genome engineering. Cell. Sep. 12, 2013; 154(6): 1370-9. doi: 10.1016/j.cell.2013.08.022. Epub Aug. 29, 2013.
Yang et al., Permanent genetic memory with >1-byte capacity. Nat Methods. Dec. 2014;11(12):1261-6. doi: 10.1038/nmeth.3147. Epub Oct. 26, 2014.
Yang et al., Preparation of RNA-directed DNA polymerase from spleens of Balb-c mice infected with Rauscher leukemia virus. Biochem Biophys Res Commun. Apr. 28, 1972;47(2):505-11. doi: 10.1016/0006-291x(72)90743-7.
Yang et al., Small-molecule control of insulin and PDGF receptor signaling and the role of membrane attachment. Curr Biol. Jan. 1, 1998;8(1):11-8. doi: 10.1016/s0960-9822(98)70015-6.
Yang, Nucleases: diversity of structure, function and mechanism. Q Rev Biophys. Feb. 2011;44(1):1-93. doi: 10.1017/S0033583510000181. Epub Sep. 21, 2010.
Yang, PAML 4: phylogenetic analysis by maximum likelihood. Mol Biol Evol. Aug. 2007;24(8):1586-91. doi: 10.1093/molbev/msm088. Epub May 4, 2007.
Yasui et al., Miscoding Properties of 2′-Deoxyinosine, a Nitric Oxide-Derived DNA Adduct, during Translesion Synthesis Catalyzed by Human DNA Polymerases. J Molec Biol. Apr. 4, 2008;377(4):1015-23.
Yasui, Alternative excision repair pathways. Cold Spring Harb Perspect Biol. Jun. 1, 2013;5(6):a012617. doi: 10.1101/cshperspect.a012617.
Yasukawa et al., Characterization of Moloney murine leukaemia virus/avian myeloblastosis virus chimeric reverse transcriptases. J Biochem. Mar. 2009;145(3):315-24. doi: 10.1093/jb/mvn166. Epub Dec. 6, 2008.
Yeh et al., In vivo base editing of post-mitotic sensory cells. Nat Commun. Jun. 5, 2018;9(1):2184. doi: 10.1038/s41467-018-04580-3.
Yokoe et al., Spatial dynamics of GFP-tagged proteins investigated by local fluorescence enhancement. Nat Biotechnol. Oct. 1996;14(10):1252-6. doi: 10.1038/nbt1096-1252.
Yu et al., Circular permutation: a different way to engineer enzyme structure and function. Trends Biotechnol. Jan. 2011;29(1):18-25. doi: 10.1016/j.tibtech.2010.10.004. Epub Nov. 17, 2010.
Yu et al., Liposome-mediated in vivo E1A gene transfer suppressed dissemination of ovarian cancer cells that overexpress HER-2/neu. Oncogene. Oct. 5, 1995;ll(7):1383-8.
Yu et al., Progress towards gene therapy for HIV infection. Gene Ther. Jan. 1994;1(1):13-26.
Yu et al., Small molecules enhance CRISPR genome editing in pluripotent stem cells. Cell Stem Cell. Feb. 5, 2015;16(2): 142-7.doi: 10.1016/j.stem.2015.01.003.
Yu et al., Synthesis-dependent microhomology-mediated end joining accounts for multiple types of repair junctions. Nucleic Acids Res. Sep. 2010;38(17):5706-17. doi: 10.1093/nar/gkq379. Epub May 11, 2010.
Zakas et al., Enhancing the pharmaceutical properties of protein drugs by ancestral sequence reconstruction. Nat Biotechnol. Jan. 2017;35(l):35-37. doi: 10.1038/nbt.3677. Epub Sep. 26, 2016.
Zalatan et al., Engineering complex synthetic transcriptional programs with CRISPR RNA scaffolds. Cell. Jan. 15, 2015;160(1-2):339-50. doi: 10.1016/j.cell.2014.11.052. Epub Dec. 18, 2014.
Zettler et al., The naturally split Npu DnaE intein exhibits an extraordinarily high rate in the protein trans-splicing reaction. FEBS Lett. Mar. 4, 2009;583(5):909-14. doi: 10.1016/j.febslet.2009.02.003. Epub Feb. 10, 2009.
Zhang et al., II-Clamp-mediated cysteine conjugation. Nat Chem. Feb. 2016;8(2): 120-8. doi: 10.1038/nchem.2413. Epub Dec. 21, 2015.
Zhang et al., A new strategy for the site-specific modification of proteins in vivo. Biochemistry. Jun. 10, 2003;42(22):6735-46.
