INVERTED TRANSPORTER POLYPEPTIDES AND METHODS OF USING

Information

  • Patent Application
  • 20210246185
  • Publication Number
    20210246185
  • Date Filed
    June 04, 2019
    6 years ago
  • Date Published
    August 12, 2021
    4 years ago
Abstract
This document provides methods and materials for modulating one or more properties of transporter proteins. For example, inverted transporter polypeptides including a leader sequence fused to a transporter protein, and methods of using one or more inverted transporter polypeptides to modulate (e.g., stimulate or inhibit) the excitability of one or more cells (e.g., neurons and myocytes) are provided.
Description
BACKGROUND
1. Technical Field

This document relates to methods and materials for modulating one or more properties of transporter proteins. For example, this document provides inverted transporter polypeptides including a leader sequence fused to a transporter protein. In some cases, one or more inverted transporter polypeptides can be used to alter (e.g., stimulate or inhibit) the excitability of one or more cells (e.g., neurons and myocytes).


2. Background Information

Transporters are distinguished by intramolecular ion coordination and conformational changes that restrict and permit, in sequence, access to internal and external compartments. Rhodopsin family members that appear to behave like transporters have properties of both transporters and channels, reflecting a proposed functional continuum (Gadsby, 2009 Nature reviews Molecular cell biology 10:344-352): their currents show strong dependence on electrochemical gradients, but the flux is markedly lower than that of channels.


SUMMARY

This document provides methods and materials for modulating one or more properties of transporter proteins. For example, this document provides inverted transporter proteins including a leader sequence fused to a transporter protein. For example, this document also provides methods for altering (e.g., stimulating or inhibiting) the excitability of one or more cells (e.g., neurons and myocytes). In some cases, one or more inverted transporter proteins (e.g., in the plasma membrane of a cell) can be used to inhibit excitability of one or more neurons and/or to inhibit excitability of one or more myocytes.


As demonstrated herein, a light-gated inhibitor of neural activity, FLInChR, was generated by topological inversion of a Channelrhodopsin (ChR). FLInChR (Full Length Inversion of ChR)—a fusion between the transmembrane domain of Neurexin 1B and a E123T/T159C variant of ChR 2—displays efficient membrane targeting and responds to light with robust outward current. In brain slices, FLInChR sustained suppression of action potential generation for prolonged periods, and displayed enough precision for the “deletion” of individual action potentials in high frequency trains. Also demonstrated herein, topological inversion CsChrimson, a cation channel displayed markedly greater selectivity for K+ over Na+.


Having the ability to modify membrane topology (e.g., by topological inversion of transporter proteins) provides a unique and unrealized opportunity to enable targeted manipulation of activity in specific populations of cells (e.g., neurons). Targeted manipulation can be used to alter (e.g., stimulate or inhibit) the excitability of one or more cells (e.g., neurons and myocytes) to treat a mammal having a disease or disorder characterized by altered cellular excitability. Targeted manipulation also can be used in neuroscience research to investigate the neural basis of behavior by, for example, using membrane topology to evaluate, for example, structure-function studies of permeation in transporter proteins.


In general, one aspect of this document features inverted transporter polypeptides. An inverted transporter polypeptide can include a leader sequence and a transporter protein. The transporter protein can include an extracellular N-terminus and can present the extracellular N-terminus on the intracellular side of a cell membrane. The inverted transporter polypeptide can inhibit the excitability of one or more cells. The one or more cells can include one or more neurons. The one or more cells can include one or more myocytes. The leader sequence can include a transmembrane domain of an integral membrane protein. The integral membrane protein can be Neurexin 1B, synaptobrevin, or a Drosophila olfactory receptor. The transporter protein can include a light-gated ion channel. The transporter protein can include a light-sensitive receptor protein. The light-sensitive receptor protein can be a rhodopsin. The rhodopsin can be a channelrhodopsin, an archaerhodopsin, or a halorhodopsin. An inverted transporter polypeptide can have a leader sequence including a transmembrane domain of Neurexin 1B and a transporter protein including a channelrhodopsin. An inverted transporter polypeptide can have a leader sequence including a transmembrane domain of synpatobrevin and a transporter protein including a channelrhodopsin. The channelrhodopsin can include a substitution of the glutamic acid at residue 123 with a threonine (E123T). The channelrhodopsin can include a substitution of the threonine at residue 159 with a cysteine (T159C). The channelrhodopsin can include both a E123T substitution and a T159C substitution. The inverted transporter polypeptide can include the sequence set forth in SEQ ID NO:5. The inverted transporter polypeptide can include the sequence set forth in SEQ ID NO:6. The inverted transporter polypeptide can include the sequence set forth in SEQ ID NO:7.


In another aspect, this document features a nucleic acid encoding any one of the inverted transporter polypeptides described herein. A nucleic acid encoding an inverted transporter polypeptide can include a nucleic acid encoding a leader sequence. The nucleic acid can be a viral vector (e.g., an adenoviral vector).


In another aspect, this document features a method for inverting a transporter protein in a cell. The methods can include, or consist essentially of, expressing a nucleic acid encoding a leader sequence conjugated to a nucleic acid encoding a transporter protein in a cell such that the nucleic acid expresses an inverted transporter polypeptide. The nucleic acid can be a viral vector (e.g., an adenoviral vector).


In another aspect, this document features a method for altering the excitability of a cell. The methods can include, or consist essentially of, administering nucleic acid encoding a leader sequence conjugated to a nucleic acid encoding a transporter protein to a cell, such that the nucleic acid expresses an inverted transporter polypeptide where the inverted transporter polypeptide can regulate the excitability of the cell. The nucleic acid can be a viral vector (e.g., an adenoviral vector). The altering can include inhibiting the excitability of a cell. The cell can be a neuron. The cell can be a myocyte. The regulation can be photoinhibition.


In another aspect, this document features a method for treating a mammal having a disease or disorder characterized by altered cellular excitability. The methods can include, or consist essentially of, administering an inverted transporter polypeptide to a mammal. The mammal can be a human. The administering can include administering a nucleic acid encoding a leader sequence conjugated a nucleic acid encoding a transporter protein, where the nucleic acid expresses an inverted transporter polypeptide. The nucleic acid can be a viral vector (e.g., an adenoviral vector). The altering can include inhibiting the excitability of a cell. The cell can be a neuron. The cell can be a myocyte. The regulation can be photoinhibition.


Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Although methods and materials similar or equivalent to those described herein can be used to practice the invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.


The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the description and drawings, and from the claims.





DESCRIPTION OF THE DRAWINGS


FIG. 1. A molecular engineering approach to topological inversion of rhodopsins. A, Schematic of the approach. Nx1B-TM denotes transmembrane domain of Neurexin 1B, ++ denotes positively charged furin cleavage site. B, Immunocytochemical evaluation of the location of the N-terminal-myc epitope tag. Top: schematic of the approach. Bottom: Background-subtracted, bead fluorescence-normalized fluorescence intensity of regions of interest manually drawn over cell bodies. 1° Ab: primary anti-myc antibody. C, Proteinase-K-based evaluation of the location of the C-terminal-mVenus domain in primary neuronal cultures. Top: Schematic of the approach. Scissors depict action of extracellularly-added Proteinase K. Bottom left: Time-lapse live-cell imaging of four individual experiments. Scale bar: 1 μm. Bottom right: Background-subtracted change in fluorescence at the end of the assay (normalized to the starting fluorescence) for native ChR ET/TC (n=59), inverted ChR ET/TC (n=47), inverted CsChrimson (n=7) and inverted ArchT (n=6). D, Proteinase K-based evaluation of the location of the C-terminal mVenus domain for the fusion of Drosophila melanogaster OR 59D.1 gene N-terminal leader sequence and ChR ET/TC (n=42). Top: Schematic of the approach. Bottom: Background-subtracted change in fluorescence at the end of the assay. Error bars represent standard error of the mean.



FIG. 2. Inverted ChR ET/TC displays robust intracellular trafficking. A, Image of a coronal rat brain slice with neurons in the cingulate cortex that project to supplementary motor cortex expressing Nx1B-ChR fusion. Note the evident fiber tracts suggestive of robust axonal trafficking. B, A maximum projection for a confocal image of rat layer V neuron expressing FLInChR with concentric circles at increasing radii describing the analysis of FLInChR expression as a function of distance from the soma center. C, Fluorescence intensity normalized to peak intensity along the circumference of concentric circles relative to the center of the soma. Only pixels from intersections of these circumferences and the segmented neuron are used. The red line represents the median fluorescence, blue boxes mark the 25th and 75th percentiles, whiskers represent the extreme data points and, + represent outliers. Note that despite a modest increase in the median fluorescence at the soma, the dendritic expression remains consistent throughout the neuron.



FIG. 3. Inversion is robust to the choice of N terminal linker domain. Proteinase-K-based evaluation of the location of the C-terminal-mVenus domain in primary neuronal cultures for FLInChR(Nx) (as in FIG. 1) and FLInChR(Syb) (n=16).



FIG. 4. Opsin inversion generates novel functionality. A, Action spectrum of native and inverted CsChrimson in hippocampal neuronal cultures. B, Current-voltage relationship for native (n=5) and inverted (n=5) CsChrimson. Note a shift of the reversal potential towards the reversal potential for potassium. C, Current amplitude as a function of holding potential in three different internal solutions for inverted Channelrhodopsin 2 ET/TC. Note the lack of current reversal. D, Action spectrum for native (n=4) and inverted (n=4) Channelrhodopsin 2 ET/TC and FLInChR. E, Amplitude of light-evoked current amplitude in physiological conditions and following wholesale replacement of external ions by sucrose. F, Current amplitude during bidirectional manipulation of internal pH (n=5, see Methods). E, Amplitude of light-evoked current following ion substitutions. Error bars represent standard error of the mean. *, p<0.05, one-way ANOVA with post-hoc Tukey's test. All currents were characterized in response to 2 ms light pulses (widefield illumination, 10 mW/mm2 at the focal plane of the objective).



