Claims
- 1. A therapeutic agent comprising
(a) a first domain that binds a first protein, the first protein having at least seven consecutive glutamine residues; (b) a second domain that binds a second protein, the second protein having at least seven consecutive glutamine residues; and (c) a third domain that separates the first domain from the second domain.
- 2. The therapeutic agent of claim 1, wherein the first protein and the second protein each have at least seven consecutive glutamine residues.
- 3. The therapeutic agent of claim 2, wherein the first protein and the second protein each have more than 37 consecutive glutamine residues.
- 4. The therapeutic agent of claim 1, wherein the first domain and the second domain are identical.
- 5. The therapeutic agent of claim 1, wherein the first domain or the second domain comprises a peptide.
- 6. The therapeutic agent of claim 5, wherein the peptide comprises at least three consecutive glutamine residues.
- 7. The therapeutic agent of claim 6, wherein the peptide comprises the first 17 amino acid residues of a huntingtin protein fused to 25 glutamine residues.
- 8. The therapeutic agent of claim 1, wherein the third domain comprises a peptide or other polymer.
- 9. The therapeutic agent of claim 8, wherein the peptide comprises an alpha-helical region or a beta-sheet.
- 10. The therapeutic agent of claim 6, wherein the third domain comprises LEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVR-AEIYEAFENIYPILKGFRK (SEQ ID NO: 11).
- 11. A therapeutic composition comprising the therapeutic agent of claim 1.
- 12. An isolated DNA molecule, wherein the DNA molecule encodes a polypeptide having three domains:
(a) a first domain that binds a first protein, the first protein having at least seven consecutive glutamine residues; (b) a second domain that binds a second protein, the second protein having at least seven consecutive glutamine residues; and (c) a third domain that separates the first domain from the second domain.
- 13. An expression vector comprising the isolated DNA molecule of claim 12.
- 14. A cell comprising the expression vector of claim 13.
- 15. A method of treating a patient who has a disease associated with expanded CAG repeats, the method comprising administering to the patient the therapeutic agent of claim 1.
- 16. The method of claim 15, wherein the disease is Huntington's disease (HD), primal and bulbar muscular atrophy (SBMA), dentatorubral-pallidoluysian atrophy, spinocerebellar ataxia type 1, type 2, type 6, or type 7, or Machado-Joseph disease (MJD/SCA3).
- 17. A method of treating a patient who has a disease associated with expanded CAG repeats, the method comprising administering to the patient the DNA molecule of claim 12.
Priority Claims (1)
Number |
Date |
Country |
Kind |
PCT/US01/26097 |
Aug 2001 |
US |
|
CLAIM OF PRIORITY
[0001] This application claims priority under 35 USC §119(e) to U.S. patent application Ser. No. 60/226,502, filed on Aug. 18, 2000, the entire contents of which are hereby incorporated by reference.
GOVERNMENT SUPPORT
[0002] The work described herein was supported in part by a grant from the National Institutes of Health (PO1-CA42063). The United States government may, therefore, have certain rights in the invention.
Provisional Applications (1)
|
Number |
Date |
Country |
|
60226502 |
Aug 2000 |
US |