Zhang et al., Circular intronic long noncoding RNAs. Mol Cell. Sep. 26, 2013;51(6):792-806. doi: 10.1016/j.molcel.2013.08.017. Epub Sep. 12, 2013.
Zhang et al., Copy number variation in human health, disease, and evolution. Annu Rev Genomics Hum Genet. 2009;10:451-81. doi: 10.1146/annurev.genom.9.081307.164217.
Zhang et al., Myoediting: Toward Prevention of Muscular Dystrophy by Therapeutic Genome Editing. Physiol Rev. Jul. 18, 201;98(3): 1205-1240. doi: 10.1152/physrev.00046.2017.
Zhao et al., An ultraprocessive, accurate reverse transcriptase encoded by a metazoan group II intron. RNA. Feb. 2018;24(2):183-195. doi: 10.1261/ma.063479.117. Epub Nov. 6, 2017.
Zhao et al., Crystal structures of a group II intron maturase reveal a missing link in spliceosome evolution. Nat Struct Mol Biol. Jun. 2016;23(6):558-65. doi: 10.1038/nsmb.3224. Epub May 2, 2016.
Zhao et al., Post-transcriptional gene regulation by mRNA modifications. Nat Rev Mol Cell Biol. Jan. 2017;18(1):31-42. doi: 10.1038/nrm.2016.132. Epub Nov. 3, 2016.
Zheng et al., ALKBH5 is a mammalian RNA demethylase that impacts RNA metabolism and mouse fertility. Mol Cell. Jan. 10, 2013;49(1):18-29. doi: 10.1016/j.molcel.2012.10.015. Epub Nov. 21, 2012.
Zheng et al., Highly efficient base editing in bacteria using a Cas9-cytidine deaminase fusion. CommunBiol. Apr. 19, 2018;1:32. doi: 10.1038/s42003-018-0035-5.
Zheng et al., Structural basis for the complete resistance of the human prion protein mutant G127V to prion disease. Sci Rep. Sep. 4, 2018;8(1): 13211. doi: 10.1038/s41598-018-31394-6.
Zhou et al., Dynamic m(6)A mRNA methylation directs translational control of heat shock response. Nature. Oct. 22, 2015;526(7574):591-4. doi: 10.1038/nature15377. Epub Oct. 12, 2015.
Zhou et al., Off-target RNA mutation induced by DNA base editing and its elimination by mutagenesis. Nature. Jul. 2019;571(7764):275-278. doi: 10.1038/s41586-019-1314-0. Epub Jun. 10, 2019.
Zhou et al., Protective VI27 prion variant prevents prion disease by interrupting the formation of dimer and fibril from molecular dynamics simulations. Sci Rep. Feb. 24, 2016;6:21804. doi: 10.1038/srep21804.
Zhou et al., Seamless Genetic Conversion of SMN2 to SMN1 via CRISPR/Cpfl and Single-Stranded Oligodeoxynucleotides in Spinal Muscular Atrophy Patient-Specific Induced Pluripotent Stem Cells. Hum Gene Ther. Nov. 2018;29(11):1252-1263. doi: 10.1089/hum.2017.255. Epub May 9, 2018.
Ztelenski, Genotype and phenotype in cystic fibrosis. Respiration. 2000;67(2):117-33. doi: 10.1159/000029497.
Zimmerly et al., An Unexplored Diversity of Reverse Transcriptases in Bacteria. Microbiol Spectr. Apr. 2015;3(2):MDNA3-0058-2014. doi: 10.1128/microbiolspec.MDNA3-0058-2014.
Zimmerly et al., Group II intron mobility occurs by target DNA-primed reverse transcription. Cell. Aug. 25, 1995;82(4):545-54. doi: 10.1016/0092-8674(95)90027-6.
Zufferey et al., Woodchuck hepatitis virus posttranscriptional regulatory element enhances expression of transgenes delivered by retroviral vectors. J Virol. Apr. 1999;73(4):2886-92. doi: 10.1128/JVI.73.4.2886-2892.1999.
Zuker et al., Optimal computer folding of large RNA sequences using thermodynamics and auxiliary information. Nucleic Acids Res. Jan. 10, 19810;9(1):133-48. doi: 10.1093/nar/9.1.133.
Zuo et al., Cytosine base editor generates substantial off-target single-nucleotide variants in mouse embryos. Science. Apr. 19, 2019;364(6437):289-292. doi: 10.1126/science.aav9973. Epub Feb. 28, 2019.
Aida et al., Prime editing primarily incudes undesired outcomes in mice. bioRxiv preprint and Supplemental Information. Aug. 6, 2020. Retrieved from www.biorxiv.org. doi: 10.1101/2020.08.06.239723. 40 pages.