FIG. 5. Opsin inversion is compatible with regular ionic flux. A, Left: Schematic of the experimental preparation. Brain slices were prepared from GAD2-IRES-Cre mice that had been previously injected into substantia nigra with AAV2/1 CAG FLEX FLInChR-mVenus or AAV2/1 CAG FLEX ArchT-mVenus. Right: representative differential interference contrast (DIC) and fluorescence images of FLInChR-expressing slices. B-D, Left two panels: Representative whole cell currents observed in SNr cells expressing either FLInChR(Nx) (B), FLInChR(Syb) (C) or ArchT (D) held at −70 mV in response to a 1 ms light pulse (10 mW/mm2 at the focal point of the objective) at 470 nm and 590 nm. Right two panels: Photocurrent amplitude as a function of light power at the objective (n=4 cells each). Light shading represents standard error of the mean. E-G, Top: Response latencies across cells for the two wavelengths. Bottom: Decay constants for light-induced currents (n=4 cells each). Error bars represent standard error of the mean.



FIG. 6. FLInChR mediates efficient suppression of spiking. A, Example responses of a FLInChRexpressing SNr cell to step current injections with and without 470 nm light (10 mW/mm2 at the focal point of the objective). Top: overlaid voltage traces. Bottom: raster plots of spiking activity. B, Population average of firing rates in response to injected current with (black) and without (blue) light exposure. C, Spiking activity of an example cell in the presence of progressively longer illumination at 470 nm.



FIG. 7. FLInChR mediates efficient suppression of spiking in cortical neurons. A, Responses of a FLInChR-expressing layer 4 stellate cell to step current injections with and without 470 nm light. Top: overlaid voltage traces. Bottom: raster plots of spiking activity. B, Left panel: Firing rate in response to injected current of different amplitude with (black) and without (blue) light exposure. Right panel: Percent inhibition for different levels of injected current.



FIG. 8. FLInChR-mediated photocurrent shows moderate desensitization. Voltage clump recordings from FLInChR-expressing SNr neurons (n=4) with long light pulses. Note only moderate decay of photocurrent after the initial 100 ms. Light shading represents standard error of the mean.



FIG. 9. FLInChR is an effective light-dependent inhibitor for circuit dissection. A, Experimental paradigm used to evaluate the efficacy of FLInChR in awake behaving animals. Head-fixed mice were trained to manipulate a joystick, with responses above a certain threshold preferentially rewarded. Effect of FLInChR-based perturbation of neural ensemble activity in SNr on response vigor was then assessed. Selective expression of FLInChR in the GABA-ergic cells of the SNr was achieved through stereotaxic delivery of AVV2/1 FLEX-FLInChR in GAD2-IRES-Cre mice. B, Schematic of the experimental protocol. Trial start (green diamond) was un-cued. Reaches had to pass variable threshold (gray diamond) for a delayed water reward (blue square). Reaches were extracted using both the Euclidean displacement and the velocity of the joystick. Light (473 nm, 1-5 mW at the fiber tip) was delivered on the first reach of approximately 20% of trials. C, Instantaneous velocity and trajectory in space for an example reach before (light gray), during (blue) and after (dark gray) light delivery. D, Duration of ‘stimulated’ reaches as a function of the fraction of reach completed at the time of light onset (n=627 reaches in 6 animals). E, Cumulative distribution of durations for ‘stimulated’ (n=25) and ‘unstimulated’ (n=94) reaches during one session. F, Mean reach durations for ‘stimulated’ reaches than for ‘unstimulated’ reaches across 23 sessions in 6 animals. *, p<0.01, paired t-test. G, Distribution of reach durations for all 627 ‘stimulated’ and 2254 ‘unstimulated’ reaches. White dot indicates distribution median, black-distribution mean. *, p<0.01, Mann-Whitney test. H, Schematic of the experiment aimed to optogenetically tag projection neurons in behaving mice and rats. I, Top two panels: Activity in an example rat cortico-striatal neuron for 800 repeated light presentations. Light power was 2 mW at the fiber tip. Bottom panel: Distribution of latencies for light-dependent suppression of spiking across neurons. J. Repeated photoinhibition in an example juxta-cellular recording from a mouse layer 5 projection neuron. Note efficient suppression of spiking throughout the duration of illumination. K, Activity in three example mouse projection neurons for 60 repeated light presentations. L, Distribution of light-dependent modulation effects across cortical layers. Notice that robust short-latency inhibition is confined to layer 5.



FIG. 10. FLInChR-mediated hyperpolarization of body wall muscles induces body elongations in C. elegans. Mean normalized body length (±SEM) relative to the initial length in animals expressing FLInChR in body-wall muscles. Left panel: time course of muscle elongation. Right panel: average percent change in body length over a 5 second window before and after onset of illumination.





DETAILED DESCRIPTION

This document relates to methods and materials for modulating one or more properties of one or more transporter proteins. For example, this document provides inverted transporter polypeptides, nucleic acids encoding inverted transporter polypeptides, and methods for inverting transporter polypeptides (e.g., in the plasma membrane of a cell). In some cases, inverted transporter polypeptides can include a leader sequence fused to a transporter protein (e.g., a transporter protein having an extracellular N-terminus). As used herein, an “inverted” transporter polypeptide is any transporter polypeptide where fusion to a leader sequence described herein results in the inversion of the full-length transporter protein or a portion (e.g., a terminus, a helix, or a loop) of the transporter protein within the plasma membrane of a cell. For example, inverted transporter polypeptides provided herein can include a leader sequence and a transporter protein having an extracellular N-terminus (e.g., in the non-inverted (e.g., endogenous) conformation of the transporter protein), and can be an inverted such that the extracellular N-terminus of the transporter protein is presented on the intracellular side of a cell membrane. As described herein, inverted transporter polypeptides provided herein can have one or more properties of the transporter protein modulated (e.g., enhanced, inhibited, shifted, or reversed) relative to a transporter protein that is not inverted. Also provided herein are methods of using inverted transporter polypeptides provided herein. For example, one or more inverted transporter polypeptides provided herein can be used to alter (e.g., stimulate or inhibit) the excitability of one or more cells (e.g., neurons and myocytes). In some cases, the excitability of one or more cells can be altered by modulating (e.g., enhancing, inhibiting, shifting, or reversing) one or more properties of the transporter protein (e.g., relative to a transporter protein that is not inverted). For example, one or more inverted transporter polypeptides can be used to inhibit excitability of one or more neurons (e.g., one or more neurons within a mammal). In some cases, the excitability of one or more cells can be altered by modulating (e.g., enhancing, inhibiting, shifting, or reversing) one or more properties of the transporter protein (e.g., relative to a transporter protein that is not inverted) as described herein.


Inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein) can include any appropriate transporter protein. A transporter protein can be synthetic (e.g., recombinant) or naturally occurring. A transporter protein can be a full-length transporter protein or a fragment of a transporter protein. In some cases, a transporter protein can be a gated-transporter protein (e.g., a light-gated transporter protein such as a light-gated ion channel, a voltage-gated transporter protein such as a voltage-gated ion channel (VIC), and a ligand-gated transporter protein such as a ligand-gated ion channels (LGICs)). In some cases, a transporter protein can be a light-sensitive protein. In some cases, a transporter protein can be a receptor protein. In some cases, a transporter protein can be both a light-sensitive protein and a receptor protein. For example, a transporter protein can be a light-sensitive receptor protein (e.g., a light-sensitive receptor protein involved in visual phototransduction). In some cases, a transporter protein can be a seven-transmembrane protein. In some cases, a transporter protein can be a pump. In some cases, a transporter protein can be a channel. In some cases, a transporter protein can be both a pump and a channel. In some cases, a transporter protein can be a G-protein-coupled receptor (GPCR) protein. In some cases, a transporter protein can be a pigment (e.g., a biological pigment) protein. In some cases, a transporter protein can have an extracellular N-terminus. Examples of transporter proteins that can be included in an inverted transporter polypeptide described herein can include, without limitation, rhodopsins (e.g., channelrhodopsins (ChR) such as ChR1 and ChR2, archaerhodopsin (ArchT), halorhodopsin, Chrimson, and Chronos).


In some cases, an inverted transporter polypeptide described herein can include a ChR protein. Exemplary ChR polypeptides (and nucleotides encoding exemplary ChR polypeptides) can be as set forth in the National Center for Biotechnology Information (NCBI) sequence databases at, for example, Accession No. 6EID_A, and Accession No. 6EID_B. A representative ChR polypeptide sequence is as follows.









SEQ ID NO: 1


MDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNGAQT





ASNVLQWLAAGFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEFFF





EFKNPSMLYLATGHRVQWLRYAEWLLTCPVILIHLSNLTGLSNDYSRRTM





GLLVSDIGTIVWGATSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIEGY





HTVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHT





IIDLMSKNCWGLLGHYLRVLIHEHILIHGDIRKTTKLNIGGTEIEVETLV





EDEAEAGAV






In some cases, an inverted transporter polypeptide described herein can include a Chrimson protein. Exemplary Chrimson polypeptides (and nucleotides encoding exemplary Chrimson polypeptides) can be as set forth in the NCBI sequence databases at, for example, Accession No. AHH02126.1 (e.g., Version AHH02126.1), and Accession No. AIE89247 (e.g., Version AIE89247.2). A representative Chrimson polypeptide sequence is as follows









SEQ ID NO: 2


MSRLVAASWLLALLLCGITSTTTASSAPAASSTDGTAAAAVSHYAMNGFD





ELAKGAVVPEDHFVCGPADKCYCSAWLHSRGTPGEKIGAQVCQWIAFSIA





IALLTFYGFSAWKATCGWEEVYVCCVEVLFVTLEIFKEFSSPATVYLSTG





NHAYCLRYFEWLLSCPVILIKLSNLSGLKNDYSKRTMGLIVSCVGMIVFG





MAAGLATDWLKWLLYIVSCIYGGYMYFQAAKCYVEANHSVPKGHCRMVVK





LMAYAYFASWGSYPILWAVGPEGLLKLSPYANSIGHSICDIIAKEFWTFL





AHHLRIKIHEHILIHGDIRKTTKMEIGGEEVEVEEFVEEEDEDTV






In some cases, an inverted transporter polypeptide described herein can include a variant of a transporter protein described herein. The term “variant” as used herein refers to an amino acid sequence that is at least 85 percent (e.g., at least 85, 90, 95, 99, or 100 percent) identical to the wild type sequence, provided that the variant maintains the features (e.g., the function and any secondary, tertiary, and/or quaternary structure(s)) of the wild type protein. In some cases, a variant polypeptide can have at least 6 (e.g., 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more) amino acid residues modified (e.g., substituted) relative to the wild type sequence, provided that the variant maintains the features (e.g., the function and any secondary, tertiary, and/or quaternary structure(s)) of the wild type protein. For example, a variant ChR2 polypeptide can include any sequence that is at least 85 percent (e.g., at least 85, 90, 95, 99, or 100 percent) identical to the sequence set forth in SEQ ID NO:1. In some cases, a variant ChR2 polypeptide can include a substitution of the glutamic acid (E) at residue 123 (e.g., residue 123 as shown in SEQ ID NO:1) with a threonine (T) (e.g., a E123T substitution). In some cases, a variant ChR2 polypeptide can include a substitution of the T at residue 159 (e.g., residue 159 as shown in SEQ ID NO:1) with a cysteine (C) (e.g., a T159C substitution). In some cases, a variant ChR2 polypeptide can include both a E123T substitution and a T159C substitution.


Inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein) can include a transporter protein obtained from any appropriate source. In some cases, a transporter protein can be a microbial transporter protein. In some cases, a transporter protein can be a mammalian transporter protein. Examples of sources from which transporter proteins can be obtained include, without limitation, green algae (e.g., chlamydomonas), fungi, plants, and metazoan. For example, a transporter protein (e.g., ChR2) can be obtained from chlamydomonas (e.g., Chlamydomonas reinhardtii).


Inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein) can include any appropriate leader sequence. In some cases, a leader sequence can be a polypeptide sequence. In some cases, a leader sequence can include a transmembrane domain. In some cases, a leader sequence can include a signal sequence. In some cases, a leader sequence can be obtained from an integral membrane protein (e.g., a type-I integral membrane protein). Examples of leader sequences that can be included in an inverted transporter polypeptide described herein include, without limitation, a Neurexin 1B transmembrane domain, a synaptobrevin transmembrane domain, and a Drosophila olfactory receptor transmembrane domain. Examples of leader sequences include, without limitation, the following amino acid sequences.









SEQ ID NO: 3


MYQRMLRCGAELGSPGGGSSGGAGGRLALLWIVPLTLSGLLGVAWGASSL





GAHHIHHKLEQKLISEEDLGGLANPTRVGGREPYPGSAEVIRESSSTTGM





VVGIVAAAALCILILLYAMKKRRAKGGSGGSGGLEHGTIPFNRTHRSKRS





SG





SEQ ID NO: 4


MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNV





DKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILG





VICAIILIIIIVYFSTGGSGGSRGVQVETISPGDGRTFPKRGQTCVVHYT





GMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTIS





PDYAYGATGHPGIIPPHATLVFDVELLKLETRGVQVETISPGDGRTFPKR





GQTCVVHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSV





GQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLESAEQKISEEDK





EQKISEEDKGTSARNRQKRASGTEGRGSLLTCGDVEENPGPSG






Inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein) can include a leader sequence obtained from any appropriate source.


In some cases, inverted transporter polypeptides described herein can include a Neurexin 1B transmembrane domain leader sequence and a ChR transporter protein. A representative inverted transporter polypeptide including a Neurexin 1B leader sequence and ChR transporter protein is as follows.









SEQ ID NO: 5


MYQRMLRCGAELGSPGGGSSGGAGGRLALLWIVPLTLSGLLGVAWGASSL





GAHHIHHKLEQKLISEEDLGGLANPTRVGGREPYPGSAEVIRESSSTTGM





VVGIVAAAALCILILLYAMKKRRAKGGSGGSGGLEHGTIPFNRTHRSKRS





SGMDYGGALSAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNGA





QTASNVLQWLAAGFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEF





FFEFKNPSMLYLATGHRVQWLRYATWLLTCPVILIHLSNLTGLSNDYSRR





TMGLLVSDIGCIVWGATSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIE





GYHTVPKGRCRQVVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVG





HTIIDLMSKNCWGLLGHYLRVLIHEHILIHGDIRKTTKLNIGGTEIEVET





LVEDEAEAGAVPGGSGGTGVSKGEELFTGVVPILVELDGDVNGHKFSVSG





EGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQH





DFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFK





EDGNILGHKLEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADH





YQQNTPIGDGPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITL





GMDELYK






In some cases, inverted transporter polypeptides described herein can include a synaptobrevin transmembrane domain leader sequence and a ChR transporter protein. A representative inverted transporter polypeptide including a synaptobrevin leader sequence and a ChR transporter protein is as follows.









SEQ ID NO: 6


MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNV





DKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILG





VICAIILIIIIVYFSTGGSGGSRGVQVETISPGDGRTFPKRGQTCVVHYT





GMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTIS





PDYAYGATGHPGIIPPHATLVFDVELLKLETRGVQVETISPGDGRTFPKR





GQTCVVHYTGMLEDGKKVDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSV





GQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLESAEQKISEEDK





EQKISEEDKGTSARNRQKRASGTEGRGSLLTCGDVEENPGPSGMDYGGAL





SAVGRELLFVTNPVVVNGSVLVPEDQCYCAGWIESRGTNGAQTASNVLQW





LAAGFSILLLMFYAYQTWKSTCGWEEIYVCAIEMVKVILEFFFEFKNPSM





LYLATGHRVQWLRYATWLLTCPVILIHLSNLTGLSNDYSRRTMGLLVSDI





GCIVWGATSAMATGYVKVIFFCLGLCYGANTFFHAAKAYIEGYHTVPKGR





CRQVVTGMAWLFFVSWGMFPILFILGPEGFGVLSVYGSTVGHTIIDLMSK





NCWGLLGHYLRVLIHEHILIHGDIRKTTKLNIGGTEIEVETLVEDEAEAG





AVPGGSGGTGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYG





KLTLKLICTTGKLPVPWPTLVTTLGYGLQCFARYPDHMKQHDFFKSAMPE





GYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHK





LEYNYNSHNVYITADKQKNGIKANFKIRHNIEDGGVQLADHYQQNTPIGD





GPVLLPDNHYLSYQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK






In some cases, inverted transporter polypeptides described herein can include a Neurexin 1B transmembrane domain leader sequence and a Chrimson transporter protein. A representative inverted transporter polypeptide including a Neurexin 1B leader sequence and Chrimson transporter protein is as follows.









SEQ ID NO: 7


MYQRMLRCGAELGSPGGGSSGGAGGRLALLWIVPLTLSGLLGVAWGASSL





GAHHIHHKLEQKLISEEDLGGLANPTRVGGREPYPGSAEVIRESSSTTGM





VVGIVAAAALCILILLYAMKKRRAKGGSGGSGGLEHGTIPFNRTHRSKRS





SGMSRLVAASWLLALLLCGITSTTTASSAPAASSTDGTAAAAVSHYAMNG





FDELAKGAVVPEDHFVCGPADKCYCSAWLHSRGTPGEKIGAQVCQWIAFS





IAIALLTFYGFSAWKATCGWEEVYVCCVEVLFVTLEIFKEFSSPATVYLS





TGNHAYCLRYFEWLLSCPVILIKLSNLSGLKNDYSKRTMGLIVSCVGMIV





FGMAAGLATDWLKWLLYIVSCIYGGYMYFQAAKCYVEANHSVPKGHCRMV





VKLMAYAYFASWGSYPILWAVGPEGLLKLSPYANSIGHSICDIIAKEFWT





FLAHHLRIKIHEHILIHGDIRKTTKMEIGGEEVEVEEFVEEEDEDTVGGS





GGSKSRITSEGEYIPLDQIDINGGSGGTGVSKGEELFTGVVPILVELDGD





VNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCF





SRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVN





RIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNI





EDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLL





EFVTAAGITLGMDELYKFCYENEV






In some cases, inverted transporter polypeptides described herein also can include one or more additional components. In some cases, an inverted transporter polypeptide also can include a label (e.g., a detectable label). Examples of detectable labels include, without limitation, polypeptide tags (e.g., a myc tag, a histidine tag, and a FLAG tag), and fluorescent tags (e.g., green fluorescent protein (GFP), yellow fluorescent protein (YFP), blue fluorescent protein (BFP), and cyan fluorescent protein (CFP)).


Also provided herein are nucleic acids (e.g., nucleic acid constructs) encoding inverted transporter polypeptides described herein. A nucleic acid encoding an inverted transporter polypeptide described herein can include any appropriate type of nucleic acid. Examples of nucleic acids include, without limitation, DNA, RNA, and hybrids thereof. A nucleic acid can be single stranded, double stranded, or a combination there (e.g., having one or more portions of the nucleic acid that are single stranded and having one or more portions of the nucleic acid that are double stranded).


A nucleic acid construct can be any appropriate construct. In some cases, a nucleic acid construct can be an expression construct. Examples of nucleic acid constructs include, without limitation, plasmids and viral vectors. In some cases, a nucleic acid construct encoding an inverted transporter polypeptide can be a viral vector (e.g., an adeno associated virus (AAV, such as AAV1 or AAV2) vector, a retroviral vector, and a lentiviral vector). For example, a nucleic acid construct encoding an inverted transporter polypeptide can be an AAV vector.


In some cases, nucleic acids (e.g., nucleic acid constructs) encoding inverted transporter polypeptides described herein also can include one or more additional components. In some cases, an inverted transporter polypeptide also can include one or more regulatory elements. Examples of regulatory elements include, without limitation, promoters (e.g., CAG), enhancers, nucleic acids encoding a label (e.g., a detectable label), one or more loxP sites, and one or more FRT sites. For example, a nucleic acid construct encoding an inverted transporter polypeptide also can include a CAG promoter to drive expression of the nucleic acid encoding an inverted transporter polypeptide.


Inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein) can have one or more modulated (e.g., enhanced, inhibited, shifted, or reversed) properties of the transporter protein (e.g., relative to a transporter protein that is not inverted). The transporter protein property can be any appropriate property of the transporter protein. Examples of properties of transporter proteins include, without limitation, the transporter regulation (e.g., the stimulus/stimuli regulating transport and/or the sensitivity to stimulus/stimuli regulating transport), the transporter function (e.g., the molecule(s) being transported, the selectivity of the molecule(s) being transported, and/or the direction of transport), and the transporter conduction mechanism.