Akopian et al., Chimeric recombinases with designed DNA sequence recognition. Proc Natl Acad Sci USA. Jul. 2, 20032;100(15):8688-91. Epub Jul. 1, 2003.
André et al., Axotomy-induced expression of calcium-activated chloride current in subpopulations of mouse dorsal root ganglion neurons. J Neurophysiol. Dec. 2003;90(6):3764-73. doi: 10.1152/jn.00449.2003. Epub Aug. 27, 2003.
Berges et al., Transduction of brain by herpes simplex virus vectors. Mol Ther. Jan. 2007;15(1):20-9. doi: 10.1038/sj.mt.6300018.
Bhagwat, DNA-cytosine deaminases: from antibody maturation to antiviral defense. DNA Repair (Amst). Jan. 5, 2004;3(1):85-9.
Bourinet et al., Silencing of the Cav3.2 T-type calcium channel gene in sensory neurons demonstrates its major role in nociception. EMBO J. Jan. 26, 2005;24(2):315-24. doi: 10.1038/sj.emboj.7600515. Epub Dec. 16, 2004.
Burke et al., Activating mutations of Tn3 resolvase marking interfaces important in recombination catalysis and its regulation. Mol Microbiol. Feb. 2004;51(4):937-48.
Burton et al., Gene delivery using herpes simplex virus vectors. DNA Cell Biol. Dec. 2002;21(12):915-36. doi: 10.1089/104454902762053864.
Chari et al., Unraveling CRISPR-Cas9 genome engineering parameters via a library-on-library approach. Nat Methods. Sep. 2015;12(9):823-6. doi: 10.1038/nmeth.3473. Epub Jul. 13, 2015.
Chavez et al., Therapeutic applications of the ?C31 integrase system. Curr Gene Ther. Oct. 2011;11(5):375-81. Review.
Chen et al., Genome-wide CRISPR screen in a mouse model of tumor growth and metastasis. Cell. Mar. 12, 2015; 160(6): 1246-60. doi: 10.1016/j.cell.2015.02.038. Epub Mar. 5, 2015.
Cheng et al., Multiplexed activation of endogenous genes by CRISPR-on, an RNA-guided transcriptional activator system. Cell Res. Oct. 2013;23(10):1163-71. doi: 10.1038/cr.2013.122. Epub Aug. 27, 2013.
Chester et al., The apolipoprotein B mRNA editing complex performs a multifunctional cycle and suppresses nonsense-mediated decay. EMBO J. Aug. 1, 2003 ;22(15):3971-82. doi: 10.1093/emboj/cdg369.
Cho et al., The calcium-activated chloride channel anoctamin 1 acts as a heat sensor in nociceptive neurons. Nat Neurosci. May 27, 2012;15(7):1015-21. doi: 10.1038/nn.3111.
Cox et al., Congenital insensitivity to pain: novel SCN9A missense and in-frame deletion mutations. Hum Mutat. Sep. 2010;31(9):E1670-86. doi: 10.1002/humu.21325.
Cox et al., RNA editing with CRISPR-Cas13. Science. Nov. 24, 2017;358(6366):1019-1027. doi: 10.1126/science.aaq0180. Epub Oct. 25, 2017.
Cronican et al., A class of human proteins that deliver functional proteins into mammalian cells in vitro and in vivo. Chem Biol. Jul. 29, 2011;18(7):833-8. doi: 10.1016/j.chembiol.2011.07.003.
Cronican et al., Potent delivery of functional proteins into mammalian cells in vitro and in vivo using a supercharged protein. ACS Chem Biol. Aug. 20, 2010;5(8):747-52. doi: 10.1021/cb1001153.
Database EBI Accession No. ADE34233 Jan. 29, 2004.
Database EBI Accession No. BFF09785. May 31, 2018. 2 pages.
Database EBI Accession No. BGE38086. Jul. 25, 2019. 2 pages.
Database UniProt Accession No. G8I3E0. Jan. 14, 2012.
Davidson et al., Viral vectors for gene delivery to the nervous system. Nat Rev Neurosci. May 2003;4(5):353-64. doi: 10.1038/nrn1104.
Deverman et al., Cre-dependent selection yields AAV variants for widespread gene transfer to the adult brain. Nat Biotechnol. Feb. 2016;34(2):204-9. doi: 10.1038/nbt.3440. Epub Feb. 1, 2016.
Devigili et al., Paroxysmal itch caused by gain-of-function Nav1.7 mutation. Pain. Sep. 2014;155(9):1702-1707. doi: 10.1016/j.pain.2014.05.006. Epub May 10, 2014.
Doench et al., Rational design of highly active sgRNAs for CRISPR-Cas9-mediated gene inactivation. Nat Biotechnol. Dec. 2014;32(12): 1262-7. doi: 10.1038/nbt.3026. Epub Sep. 3, 2014.
Emery et al., HCN2 ion channels play a central role in inflammatory and neuropathic pain. Science. Sep. 9, 2011;333(6048): 1462-6. doi: 10.1126/science.1206243.
Estacion et al., A sodium channel gene SCN9A polymorphism that increases nociceptor excitability. Ann Neurol. Dec. 2009;66(6):862-6. doi: 10.1002/ana.21895.
Farboud et al., Dramatic enhancement of genome editing by CRISPR/Cas9 through improved guide RNA design. Genetics. Apr. 2015;199(4):959-71. doi: 10.1534/genetics.115.175166. Epub Feb. 18, 2015.
Fusi et al., In Silico Predictive Modeling of CRISPR/Cas9 guide efficiency. Jun. 26, 2015; bioRxiv. http://dx.doi.org/10.1101/021568.
Gaj et al., Structure-guided reprogramming of serine recombinase DNA sequence specificity. Proc Natl Acad Sci USA. Jan. 11, 2011;108(2):498-503. doi: 10.1073/pnas.1014214108. Epub Dec. 27, 2010.
Genbank Submission; NIH/NCBI, Accession No. NM_002945.3. Weiser et al., Sep. 3, 2017. 5 pages.
Genbank Submission; NIH/NCBI, Accession No. NM_002947.4. Xiao et al., May 1, 2019. 4 pages.
Genbank Submission; NIH/NCBI, Accession No. NP_358988.1. Hoskins et al., Jan. 11, 2017. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. NP_628093.1. Hsiao et al., Aug. 3, 2016. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. YP_009137104.1. Davison, Aug. 13, 2018. 2 pages.
Goldberg et al., Loss-of-function mutations in the Navi.7 gene underlie congenital indifference to pain in multiple human populations. Clin Genet. Apr. 2007;71(4):311-9. doi: 10.1111/j. 1399-0004.2007.00790.X.
Gong et al., Active DNA demethylation by oxidation and repair. Cell Res. Dec. 2011;21(12):1649-51. doi: 10.1038/cr.2011.140. Epub Aug. 23, 2011.
Goodnough et al., Development of a delivery vehicle for intracellular transport of botulinum neurotoxin antagonists. FEBS Lett. Feb. 27, 2002;513(2-3):163-8.
Gordley et al., Evolution of programmable zinc finger-recombinases with activity in human cells. J Mol Biol. Mar. 30, 2007;367(3):802-13. Epub Jan. 12, 2007.
Gordley et al., Synthesis of programmable integrases. Proc Natl Acad Sci USA. Mar. 31, 2009;106(13):5053-8. doi: 10.1073/pnas.0812502106. Epub Mar. 12, 2009.
Grindley et al., Mechanisms of site-specific recombination. Annu Rev Biochem. 2006;75:567-605. doi: 10.1146/annurev.biochem.73.011303.073908.
Groth et al., Phage integrases: biology and applications. J Mol Biol. Jan. 16, 2004;335(3):667-78.
Gruber et al., The Vienna RNA websuite. Nucleic Acids Res. Jul. 1, 2008;36(Web Server issue):W70-4. doi: 10.1093/nar/gknl88. Epub Apr. 19, 2008.
Guo et al., Structure of Cre recombinase complexed with DNA in a site-specific recombination synapse. Nature. Sep. 4, 1997;389(6646):40-6.
Hartung et al., Cre mutants with altered DNA binding properties. J Biol Chem. Sep. 4, 1998;273(36):22884-91.
Hirano et al., Site-specific recombinases as tools for heterologous gene integration. Appl Microbiol Biotechnol. Oct. 2011;92(2):227-39. doi: 10.1007/s00253-011-3519-5. Epub Aug. 7, 2011. Review.
Hoess et al., DNA specificity of the Cre recombinase resides in the 25 kDa carboxyl domain of the protein. J Mol Biol. Dec. 20, 1990;216(4):873-82. doi: 10.1016/S0022-2836(99)80007-2.
Holt et al., Human hematopoietic stem/progenitor cells modified by zinc-finger nucleases targeted to CCR5 control HIV-1 in vivo. Nat Biotechnol. Aug. 2010;28(8):839-47. doi: 10.1038/nbt.l663. Epub Jul. 2, 2010.
Hotta et al., [Neurotropic viruses—classification, structure and characteristics]. Nihon Rinsho. Apr. 1997;55(4):777-82. Japanese.