In some cases, inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein) can modulate (e.g., enhance, inhibit, shift, or reverse) the regulation (e.g., gating) of the transporter (e.g., the stimulus/stimuli regulating transport and/or the sensitivity to stimulus/stimuli regulating transport) relative to a transporter protein that is not inverted. Inverted transporter polypeptides described herein can modulate any appropriate type of transporter gating. Examples of stimuli that can regulate transporter gating include, without limitation, light, electromagnetic radiation, voltage, ligands, and temperature. In some cases, the activity of an inverted transporter polypeptides having modulated regulation can be controlled (e.g., by providing or withholding a stimulus). For example, the activity of an inverted transporter polypeptide (e.g., containing a Neurexin 1B transmembrane domain leader sequence and a ChR transporter protein) can be inhibited in the presence of light (e.g., photoinhibition).


In some cases, inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein) can modulate (e.g., enhance, inhibit, shift, or reverse) the function of the transporter (e.g., the molecule(s) being transported, the selectivity of the molecule(s) being transported, and/or the direction of transport) relative to a transporter protein that is not inverted. Inverted transporter polypeptides described herein can modulate transport of any appropriate molecule. Examples of molecules that can be transported by a transporter protein include, without limitation, ions (e.g., sodium (Na+), potassium (K+), calcium (Ca2+), chloride (Cl), HCO3− (bicorabonate), and tetraethylammonium (TEA+)), gases (e.g., CO2, N2, O2), uncharged polar molecules (e.g., urea, water, ethanol, glucose, and fructose), and charged polar molecules (e.g., ATP, amino acids, and glucose-6-phosphate). In some cases, an inverted transporter polypeptide can have increased ion permeability. An inverted transporter polypeptide can have any appropriate level of increased ion permeability. For example, an inverted transporter polypeptide (e.g., containing a Neurexin 1B transmembrane domain leader sequence and a Chrimson transporter protein) can have increased K+ ion permeability (e.g., about 7-8 fold increased K+ permeability). For example, an inverted transporter polypeptide (e.g., containing a Neurexin 1B transmembrane domain leader sequence and a Chrimson transporter protein) can have selectivity for K+ ions over Na+ ions.


Also provided herein are methods of inverting transporter proteins (e.g., containing a leader sequence and a transporter protein). For example, a leader sequence described herein can be conjugated (e.g., fused) to a transporter protein described herein to produce inverted transporter polypeptides described herein. For example, nucleic acid encoding a leader sequence described herein can be conjugated (e.g., fused) to a nucleic acid encoding a transporter protein described herein, and the conjugated nucleic acid can be expressed in a cell to produce inverted transporter polypeptides described herein. In some cases, a transporter protein containing an extracellular N-terminus can be inverted by fusing a Neurexin 1B transmembrane domain leader sequence to the transporter protein. In some cases, a transporter protein containing an extracellular N-terminus can be inverted by fusing a synaptobrevin transmembrane domain leader sequence to the transporter protein. In some cases, a transporter protein containing an extracellular N-terminus can be inverted by fusing a Drosophila olfactory receptor transmembrane domain leader sequence to the transporter protein.


In some cases, methods of inverting transporter proteins can produce inverted transporter polypeptides having one or more properties of the transporter protein modulated (e.g., enhanced, inhibited, shifted, or reversed) as described herein (e.g., relative to a transporter protein that is not inverted). For example, a rhodopsin transporter protein (e.g., ChR2) can be inverted as described herein to produce an inverted rhodopsin that can be regulated with light.


Also provided herein are methods of using inverted transporter polypeptides provided herein (e.g., containing a leader sequence and a transporter protein). For example, one or more inverted transporter polypeptides provided herein (e.g., in the plasma membrane of a cell) can be used to alter (e.g., stimulate or inhibit) the excitability of one or more cells (e.g., neurons and myocytes). In some cases, the excitability of one or more cells can be altered by modulating (e.g., enhancing, inhibiting, shifting, or reversing) one or more properties of the transporter protein (e.g., relative to a transporter protein that is not inverted) as described herein. For example, one or more inverted transporter polypeptides can be used to inhibit excitability of one or more neurons (e.g., one or more neurons within a mammal). In cases where an inverted transporter polypeptide includes a gated-transporter protein, the activity of the inverted transporter polypeptide can be controlled (e.g., by providing or withholding the stimulus). For example, the activity of an inverted transporter polypeptide including a gated-transporter protein can be controlled in temporal and/or spatial manner.


Inverted transporter polypeptides provided herein (e.g., containing a leader sequence and a transporter protein) can be used to treat any appropriate disease or disorder characterized by altered cellular excitability. In some cases, a disease or disorder characterized by altered cellular excitability can include altered excitability of one or more neurons. For example, one or more inverted transporter polypeptides can be used to inhibit excitability of one or more neurons in a mammal having a disease or disorder characterized by altered cellular excitability can include altered excitability of one or more neurons to treat the mammal. In some cases, a disease or disorder characterized by altered cellular excitability can include altered excitability of one or more myocytes. For example, one or more inverted transporter polypeptides can be used to inhibit excitability of one or more myocytes in a mammal having a disease or disorder characterized by altered cellular excitability can include altered excitability of one or more myocytes to treat the mammal.


Inverted transporter polypeptides provided herein (e.g., containing a leader sequence and a transporter protein), or nucleic acids encoding one or more inverted transporter polypeptides described herein, can be used to treat any appropriate type of mammal (e.g., a mammal having or at risk for developing a disease or disorder characterized by altered cellular excitability). Examples of mammals that can be treated with one or more inverted transporter polypeptides described herein include, without limitation, humans, non-human primates (e.g., monkeys), dogs, cats, horses, cows, pigs, sheep, rabbits, mice, and rats. For example, humans having or at risk of developing a disease or disorder characterized by altered cellular excitability can be treated with one or more inverted transporter polypeptides or nucleic acids encoding one or more inverted transporter polypeptides as described herein.


In some cases, the methods provided herein can include identifying a mammal as having or at risk for developing a disease or disorder characterized by altered cellular excitability. Any appropriate method can be used to identify a mammal having or at risk for developing a disease or disorder characterized by altered cellular excitability.


A mammal identified as having or at risk for developing a disease or disorder characterized by altered cellular excitability can be administered or instructed to self-administer one or more (e.g., one, two, three, four, five, or more) inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein). In some cases, a mammal identified as having or at risk for developing a disease or disorder characterized by altered cellular excitability can be administered or instructed to self-administer one or more one or more nucleic acids encoding one or more inverted transporter polypeptides described herein.


Inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein), or nucleic acid encoding one or more inverted transporter polypeptides described herein, can be used to alter the excitability of any type of cell in a mammal. Examples of excitable cells include, without limitation, neurons (e.g., sensory neurons and motor neurons), myocytes (e.g., cardiac cells, skeletal cells, and smooth muscle cells), and endocrine cells (e.g., insulin-releasing pancreatic β cells). In cases where the cell is a neuron, the neuron can be in the substantia nigra (e.g., in the pars reticulata of the substantia nigra). In some cases, the cell can be an excitable cell. In cases where the cell is a neuron, the neuron can be an excitatory neuron (e.g., neurons that release glutamate) or the neuron can be an inhibitory neuron (e.g., neurons that release GABA). A cell can be in vivo or ex vivo.


Inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein), or nucleic acid encoding one or more inverted transporter polypeptides described herein, can be formulated into a composition (e.g., a pharmaceutically acceptable composition) for administration to a mammal (e.g., a mammal having or at risk for developing a disease or disorder characterized by altered cellular excitability). For example, a therapeutically effective amount of one or more inverted transporter polypeptides described herein a therapeutically effective amount of nucleic acid encoding one or more inverted transporter polypeptides described herein can be formulated together with one or more pharmaceutically acceptable carriers (additives) and/or diluents. A pharmaceutical composition can be formulated for administration in solid or liquid form including, without limitation, sterile solutions, suspensions, sustained-release formulations, tablets, capsules, pills, powders, and granules.


Inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein), or nucleic acid encoding one or more inverted transporter polypeptides described herein, can be administered by any appropriate method. For example, a composition (e.g., a pharmaceutically acceptable composition) including one or more inverted transporter polypeptides described herein or nucleic acid encoding one or more inverted transporter polypeptides described herein, can be administered by any appropriate method. Inverted transporter polypeptides described herein, or nucleic acid encoding one or more inverted transporter polypeptides described herein, can be administered locally or systemically. Inverted transporter polypeptides described herein, or nucleic acid encoding one or more inverted transporter polypeptides described herein, can be administered by oral administration, parenteral administration (e.g., by injection such as intracranial injection, subcutaneous injection, intramuscular injection, intravenous injection, and intradermal injection), or inhaled administration. For example, a composition containing can be administered systemically by an oral administration to or inhalation by a mammal (e.g., a human). When being administered orally, a composition can be in the form of a pill, tablet, or capsule.


Inverted transporter polypeptides described herein (e.g., containing a leader sequence and a transporter protein), or nucleic acid encoding one or more inverted transporter polypeptides described herein, can be administered to a mammal having or at risk for developing a disease or disorder characterized by altered cellular excitability as a combination therapy with one or more additional agents/therapies used to treat a disease or disorder characterized by altered cellular excitability. In cases where one or more inverted transporter polypeptides described herein or nucleic acid encoding one or more inverted transporter polypeptides described herein are used in combination with one or more additional agents/therapies used to treat a disease or disorder characterized by altered cellular excitability, the one or more additional agents/therapies can be administered at the same time or independently. For example, the one or more inverted transporter polypeptides described herein or nucleic acid encoding one or more inverted transporter polypeptides described herein can be administered first, and the one or more additional agents/therapies administered second, or vice versa.


The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.


EXAMPLES
Example 1: Expanding the Optogenetics Toolkit by Topological Inversion of Rhodopsins
Results

To evaluate the potential of topological engineering for generating novel rhodopsin variants, a leader sequence containing the signal sequence and the transmembrane (TM) domain of Neurexin 1B-delta—a type-I integral membrane protein—was designed that could, in principle, impose topological inversion on any membrane protein with an extracellular N-terminus (FIG. 1A). To impart further stability on the orientation of the N-terminal TM domain, a short positively charged peptide was also included into the presumed cytoplasmic portion of the leader sequence. A positively charged peptide was chosen that serves as the recognition sequence for a Golgi-bound protease, furin, because establishing that the fusion protein is protected from furin-mediated cleavage would lend further support for the desired orientation of the leader sequence.