Housden et al., Identification of potential drug targets for tuberous sclerosis complex by synthetic screens combining CRISPR-based knockouts with RNAi. Sci Signal. Sep. 8, 2015;8(393):rs9. doi: 10.1126/scisignal.aab3729.
Hu et al., Evolved Cas9 variants with broad PAM compatibility and high DNA specificity. Nature. Apr. 5, 2018;556(7699):57-63 and Extended/Supplementary Data, doi: 10.1038/nature26155. Epub Feb. 28, 2018. 21 pages.
Jiang et al., Prime editing efficiently generates W542L and S621I double mutations in two ALS genes of maize. bioRxiv preprint. Jul. 6, 2020. Retrieved from www.biorxiv.org. doi: 10.1101/2020.07.06.188896. 15 pages.
Kay et al., Viral vectors for gene therapy: the art of turning infectious agents into vehicles of therapeutics. Nat Med. Jan. 2001;7(l):33-40.
Kilbride et al., Determinants of product topology in a hybrid Cre-Tn3 resolvase site-specific recombination system. J Mol Biol. Jan. 13, 2006;355(2): 185-95. Epub Nov. 9, 2005.
Kim et al., In vivo genome editing with a small Cas9 orthologue derived from Campylobacter jejuni. Nat Commun. Feb. 21, 2017;8:14500. doi: 10.1038/ncomms14500. PMID: 28220790; PMCID: PMC5473640.
Kleinstiver et al., Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature. Jul. 23, 2015;523(7561):481-5 and Supplementary Materials, doi: 10.1038/nature14592. Epub Jun. 22, 2015. 27 pages.
Koblan et al., Improving cytidine and adenine base editors by expression optimization and ancestral reconstruction. Nat Biotechnol. Oct. 2018;36(9):843-846. doi: 10.1038/nbt.4172. Epub May 29, 2018.
Landrum et al., ClinVar: public archive of relationships among sequence variation and human phenotype. Nucleic Acids Res. Jan. 2014;42(Database issue):D980-5. doi: 10.1093/nar/gkt1113. Epub Nov. 14, 2013.
Leipold et al., A de novo gain-of-function mutation in SCN11A causes loss of pain perception. Nat Genet. Nov. 2013;45(11):1399-404. doi: 10.1038/ng.2767. Epub Sep. 15, 2013.
Li et al., Precise Modifications of Both Exogenous and Endogenous Genes in Rice by Prime Editing. Mol Plant. May 4, 2020;13(5):671-674. doi: 10.1016/j.molp.2020.03.011. Epub Mar. 25, 2020.
Lim et al., Viral vectors for neurotrophic factor delivery: a gene therapy approach for neurodegenerative diseases of the CNS. Pharmacol Res. Jan. 2010;61(l):14-26. doi: 10.1016/j.phrs.2009.10.002. Epub Oct. 17, 2009.
Lin et al., Prime genome editing in rice and wheat. Nat Biotechnol. May 2020;38(5):582-585 and Supplemental Info, doi: 10.1038/s41587-020-0455-x. Epub Mar. 16, 2020. 8 pages.
Maizels et al., Initiation of homologous recombination at DNA nicks. Nucleic Acids Res. Aug. 21, 2018;46(14):6962-6973. doi: 10.1093/nar/gky588.
Mir et al., Type II-C CRISPR-Cas9 Biology, Mechanism, and Application. ACS Chem Biol. Feb. 16, 2018;13(2):357-365. doi: 10.1021/acschembio.7b00855. Epub Dec. 20, 2017.
Moreno-Mateos et al., CRISPRscan: designing highly efficient sgRNAs for CRISPR-Cas9 targeting in vivo. Nat Methods. Oct. 2015;12(10):982-8. doi: 10.1038/nmeth.3543. Epub Aug. 31, 2015.
Mougiakos et al., Characterizing a thermostable Cas9 for bacterial genome editing and silencing. Nat Commun. Nov. 21, 2017;8(1):1647. doi: 10.1038/s41467-017-01591-4.
Murphy, Phage recombinases and their applications. Adv Virus Res. 2012;83:367-414. doi: 10.1016/B978-0-12-394438-2.00008-6. Review.
Nelson et al., Engineered pegRNAs improve prime editing efficiency. Nat Biotechnol. Oct. 4, 2021. doi: 10.1038/s41587-021-01039-7. Epub ahead of print. Erratum in: Nat Biotechnol. Dec. 8, 2021. 14 pages.
Olorunniji et al., Synapsis and catalysis by activated Tn3 resolvase mutants. Nucleic Acids Res. Dec. 2008;36(22):7181-91. doi: 10.1093/nar/gkn885. Epub Nov. 10, 2008.
Raghavan et al., Abstract 27: Therapeutic Targeting of Human Lipid Genes with in vivo CRISPR-Cas9 Genome Editing. Oral Abstract Presentations: Lipoprotein Metabolism and Therapeutic Targets. Arterioscler THromb Vase Biol. 2015;35(Suppl. 1):Abstract 27. 5 pages.
Reynaud et al., What role for AID: mutator, or assembler of the immunoglobulin mutasome? Nat Immunol. Jul. 2003;4(7):631-8.
Rongrong et al., Effect of deletion mutation on the recombination activity of Cre recombinase. Acta Biochim Pol. 2005;52(2):541-4. Epub May 15, 2005.
Sapunar et al., Dorsal root ganglion—a potential new therapeutic target for neuropathic pain. J Pain Res. 2012;5:31-8. doi: 10.2147/JPR.S26603. Epub Feb. 16, 2012.
Score Results for Luetticken et al., Complete genome sequence of a Streptococcus dysgalactiae subsp. RT equisimilis strain possessing Lancefield's group A antigen. RL Submitted to the EMBL/GenBank/DDBJ databases. May 2012. 3 pages.
Score Results for Okumura et al., Evolutionary paths of streptococcal and staphylococcal superantigens. RL BMC Genomics. 2012;13:404-404. 3 pages.
Score Results for SHIMOMURA et al., Complete Genome Sequencing and Analysis of a Lancefield Group G RT Streptococcus dysagalactiae Subsp. Equisimilis Strain Causing Streptococcal RT Toxic Shock Syndrome (STSS). RL BMC Genomics. 2011;12:17-17. 3 pages.
Shaikh et al., Chimeras of the Flp and Cre recombinases: tests of the mode of cleavage by Flp and Cre. J Mol Biol. Sep. 8, 2000;302(1):27-48.
Shen et al., Herpes simplex virus 1 (HSV-1) for cancer treatment. Cancer Gene Ther. Nov. 2006;13(11):975-92. doi: 10.1038/sj.cgt.7700946. Epub Apr. 7, 2006.
Singh et al., Real-time observation of DNA target interrogation and product release by the RNA-guided endonuclease CRISPR Cpfl (Cas12a). Proc Natl Acad Sci USA. May 22, 2018;115(21):5444-5449. doi: 10.1073/pnas. 1718686115. Epub May 7, 2018.
Siu et al., Riboregulated toehold-gated gRNA for programmable CRISPR-Cas9 function. Nat Chem Biol. Mar. 2019;15(3):217-220. doi: 10.1038/s41589-018-0186-1. Epub Dec. 10, 2018.
Smith et al., Diversity in the serine recombinases. Mol Microbiol. Apr. 2002;44(2):299-307. Review.
Smith et al., Herpesvirus transport to the nervous system and back again. Annu Rev Microbiol. 2012;66:153-76. doi: 10.1146/annurev-micro-092611-150051. Epub Jun. 15, 2012.
Soman Athan et al., AAV vectors expressing LDLR gain-of-function variants demonstrate increased efficacy in mouse models of familial hypercholesterolemia. Circ Res. Aug. 29, 2014;115(6):591-9. doi: 10.1161/CIRCRESAHA.115.304008. Epub Jul. 14, 2014.
Steiner et al., The neurotropic herpes viruses: herpes simplex and varicella-zoster. Lancet Neurol. Nov. 2007;6(11):1015-28. doi: 10.1016/S1474-4422(07)70267-3.
Strecker et al., Engineering of CRISPR-Cas12b for human genome editing. Nat Commun. Jan. 22, 2019;10(1):212. doi: 10.1038/s41467-018-08224-4.
Teng et al., Mutational analysis of apolipoprotein B mRNA editing enzyme (APOBEC1). structure-function relationships of RNA editing and dimerization. J Lipid Res. Apr. 1999;40(4):623-35.
Tratschin et al., Adeno-associated virus vector for high-frequency integration, expression, and rescue of genes in mammalian cells. Mol Cell Biol. Nov. 1985;5(11):3251-60. doi: 10.1128/mcb.5.11.3251.
Uniprotkb Submission; Accession No. P0DOC6. No Author Listed., Oct. 5, 2016. 5 pages.
Venken et al., Genome-wide manipulations of Drosophila melanogaster with transposons, Flp recombinase, and ΦC31 integrase. Methods Mol Biol. 2012;859:203-28. doi: 10.1007/978-1-61779-603-6_12.