Fusion between the Neurexin (Nx)-based N-terminal domain and ChR2 E123T/T159C—a variant chosen because of its fast kinetics and robust membrane insertion-resulted in a protein that could be easily expressed at high levels, displayed efficient membrane targeting, and trafficked well down axons (FIG. 2). Immunostaining for the N-terminal myc-epitope tag under non-permeabilized conditions, and live-cell GFP florescence imaging in the presence of proteinase K, verified that both N- and C-termini of the fusion protein are in the extracellular space, as predicted for successful topological inversion (FIG. 1B, C). Pairing the Neurexin-based N-terminal domain with either CsChrimson or ArchT was equally effective at achieving inversion (FIG. 1C), as was pairing ChR E123T/T159C with an alternative N-terminal domain that contained the transmembrane domain of Synaptobrevin (Syb) (FIG. 3).


Whether any naturally existing non-canonical orientation of a transmembrane protein may be attributed to its N-terminal domain was explored. Insect odorant receptors—a family of heptahelical proteins that have the opposite membrane orientation compared with their mammalian counterparts, and function as odor-gated ion channels rather than G-protein coupled receptors—were focused on. Strikingly, fusion of the N-terminal leader sequence from the Drosophila OR 59D.1 gene to ChR E123T/T159C also resulted in an inversion (FIG. 1D). This finding lends further credence to the notion that introduction of targeted N-terminal domains through recombination may have contributed during evolution to changes in membrane protein orientation, and possibly to the emergence of new functionalities.


To evaluate the functional consequences of topological inversion, the current evoked by photoactivation of the inverted proteins in cultured hippocampal neurons (transfected at DIV7, evaluated at DIV 14-21) was examined. Flipping the orientation of CsChrimson in the membrane preserved the inward direction of the photocurrent at resting membrane potential and had no significant effect on the current's spectral sensitivity (FIG. 4A). The photocurrent still reversed when the membrane was depolarized (FIG. 4B). However, the reversal potential of the inverted CsChrimson was significantly lower than that of the original opsin (−35.3±5.2 mV, n=5 vs 4.7±2.5 mV, n=5, p<0.0001). Decreasing the extracellular Na+ concentration from 130 mM to 5 mM caused a further leftward shift in the reversal potential (to −62.7±3.6 mV, n=5, p<0.001 vs 130 mM Na+), bringing it closer to the reversal potential for K+. Together, these results indicate that for CsChrimson, topological inversion preserved the opsin's cation channel-like properties but led to a significantly (˜7-8 fold) increased K+ permeability—a sought-after functional change that has eluded other molecular engineering efforts.


Inversion of ChR E123T/T159C led to an even more dramatic change in opsin functionality. Cells expressing inverted ChR E123T/T159C FLInChR variants displayed robust outward currents suggesting that inversion converted this opsin from a potent activator into an inhibitor (FIG. 4C). Comparison of current amplitudes elicited by photostimulation at varying wavelengths revealed that the spectral response of FLInChR photocurrents was red-shifted with respect to its ‘topological isomer’, peaking around 560 nm (FIG. 4D). FLInChR photocurrents were outward at all tested membrane potentials and exhibited a very weak voltage dependence regardless of the internal solution used, implicating a pump-like mechanism for FLInChR conductance (mean increase of 18±4% at +40 mV compared to −80 mV, n=16, FIG. 4C). Replacement of external ions with sucrose had no effect on FLInChR photocurrent amplitude (p=0.5, n=4, FIG. 4E), indicating that FLInChR photocurrents result from transport of cations out of the cell. An ammonium pre-pulse protocol (Schwiening and Boron, 1994) designed to shift the cell's pH—first basic, and then acidic—had no effect on current amplitude (FIG. 4F, n=5, p=0.9), suggesting that protons are not the exclusive charge carrier of the FLInChR photocurrent. Similarly, no change in photocurrent amplitude was detected when switching between Na+ and K+-based internals (FIG. 4G, n=9 vs n=22, p>0.5). Nevertheless, increasing cation size further by substituting with TEA+-based internal resulted in a significant drop in the photocurrent (FIG. 4G, 165±22 pA for K+, n=22 vs 106±15 pA for TEA+, n=20, p<0.05, one-way ANOVA with a post-hoc Tukey's test). Taken together, the above evidence is most consistent with the notion that topological inversion has transformed ChR2 E123T/T159C into a potent optogenetic inhibitor that functions like a light-activated, non-selective cation pump. Thus, topological inversion can indeed be sufficient to produce marked changes in the functional properties of opsins. Moreover, similarly to the case of CsChrimson inversion, inversion of ChR E123T/T159C resulted in a functionality (cation pumping) distinct from those attained with previous molecular engineering efforts. This finding, together with the observation that inversion also markedly altered the action spectrum of ChR2 ET/TC (FIG. 4D), suggests that topological engineering induces a significant rearrangement of side chains around the active site.


The efficiency of optogenetic-based manipulations of cell activity critically depends both on the properties of the opsin as well as the biophysics of the targeted cell type. Thus, it is desirable to have a range of properties (different ions conducted, a continuum from pump-like to channel-like behavior, etc.) for specific use cases. However, to qualify as a viable optogenetic tool for neuroscience a reagent must be capable of dramatically perturbing activity in at least some cell types. To verify that the altered active site packing of the inverted configuration is not incompatible with sufficient light-dependent ion transport for robust circuit interrogation inhibitory potential of FLInChR variants in brain slices was evaluated. Substantia nigra pars reticulata (SNr) neurons were targeted due to extensive prior experience using the parent ChR2 variant in this experimental preparation (see, e.g., Brown et al., Elife 3:e02397 (2014)) and the that fact that tonically active neurons provide an ideal test case for evaluating inhibitory optogenetic actuators.


Midbrain slices were prepared from adult GAD-Cre mice that had been injected into SNr with an adeno-associated virus carrying mVenus-tagged FLInChR or ArchT and targeted for whole cell recordings SNr GABAergic neurons visually identified to express the opsin (FIG. 5A). To further ascertain that inversion resulted in a marked change in the opsin function as well as to detect any contribution from potentially native, un-flipped ChR, conditions (wide-field illumination with a 1 ms pulse of 470 nm light; holding potential of −70 mV) that have been shown to elicit strong inward currents in ChR2-expressing SNr GABAergic cells were chosen (see, e.g., Brown et al., Elife 3:e02397 (2014)). FLInChR-expressing cells displayed robust outward currents under these conditions (FIG. 5B for FLInChR(Nx) and FIG. 5C for FLInChR(Syb)). Consistent with the observations in dissociated cultures, FLInChR-mediated photocurrent was observed even when cells were stimulated with 590 nm light (FIG. 5B, C)—conditions under which the parent ChR2 variant is not expected to display robust activity (Berndt et al., Science 344:420-424 (2011)). Evoked outward currents were on par with those mediated by ArchT—a commonly used and potent optogenetic inhibitor (FIG. 5D). A similarly rapid onset latency (FLinChR(Nx): 0.33+/−0.01 ms @ 470 nm; 0.30+/−0.01 ms @ 590 nm, n=4, FIG. 5E, top panel; FLInChR(Syb) 0.24+/−0.01 ms @ 470 nm; 0.24+/−0.01 ms @590 nm, n=4, FIG. 5F, top panel; ArchT: 0.25+/−0.04 ms @ 470 nm; 0.22+/−0.03 ms @ 590 nm, n=4, FIG. 5G, top panel) and rapid decay time constants (FLinChR(Nx): 2.51+/−0.14 ms @ 470 nm; 2.60+/−0.25 ms @ 590 nm, n=4, FIG. 5E, bottom panel; FLInChR(Syb) 3.07+/−0.13 ms @ 470 nm; 3.31+/−0.24 ms @590 nm, n=4, FIG. 5F, bottom panel; ArchT: 2.49+/−0.04 ms @ 470 nm; 2.24+/−0.03 ms @ 590 nm, n=4, FIG. 5G, bottom panel) were observed for FLInChR- and ArchTmediated currents. The comparable performance of Arch and FLInChR variants argues that the structural re-arrangements in the vicinity of the active site (a consequence of inversion) are compatible with efficient light-dependent ion transport.


The fact that SNr GABAergic cells respond to depolarizing current in vitro with firing rates of over 150 Hz (FIG. 6A) was used to examine the efficiency, with which FLInChR can inhibit evoked activity. In the absence of light stimulation, it was possible to evoke progressively higher spiking frequency in FLInChR-expressing neurons by injecting increasing steps of depolarizing current in a whole-cell current clamp mode. Brief pulses (100 ms) of photostimulation induced significant hyperpolarization of the membrane voltage that was maintained even during depolarizing current injection steps. Evoked spiking was mostly eliminated during photostimulation, and could only be partially recovered with very large (>400 pA) current injections (FIG. 6A, B). Similarly, efficient suppression of evoked spiking was observed in FLInChR-expressing cortical neurons (FIG. 7). The ability to sustain photoinhibition for prolonged periods (FIG. 6A, C) was likely due to only moderate desensitization of FLInChR-mediated currents beyond the initial 100 ms (FIG. 8, photocurrent amplitude normalized to peak: 0.8062+/−0.0743 at 100 ms, 0.6333+/−0.1131 ms at 1000 ms, n=4). Combined, these results demonstrate that FLInChR is a robust optogenetic inhibitor that can suppress evoked activity even in fast spiking neurons and may be sufficient for in vivo circuit interrogation experiments in behaving animals.


SNr neurons are the primary output of basal ganglia in rodents—a brain structure thought to be central to the bi-directional control of the vigor of voluntary movement in rodents, and primates. Given the efficacy of FLInChR in vitro whether focal optogenetic inhibition of SNr projection neurons could be used for behavioral circuit perturbation experiments was examined. Mice expressing FLInChR in the SNr were trained on a previously developed effort-based operant task that requires animals to adjust the vigor of a reaching movement to obtain reward (FIG. 9A,B). Once animals attained expert performance, activity in the SNr was suppressed on 25% of randomly selected reaches by delivering light through bilaterally implanted optical fibers. The perturbation was applied selectively during movement. Consistent with the efficient perturbation of spiking observed in FLInChR-expressing animals in vitro, a specific and systematic reduction was observed in peak velocity of reaches in “light ON” trials (FIG. 9C) which necessitated reaches of significantly longer reach duration for all mice (FIG. 9D-G). Importantly, the size of the observed behavioral effect for FLInChR-mediated SNr perturbation of movement vigor was similar in magnitude to that observed in other experiments where basal ganglia activity was manipulated with Arch in this task (Panigrahi et al., Cell 162:1418-1430 (2015)) as well as other prior measurements. Thus, although comparisons between different optogenetic tools are notoriously subject to the vagaries of the specific experimental preparation, the observed robust performance places FLInChR variants favorably amongst extant optogenetic tools for in vivo circuit perturbation experiments. Indeed, parallel sets of behavioral perturbation experiments in Caenorhabditis elegans nematodes expressing FLInChR in muscle cells (FIG. 8), demonstrating muscle inhibition and body elongation, and in rats expressing FLInChR in prefrontal cortical neurons (not shown), provided further support that this new opsin variant is a powerful new inhibitor suitable for in vivo manipulations.


The rapid kinetics of FLInChR-mediated photoinhibition evident in slice experiments (FIG. 5) prompted us to investigate whether FLInChR might aid with optogenetic tagging efforts—a common method for identification of neuronal cell types in electrophysiological experiments. While simple in principle, such experiments can be notoriously difficult in awake, active animals because of pronounced network effects, especially in circuits with strong recurrent connectivity, e.g. neocortex. The depolarizing opsin ChR2 is by far the most frequently used optogenetic tag, but in excitatory neuronal populations, its use for opto-tagging can be problematic (see, e.g., Lima et al., PloS one 4:e6099 (2009)). As latencies of light-driven modulation are often on par with synaptic delays, light-dependent activation by neighboring ChR2+ neurons driving a ChR2-cell over threshold can be indistinguishable from direct light activation of a ChR2+ cell. Inhibitory opsins, in principle, provide an alternative approach to optotagging populations of excitatory cells such as cortical projection neurons (PNs). Since PNs derive most of their excitatory drive from long-range inputs (Guo et al., 2017), short latencies to light-dependent inhibition is unlikely to result from removal of synaptic drive through local recurrent connections. Therefore rAAV2-retro-mediated delivery was used to selectively target long-range PNs in layer 5 of sensorimotor cortex in awake, behaving mice and rats, and analyzed the distribution of latencies to detectable photoinhibition through simultaneous extracellular recordings (FIG. 9H).


Robust photoinhibition was easily observed even in large rat PNs after 2 to 3 weeks of expression (FIG. 9I, significant responses detected in 19.5% of recorded units). When the optical fiber was advanced alongside the recording electrodes, the majority of light-sensitive units displayed latency to photoinhibition below three milliseconds (although latencies up to ten milliseconds could be observed in some cases). The ease of finding units with very short photoinhibition latencies and their spatial distribution (nominal depths of 0.9 to 1.3 mm from the cortical surface, consistent with the location in the rat brain of retrogradely-labeled striatal-projecting cortical neurons) strongly suggests that short-latency suppression is mediated by a direct effect. To verify the efficacy of direct FLInChRmediated photo-inhibition in such settings, juxta-cellular recordings were used in the equivalent experiment in the mouse. Illumination through the pipette was sufficient to induce rapid suppression of activity that could be maintained for up to 5 seconds of constant illumination (FIG. 9J), further arguing in favor of the direct nature of the observed photoinhibition. Moreover, when activity across all cortical layers was evaluated simultaneously with a large, high channel-density electrode array, units with rapid and robust suppression of firing (FIG. 9K) were exclusively found at depths consistent with layer 5 PNs (FIG. 9L). Interestingly, these high-density recordings revealed that targeted photoinhibition of targeted PNs is accompanied by dis-inhibition of other cortical neurons within the circuit (FIG. 9L, units with positive change in activity during illumination). However, the observed positive modulation of activity was both systematically delayed compared to presumed direct photoinhibition (indicative of poly-synaptic connectivity) and distributed across cortical layers. Collectively, these data suggest that FLInChR can be used in vivo in awake animals to effectively silence target populations of neurons. Moreover, the magnitude, speed and duration of activity suppression attainable even in large, difficult-to-inhibit pyramidal neurons argue that FLInChR is a useful tool for a variety of perturbation and opto-tagging experiments.


Methods
Dissociated Neuronal Cultures

Dissociated hippocampal cultures were prepared from Sprague-Dawley post-natal day 0 to 1 rat pups. Fourty-thousand neurons were plated on each poly-D-Lysine coated glass coverslips (Cat no. 3524; Corning) and cultured in in NBACTIVE4 (BrainBits).


Constructs and Adeno Associated Virus









TABLE 1







Viruses and payloads











Titre


Serotype
Payload
(GC/mL)





AAV2/1
CAG-hChR2(ET/TC)-mVenus
2.3E+12


AAV2/1
CAG-Nx1BTM-FCS-ChR2(ET/TC)-mVenus
1.9E+12


AAV2/1
CAG-Flex-CsChrimson(TR)-mEGFP
8.8E+12


AAV2/1
CAG-Nx1BTM-CsChrimson (CORRECT ME)
2.8E+12


rAAV2-retro
CAG-Cre
7.1E+12


rAAV2-retro
CAG-Flex-Nx1BTM-ChR2ET/TC-mVenus
3.0E+12


AAV2/1
CAG-Nx1B TM-ARCH(TR)-mEGFP
1.6E+12


AAV2/1
CAG-Cre
1.1E+12


AAV2/1
CAG-FLInCHR (Syb)-mVenus
2.1E+12


AAV2/1
CAG-Flex-FLInChR(Syb)-mVenus
2.0E+12









Proteinase K Assay

Coverslips of dissociated hippocampal neuronal cultures were infected with AAVs (see above) seven to ten days after plating. Seven to ten days after AAV infection, coverslips were transferred into a 24 well glass bottom plate (Cat no. P24G-1.0-13-F; Matek Corp) with 80 μl to 100 μl of DPBS with Ca2+ and Mg2+ (Cat no. 14040117; Gibco) in each well. Epifluorescence imaging was performed using an Olympus x81 microscope equipped with a 40× objective (Olympus UplanFLN 40x/0.75) and FITC cube (FITC-2024B-000; Semrock) using Slidebook 5.0-Innovatove Application (intelligent-imaging.com). Images were acquired at a rate of 1 Hz for 30 seconds. Following the acquisition of five baseline images, either 40 μl of PBS (vehicle) or 40 μl of 2.3 mg/mL proteinase K (1:10 dilution of 1095 units/mL or 23 mg protein/mL, Sigma Cat No P4850) was added to the well, and twenty-five additional images were acquired.


Time-lapsed images were analyzed using custom Matlab and Python scripts. Regions of interest (ROI) and background regions were manually selected using the first image from each experiment, blind to the condition. The difference of the mean fluorescence of each ROI and the mean fluorescence from the background region in the same image was calculated, and the mean of these differences for the five baseline images (F0) and the five final images (Ffinal) determined. Using this initial and final fluorescence, a difference in fluorescence was found and normalized to the initial fluorescence to yield the normalized change in fluorescence (ΔF/F0).


Myc-Tag Assay

Neurons were infected five days post plating with AAV-CAG—Flincher-mVenus and AAV-CAG-Myc-GFP. Ten days post infection three wells in each group were stained with rabbit anti-c-myc primary antibody (C3956; Sigma) at 1:1000 dilution for 60 minutes. Wells were washed with PBS 3 times, and then fixed with 4% paraformaldehyde (PFA) in 0.1M phosphate buffer (PB). All of the wells were labeled with Goat anti-Rabbit IgG secondary antibody Alexa Fluro 594. Ultra Rainbow Fluorescent Particles Beads (Cat #610; mean diameter: 3.80 um; Bangs Laboratories, Inc.) were diluted 1:500 for imaging. Images were acquired for a single time point using microscopy setup described above, with addition of imaging Alex Fluor 594 using a TRITC filter set (TRITC-B-OMF-Samrock).


Each image was analyzed blind to condition, by selecting regions of interest (ROI) for the soma, background and bead regions for each coverslip and the mean fluorescence for each ROI determined. The background ROI mean fluorescence was subtracted from the mean soma ROI fluorescence, and then normalized to the mean bead fluorescence to yield the arbitrary units (a.u.) in FIG. 1.


In Vitro Whole-Cell Electrophysiology in Dissociated Neuronal Cultures

In vitro electrophysiological characterization of opsins was done in hippocampal neurons cultured prepared as described above and infected with a virus carrying the payload of interest at 7 days in vitro (DIV). At 14-21 DIV, whole cell recordings were done using an extracellular solution of artificial cerebrospinal fluid (ACSF) that contained the following: 135 mM NaCl, 15 mM glucose, 3 mM KCl, 1.3 mM CaCl2, 1 mM MgSO4, 10 mM HEPES. For wholesale external ion replacement experiments (FIG. 4c) and well as reductions in [Na+] (FIG. 5b), ions were replaced with equimolar amounts of sucrose. SR95531 (5 μM) and Kynurenic acid (0.1 mM) were added to all solutions to block ionotropic GABA and glutamate receptors, respectively. All experiments were done at room temperature, which was approximately 25° C. Glass recording pipettes were pulled to a resistance of 1-3 MΩ with a P-97 horizontal puller (Sutter Instruments), and access resistance—as measured by the instantaneous current response to a −5 mV step with pipette capacitance cancelled—was always less than 8 MΩ. Light-evoked currents were induced using 2 ms full field illumination through the microscope objective at 0.2 Hz using a 4-wavelength high power LED light source (Thorlabs LED4D067, with a DC4100 4-channel LED driver; power measured at objective focal plane was ˜1 mW), with the exception of the experiments measuring excitation spectra, in which case a Polychrome V monochromator (TILL Photonics) was used as the light source. Responses were measured with a Multiclamp 700B amplifier (Molecular Devices) and AxoGraph X acquisition software.