Wang et al., Optimized paired-sgRNA/Cas9 cloning and expression cassette triggers high-efficiency multiplex genome editing in kiwifruit. Plant Biotechnol J. Aug. 2018;16(8):1424-1433. doi: 10.1111/pbi.12884. Epub Feb. 6, 2018.
Weiss et al., Loss-of-function mutations in sodium channel Navi.7 cause anosmia. Nature. Apr. 14, 2011;472(7342): 186-90. doi: 10.1038/nature09975. Epub Mar. 23, 2011.
Woods et al., The phenotype of congenital insensitivity to pain due to the NaV1.9 variant p.L811P. Eur J Hum Genet. May 2015;23(5):561-3. doi: 10.1038/ejhg.2014.166. Epub Aug. 13, 2014.
Yan et al., Functionally diverse type V CRISPR-Cas systems. Science. Jan. 4, 2019;363(6422):88-91. doi: 10.1126/science.aav7271. Epub Dec. 6, 2018.
Yang, Development of Human Genome Editing Tools for the Study of Genetic Variations and Gene Therapies. Doctoral Dissertation. Harvard University. 2013. Accessible via nrs.harvard.edu/urn-3:HUL.InstRepos:11181072. 277 pages.
U.S. Appl. No. 17/289,665, filed Apr. 28, 2021, Liu et al.
U.S. Appl. No. 16/756,432, filed Apr. 15, 2020, Liu etal.
U.S. Appl. No. 16/772,747, filed Jun. 12, 2020, Shen et al.
U.S. Appl. No. 17/425,261, filed Jul. 22, 2021, Kim et al.
U.S. Appl. No. 17/057,398, filed Nov. 20, 2020, Liu et al.
U.S. Appl. No. 17/259,147, filed Jan. 8, 2021, Liu et al.
U.S. Appl. No. 17/270,396, filed Feb. 22, 2021, Liu et al.
U.S. Appl. No. 17/273,688, filed Mar. 4, 2021, Liu et al.
U.S. Appl. No. 17/294,287, filed May 14, 2021, Liu et al.
U.S. Appl. No. 17/288,504, filed Apr. 23, 2021, Liu et al.
U.S. Appl. No. 17/633,573, filed Feb. 7, 2022, Liu et al.
U.S. Appl. No. 17/436,048, filed Sep. 2, 2021, Liu et al.
U.S. Appl. No. 17/219,590, filed Mar. 31, 2021, Liu et al.
U.S. Appl. No. 17/603,917, filed Oct. 14, 2021, Liu et al.
U.S. Appl. No. 17/602,738, filed Oct. 8, 2021, Liu et al.
U.S. Appl. No. 17/613,025, filed Nov. 19, 2021, Liu et al.
U.S. Appl. No. 17/300,668, filed Sep. 17, 2021, Liu et al.
U.S. Appl. No. 17/219,635, filed Mar. 31, 2021, Liu et al.
U.S. Appl. No. 17/219,672, filed Mar. 31, 2021, Liu et al.
U.S. Appl. No. 17/440,682, filed Sep. 17, 2021, Liu et al.
U.S. Appl. No. 14/234,031, filed Mar. 24, 2014, Liu et al.
U.S. Appl. No. 14/320,271, filed Jun. 30, 2014, Liu et al.
U.S. Appl. No. 16/441,751, filed Jun. 14, 2019, Liu et al.
U.S. Appl. No. 14/320,519, filed Jun. 30, 2014, Liu et al.
U.S. Appl. No. 14/913,458, filed Feb. 22, 2016, Liu et al.
U.S. Appl. No. 16/266,937, filed Feb. 4, 2019, Liu et al.
U.S. Appl. No. 14/320,370, filed Jun. 30, 2014, Liu et al.
U.S. Appl. No. 14/320,413, filed Jun. 30, 2014, Liu et al.
U.S. Appl. No. 14/874,123, filed Oct. 2, 2015, Liu et al.
U.S. Appl. No. 14/911,117, filed Feb. 9, 2016, Liu et al.
U.S. Appl. No. 17/160,329, filed Jan. 27, 2021, Liu et al.
U.S. Appl. No. 15/029,602, filed Apr. 14, 2016, Ritter et al.
U.S. Appl. No. 14/462,163, filed Aug. 18, 2014, Liu et al.
U.S. Appl. No. 14/462,189, filed Aug. 18, 2014, Liu et al.
U.S. Appl. No. 14/916,679, filed Mar. 4, 2016, Liu et al.
U.S. Appl. No. 16/860,639, filed Apr. 28, 2020, Liu et al.
U.S. Appl. No. 14/320,498, filed Jun. 30, 2014, Liu et al.
U.S. Appl. No. 14/320,467, filed Jun. 30, 2014, Liu et al.