Internal Solutions for Whole Cell-Recordings

To evaluate the ionic basis of the light-evoked currents four different internal solutions were used: C5-C1, TEA-C1, Na—Cl and K-Gluc. The C5-C1 solution contained 5 mM CsCl, 130 mM CeMeSO4, 10 mM HEPES, 0.5 mM EGTA, 0.4 mM Na-GTP, 4 mM Mg-ATP, 10 mM phosphocreatine, and was adjusted to pH 7.3. To replace cations, TEA-C1 containing 140 mM TEA-C1, 10 mM HEPES, 0.5 mM EGTA, and 10 mM phosphocreatine, adjusted to pH 7.3 was used. K-Gluc solution, in turn, contained 130 mM K-Gluconate, 5 mM KCl, 10 mM HEPES, 0.5 mM EGTA, 0.4 mM Na-GTP, 4 mM Mg-ATP, 10 mM phosphocreatine, adjusted to pH 7.3. Na—Cl based internal solution contained 135 mM NaCl, 3 mM KCl, 1.3 mM CaCl2, 1 mM MgSO4, 10 mM HEPES, 0.4 mM Na-GTP, 4 mM Mg-ATP, 10 mM phosphocreatine.


Ammonium Prepulse Protocol

To address the role of pH in the light-evoked FLInChR current, an ammonium prepulse protocol was used. Briefly, an ammonium challenge was used to shift internal pH basic and then acidic. The normal extracellular solution was first replaced with one in which 20 mM NH4Cl was added and 20 mM NaCl was omitted. Subsequently, a sodium-free (Na−) extracellular solution containing an equimolar substitution of N-methyl-D-glucamine (NMDG) for NaCl was used to replace the ammonium challenge and used for the rest of the recording session. All solutions contained SR95531 (5 μM) and Kynurenic acid (0.1 mM).


In Vitro Whole-Cell Slice Electrophysiology

Adult (6-8 weeks old) GAD2-IRES-Cre (Jackson Laboratory, Stock #010802) mice were injected with AAV2/1 CAG-FLEX FLInChR-mVenus; sections were taken 3-4 weeks post injection. Mice were deeply anaesthetized under isoflurane, decapitated, and the brains were removed. Coronal midbrain slices (300 μM thick) were sectioned (Leica VT1200S, Germany) in ice-cold modified artificial cerebral spinal fluid (aCSF) (52.5 mM NaCl, 100 mM sucrose, 26 mM NaHCO3, 25 mM glucose, 2.5 mM KCl, 1.25 mM NaH2PO4, 1 mM CaCl2, 5 mM MgCl2, and 100 μM kynurenic acid). Slices were transferred to a holding chamber and incubated at 35° C. for 30 minutes in modified aCSF (119 mM NaCl, 25 mM NaHCO3, 28 mM glucose, 2.5 mM KCl, 1.25 mM NaH2PO4, 1.4 mM CaCl2, 1 mM MgCl2, 3 mM sodium pyruvate, 400 μM ascorbate, and 100 μM kynurenic acid, saturated with 95% O2/5% CO2) and then stored at 21° C.


For recordings, slices were transferred to a recording chamber perfused with modified aCSF (119 mM NaCl, 25 mM NaHCO3, 11 mM glucose, 2.5 mM KCl, 1.25 mM NaH2PO4, 1.4 mM CaCl2, 1 mM MgCl2, 3 mM sodium pyruvate, 400 μM ascorbate, saturated with 95% O2/5% CO2) and maintained at 32-34° C. at a flow rate of 2-3 mL/minute. Substantia nigra GABAergic neurons expressing the opsin were targeted for recordings. Voltage clamp recordings of evoked photocurrents were made using electrodes (5-8 MS2) containing a CeMeSO4-based intracellular solution (in mM) (114 mM CeMeSO4, 4 mM NaCl, 10 mM HEPES, 5 mM QX314.C1, 0.3 mM GTP, 4 mM ATP, 10 mM phosphocreatine, pH 7.5). Recordings were made using a MultiClamp700B amplifier (Molecular Devices) interfaced to a computer using an analog to digital converter (PCI-6259; National Instruments) controlled by custom written scripts (to be made available at dudmanlab.org/) in Igor Pro (Wavemetrics). Photo-activation was carried out using a dual scan head raster scanning confocal microscope and control software developed by Prairie Systems and incorporated into a BX51 upright microscope (Olympus America). Individual neurons were patched under DIC optics with a water-immersion 40× objective. Cells were held at −70 mV and evoked current measured following brief 1 ms wide field illumination (470 mM or 590 mM). To measure spiking activity, current-clamp recordings were made using a potassium gluconate-based intracellular solution (137.5 mM potassium gluconate, 2.5 mM KCl, 10 mM HEPES, 4 mM NaCl, 0.3 mM GTP, 4 mM ATP, 10 mM phosphocreatine, pH 7.5). Depolarizing current steps (200 ms) were used to evoke high frequency spiking of GABAergic neurons, while brief 100 ms wide field illumination (470 mM, 1 mW at the focal plane of the objective) during the current step was used to assess the effectiveness of FLInChR to suppress evoked spiking. Progressively longer photostimulation was used to assess effect of duration on spiking suppression. Analysis of postsynaptic evoke currents and spiking was performed using custom written analysis code in Igor Pro (Wavemetrics). Rise time constants of postsynaptic currents were measured by finding the 20-80% slope of the rising phase of the stimulus-evoked current. Decay time constant of postsynaptic currents were measured by fitting a single exponential to the decay phase of the stimulus-evoked currents. Spikes were detected at the threshold of maximum acceleration.


In Vivo Perturbation of SNr GABAergic Activity During Effort-Based Operant Task

Adult GAD-IRES-Cre mice were individually housed in a temperature and humidity-controlled room maintained on a reversed 12 hour light/dark cycle. Following 1 week of recovery from surgery for targeted injection of AAV2/1 CAG-FLEX FLInChR-mVenus into SNr and placement of the head fixation chamber, mice were put onto water restriction with water consumption limited to at least 1 mL per day. Mice underwent daily health checks and water restriction was eased if mice fell below 70% of their body weight at the beginning of deprivation.


Water deprived mice were trained on a head-fixed variable amplitude operant task as described elsewhere (see, e.g., Osborne and Dudman, PloS one 9:e89007 (2014); and Panigrahi et al., Cell 162:1418-1430 (2015)), undergoing at least 2 weeks of daily sessions of initial training prior to perturbation experiments. For training, mice were placed in a darkened chamber with both paws positioned on a small metal handle attached to a joystick with two degrees of freedom (as seen in FIG. 9A). Movement of the joystick was detected by a Hall effect sensor with a linear voltage/displacement relationship. Voltage traces for each axis were recorded at 10 kHz and analysis of movements conducted offline. Movement threshold detection and triggering of water delivery were accomplished with a custom micro controller device. A session typically consisted of 120 trials within 7 blocks at different threshold amplitude requirements.


Individual forelimb movements, ‘reaches’, were extracted from voltage traces by thresholding the change in position and ensuring that movements were separated by at least 200 ms. To extract parameters of the outward component of the reach, a technique was followed as described elsewhere (see, e.g., Gallivan and Chapman, Frontiers in neuroscience 8:215 (2014)). Briefly, the outward component of the reach was determined by finding the end point of maximum displacement. A reach was defined as the trajectory from earliest detectable movement to reaching the maximum displacement (the most eccentric point on the convex hull that captured the trajectory). Movement velocity was computed with summary statistics of the trajectory (max, average).


Photostimulation was delivered via a fiber coupled solid state laser (488 nm; LaserGlow) coupled via a ferrule sleeve to an optical fiber (200 um diameter) positioned just above the SNr. Laser pulses were gated through the analog modulation circuitry of the laser by modulating the pulse width (1-10 ms). Pulse trains (16.7 Hz; 450 ms duration) were triggered by displacement of the joystick past a threshold lower in magnitude than the threshold required to elicit reward delivery. A randomly chosen 25% of all trial-initiating movements (as detected online) were allowed to trigger photo stimulation.


Behavioral Experiments in C. elegans


For body-wall muscle expression in C. elegans, pmyo-3::FLInChR::mVenus was synthesized in a codon optimized manner, resulting in the plasmid pAB15. The respective transgenic strain ZX2282 (zxEx1105[pmyo-3: :FLinChR::mVenus; pmyo-2::CFP] in N2), was generated via microinjection of 50 ng/μL plasmid DNA with 2 ng/μL of the co-injection marker pmyo-2::CFP. Animals were cultured on NGM plates, seeded with E. coli OP-50 strain, in 6 cm petri dishes. For optogenetic experiments, OP-50 was supplemented with ATR (0.15 μL of stock (100 mM in ethanol) mixed with 300 μL OP-50 bacterial solution).


Video analysis of changes in body length upon light stimulation monitored the evoked effect and provided qualitative information, whether the expressed protein worked as a depolarizer (body contraction) or hyperpolarizer (body relaxation). For behavioral experiments, young adult transgenic animals were cultivated overnight on ATR supplemented plates. To guarantee for an artefact free video analysis, the worms were singled on plain NGM plates prior to the experiments. An Axiovert 40 CFL microscope (Zeiss, Germany) with 10× magnification and a Powershot G9 digital camera (Canon, USA) were used to record the animals' behavior. For photo-stimulation of FLInChR, transgenic animals were challenged by 5 second light pulses (HBO light source, 580 nm, 22 mW/mm), controlled via an Arduino-driven shutter (Sutter Instruments, USA). The body length analysis was performed based on a custom written script for Matlab (Mathworks, USA). For the analysis of data, the animals' body length was normalized to the recording period prior to illumination.


Extracellular Electrophysiological Identification of FLInChR-Expressing Neurons in Awake Rats

Extracellular electrophysiology was performed using tetrode microdrives as described elsewhere (see, e.g., Karlsson et al., Science 338:135-139 (2012)) in combination with viral delivery of FLInChR and fiber optic delivery of light. Cortico-striatal neurons in the Anterior Congulate Cortex (Cg1) of adult Long-Evans rats were labeled by combining injections of two viruses. rAAV2-retro-Cre (titer: 7.1 e12 GC/ml) was injected bilaterally into the striatal axonal field (ML: 1.94 mm, AP: 2.29 mm, DV: −4.57 mm; 600 nl per site) with the aim of achieving retrograde access to cortico-striatal neurons. A Cre-dependent FLInChR construct was delivered through localized viral injection in the cortex, ˜1.5 mm away from the recording site to minimize damage. To ensure sufficient spread of the virus, rAAV2-retro was chosen as the serotype for delivery, but with the aim of utilizing its enhanced local spread rather than retrograde functionality. rAAV2-retro-CAG-FLEX-FLInChR (titer: 9.2 e12 GC/ml) was thus injected into the dorsal medial prefrontal cortex (ML: ˜0.6 mm, 0.6 mm AP: 1.2 mm, 1.2 mm DV: −3.0/2.5 mm, −3.0/2.5 mm; 300 nl per site). Several week after virus injection, optical-fiber-containing microdrive was implanted over rostral ACC (ML: −0.6 mm; AP: 2-3 mm)


Light delivery was accomplished using a fiber optic lowered from one of the shuttles of the microdrive, where the fiber optic transmitted light from a laser diode, which was controlled using custom hardware triggered remotely by infrared light and custom software. The fiber optic (200 μm core, 0.5NA hard polymer fiber optics, FP200URT; ThorLabs), was butt coupled to a laser diode (520 nm; Cat No: PL520_B1; World Star Tech) bonded (Norlands 68).


Fibers were sharpened using chemical etching approach. Specifically, the cable jacket, strengthening fibers, and outer plastic coating (typically white or orange) were fully removed, leaving 1 cm of fiber optic cable and inner plastic coating intact. Then 2 mm of the fiber tip (with final layer of plastic coating still attached) was submerged in 48% hydrofluoric acid topped with mineral oil for 85 min, followed by water for 5 minutes (submerging 5 mm), and acetone for 2 minutes (to soften the plastic). The plastic coating was then gently cut with a razor and pulled off with tweezers to reveal a 1 mm sharp-etched fiber tip. Light emitted from the fiber optic tip was ˜2 mW, leading to an estimated power density of ˜60 mW/mm2. Manufacturing, parts information and detailed documentation are provided online at (karpova-lab.github.io/cerebro/). Light pulses of 20 ms duration were delivered at 0.5 Hz throughout the recording session, in order to inactivate spontaneous and behaviorally evoked activity.


After the electrophysiology experiments, single units were isolated and clustered as described elsewhere (see, e.g., Karlsson et al., Science 338:135-139 (2012)). Peri-event histograms were used to examine the light-dependent inactivation of neuronal activity (FIG. 9I). To discover single units that had light-dependent inactivation, the neuronal activity was z-scored and units were selected that had a decrease of at least two standard deviations for at least 20% of 1 ms time bins during the 20 ms light pulse period. A histogram was constructed of the latency to inactivation of these selected units, where the latency was the time after light onset to the first bin that had an activity decrease of at least two standard deviations (FIG. 9I).


Extracellular Electrophysiological Identification of FLInChR-Expressing Neurons in Awake Rat

For cell-type specific in vivo recordings from motor cortex, rAAV2-CAG-Flex-FLInChR-mVenus was injected to the pons bilaterally (relative to lambda: 0.4 mm anterior, 0.4 mm lateral, 5.5, 5.75, 6 mm deep, 70 nL/depth) in Siml-KJ8 mice, selectively labelling a pyramidal type (PT) layer 5 population. Mice were awake during recordings and were generally immobile, having been previously head restrained for behavioral training. Prior to recordings, a craniotomy was made over the recording site (from bregma: 0.5 mm anterior, 1.7 mm lateral) at least 4 hours prior to recording. Exposed brain tissue was kept moist with phosphate-buffered saline at all times, and craniotomy sites were covered with Kwik-Sil elastomer (WPI) outside of the recording session.


Juxta-cellular recordings were performed as described elsewhere (Coddington and Dudman, bioRxiv, 238881 (2017)). Briefly, a small craniotomy (<200 μm diameter) was made over the recording site (at least 4 hours prior to recording). Exposed brain tissue was kept moist with phosphate-buffered saline at all times, and craniotomy sites were covered with Kwik-Sil elastomer (WPI) outside of the recording session. Borosillicate glass pipettes (Sutter, BF165-120-10) were pulled to a long taper (resistance 5-8 mOhm) with a P-97 micropipette puller (Sutter). Pipettes were filled with 0.5 M NaCl solution and mounted in a holder with a side port (Warner, PE30W-T17P) to allow insertion of a fiber (105 μm core, 0.22 NA, Thorlabs) that was coupled to a 473 nm laser (OEM Laser Systems) to carry light to the pipette tip. Pipettes were lowered through the brain with a micromanipulator (Luigs and Neumann) while a small cycling current injection allowed monitoring of resistance changes across the pipette tip. Within the target region (700-1100 micron from pial surface), the pipette tip was advanced by 1-2 μm steps until a steep increase in resistance was detected. The pipette was then advanced 5-10 μm until positive-going spikes were resolved well above noise (>˜0.5 mV). FLInChR expression and responses were assayed with single laser pulses of varying durations (0.5-5 sec), with power measured out of the tip of an exposed pipette of 5 mW. Responses were amplified (Multiclamp 700B, Axon Instruments), then digitally recorded at a 30 kHz sample rate with a Cerebus Signal Processor (Blackrock Microsystems).


For neural population recording using the neuropixel probe, awake mice fully recovered from craniotomy were head-fixed in a RIVETS chamber. A neuropixel probe (option 3 phase A) with 374 recording sites was lowered through the craniotomy manually. After a smooth descent (200 μm/minute), the probe sat still at the target depth for at least 5 minutes before initiation of recording to allow the electrodes to settle. An Ag wire was soldered onto the reference pad of the probe and shorted to ground. This reference wire was connected to an Ag/AgCl wire was positioned on the skull. The craniotomy and the Ag/AgCl wire were covered with a saline bath. Voltage signals are filtered (high-pass above 300 Hz), amplified (200× gain), multiplexed and digitized (25 kHz) on the base, allowing the direct transmission of noise-free digital data from the probe, and were recorded using an open-source software SpikeGLX (github.com/billkarsh/SpikeGLX). Recorded data were pre-processed using an open-source software JRCLUST (github.com/JaneliaSciComp/JRCLUST) to identify single- or multi units in the primary motor cortex (M1). To assay FLInChR expression and responses, a fiber (200 μm core, 0.39 NA, Thorlabs) coupled to a 574 nm laser source (Omicron) was placed to deliver light onto the craniotomy. Single laser pulses of 1-second duration with power measured at the tip of the fiber of 8 mW were delivered 60 times with 8-second intervals.


OTHER EMBODIMENTS

It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.

Claims
  • 1. An inverted transporter polypeptide, said inverted transporter polypeptide comprising: a leader sequence comprising a transmembrane domain of an integral membrane protein; anda transporter protein comprising an extracellular N-terminus of a light-gated ion channel; wherein said inverted transporter polypeptide presents the extracellular N-terminus of said light-gated ion channel on an intracellular side of a membrane of a cell.
  • 2. (canceled)
  • 3. The inverted transporter polypeptide of claim 1, wherein said inverted transporter polypeptide inhibits the excitability of said cell.
  • 4. The inverted transporter polypeptide of claim 3, wherein said cell is a neuron or a myocyte.
  • 5-6. (canceled)
  • 7. The inverted transporter polypeptide of claim 1, wherein said integral membrane protein is selected from the group consisting of Neurexin 1B, synaptobrevin, and a Drosophila olfactory receptor.
  • 8. The inverted transporter polypeptide of claim 1, wherein said light-gated ion channel is selected from the group consisting of a channelrhodopsin, archaerhodopsin, and halorhodopsin.
  • 9-13. (canceled)
  • 14. The inverted transporter polypeptide of claim 8, wherein said transporter protein comprises a channelrhodopsin, and wherein said channelrhodopsin comprises a substitution of the glutamic acid at residue 123 with a threonine (E123T) or a substitution of the threonine at residue 159 with a cysteine (T159C).
  • 15. (canceled)
  • 16. The inverted transporter polypeptide of claim 8, wherein said transporter protein comprises a channelrhodopsin, and wherein said channelrhodopsin comprises a E123T substitution and a T159C substitution.
  • 17. The inverted transporter polypeptide of claim 1, wherein said inverted transporter polypeptide comprises a sequence selected from the group consisting of the sequence set forth in SEQ ID NO:5, the sequence set forth in SEQ ID NO:6, and the sequence set forth in SEQ ID NO:7.
  • 18-19. (canceled)
  • 20. A nucleic acid construct comprising a nucleic acid encoding the inverted transporter polypeptide of claim 1.
  • 21. The nucleic acid construct of claim 20, wherein said nucleic acid construct is a viral vector.
  • 22. The nucleic acid construct of claim 21, wherein said viral vector is an adenoviral vector.
  • 23. A method for inverting a transporter protein in a cell, said method comprising: expressing in said cell a nucleic acid encoding an inverted transporter polypeptide comprising a leader sequence conjugated to a transporter protein comprising an extracellular N-terminus, wherein said inverted transporter polypeptide presents the extracellular N-terminus of said transporter protein on the intracellular side of said cell membrane.
  • 24. The method of claim 23, wherein said nucleic acid is a viral vector.
  • 25. The method of claim 24, wherein said viral vector is an adenoviral vector.
  • 26. A method for altering the excitability of a cell, said method comprising: administering to said cell a nucleic acid encoding an inverted transporter polypeptide comprising a leader sequence conjugated to a transporter protein comprising an extracellular N-terminus, wherein said inverted transporter polypeptide presents the extracellular N-terminus of said transporter protein on the intracellular side of said cell membrane, and wherein said inverted transporter polypeptide can regulate the excitability of said cell.
  • 27. The method of claim 26, wherein said nucleic acid is a viral vector.
  • 28. The method of claim 27, wherein said viral vector is an adenoviral vector.
  • 29. The method of claim 26, wherein said method inhibits the excitability of a cell.
  • 30. The method of claim 26, wherein said cell is a neuron or a myocyte.
  • 31. (canceled)
  • 32. The method of claim 26, wherein said inverted transporter polypeptide regulates the excitability of said cell using photoinhibition.
  • 33-40. (canceled)
CROSS-REFERENCE TO RELATED APPLICATIONS

This application claims the benefit of U.S. Patent Application Ser. No. 62/680,130, filed on Jun. 4, 2018. The disclosure of the prior application is considered part of (and is incorporated by reference in) the disclosure of this application.

PCT Information
Filing Document Filing Date Country Kind
PCT/US19/35344 6/4/2019 WO 00
Provisional Applications (1)
Number Date Country
62680130 Jun 2018 US