U.S. Appl. No. 14/916,681, filed Mar. 4, 2016, Liu et al.
U.S. Appl. No. 17/103,233, filed Nov. 24, 2020, Liu et al.
U.S. Appl. No. 14/326,329, filed Jul. 8, 2014, Liu et al.
U.S. Appl. No. 14/326,340, filed Jul. 8, 2014 Liu et al.
U.S. Appl. No. 14/326,361, filed Jul. 8, 2014, Liu et al.
U.S. Appl. No. 14/916,683, filed Mar. 4, 2016, Liu et al.
U.S. Appl. No. 16/796,323, filed Feb. 20, 2020, Liu et al.
U.S. Appl. No. 17/688,416, filed Mar. 7, 2022, Liu et al.
U.S. Appl. No. 14/325,815, filed Jul. 8, 2014, Liu et al.
U.S. Appl. No. 14/326,109, filed Jul. 8, 2014, Liu et al.
U.S. Appl. No. 14/326,140, filed Jul. 8, 2014, Liu et al.
U.S. Appl. No. 14/326,269, filed Jul. 8, 2014, Liu et al.
U.S. Appl. No. 14/326,290, filed Jul. 8, 2014, Liu et al.
U.S. Appl. No. 14/326,318, filed Jul. 8, 2014, Liu et al.
U.S. Appl. No. 14/326,303, filed Jul. 8, 2014, Liu et al.
U.S. Appl. No. 15/103,608, filed Jun. 10, 2016, Liu et al.
U.S. Appl. No. 16/374,634, filed Apr. 3, 2019, Liu et al.
U.S. Appl. No. 17/408,306, filed Aug. 20, 2021, Liu et al.
U.S. Appl. No. 15/329,925, filed Jan. 27, 2017, Liu et al.
U.S. Appl. No. 16/132,276, filed Sep. 14, 2018, Liu et al.
U.S. Appl. No. 16/888,646, filed May 29, 2020, Liu et al.
U.S. Appl. No. 14/529,010, filed Oct. 30, 2014, Liu et al.
U.S. Appl. No. 15/958,721, filed Apr. 20, 2018, Liu et al.
U.S. Appl. No. 17/130,812, filed Dec. 22, 2020, Liu et al.
U.S. Appl. No. 15/331,852, filed Oct. 22, 2016, Liu et al.
U.S. Appl. No. 15/960,171, filed Apr. 23, 2018, Liu et al.
U.S. Appl. No. 17/527,011, filed Nov. 15, 2021, Liu et al.
U.S. Appl. No. 15/770,076, filed Apr. 20, 2018, Liu et al.
U.S. Appl. No. 15/852,891, filed Dec. 22, 2017, Maianti et al.
U.S. Appl. No. 16/926,436, filed Jul. 10, 2020, Maianti et al.
U.S. Appl. No. 15/852,526, filed Dec. 22, 2017, Maianti et al.
U.S. Appl. No. 16/492,534, filed Sep. 9, 2019, Liu et al.
U.S. Appl. No. 16/324,476, filed Feb. 8, 2019, Liu et al.
U.S. Appl. No. 15/791,085, filed Oct. 23, 2017, Liu et al.
U.S. Appl. No. 16/143,370, filed Sep. 26, 2018, Liu et al.
U.S. Appl. No. 17/148,059, filed Jan. 13, 2021, Liu et al.
U.S. Appl. No. 16/492,548, filed Sep. 9, 2019, Maianti et al.
U.S. Appl. No. 15/784,033, filed Oct. 13, 2017, Liu et al.
U.S. Appl. No. 17/692,925, filed Mar. 11, 2022, Liu et al.
U.S. Appl. No. 16/492,553, filed Sep. 9, 2019, Liu et al.
U.S. Appl. No. 15/934,945, filed Mar. 23, 2018, Liu et al.
U.S. Appl. No. 17/586,688, filed Jan. 27, 2022, Liu et al.
U.S. Appl. No. 16/643,376, filed Feb. 28, 2020, Liu et al.
U.S. Appl. No. 17/700,109, filed Mar. 21, 2022, Liu et al.
U.S. Appl. No. 16/612,988, filed Nov. 12, 2019, Liu et al.
U.S. Appl. No. 16/634,405, filed Jan. 27, 2020, Liu et al.
U.S. Appl. No. 16/976,047, filed Aug. 26, 2020, Liu et al.
U.S. Appl. No. 17/593,020, filed Sep. 3, 2021, Church et al.
Related Publications (1)
Number Date Country
20200010835 A1 Jan 2020 US
Provisional Applications (1)
Number Date Country
62379122 Aug 2016 US