The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Nov. 29, 2017, is named MXI_518CN2CN8_Sequence_Listing.txt and is 313,567 bytes in size.
The present disclosure relates to novel vascular endothelial growth factor receptor (VEGFR)-binding polypeptides and methods for using these polypeptides to inhibit biological activities mediated by vascular endothelial growth factors (VEGFs).
Angiogenesis is the process by which new blood vessels are formed from pre-existing capillaries or post capillary venules; it is an important component of many physiological processes including ovulation, embryonic development, wound repair, and collateral vascular generation in the myocardium. Angiogenesis is also central to a number of pathological conditions such as tumor growth and metastasis, diabetic retinopathy, and macular degeneration. In many instances, the process begins with the activation of existing vascular endothelial cells in response to a variety of cytokines and growth factors. In cancer, tumor released cytokines or angiogenic factors stimulate vascular endothelial cells by interacting with specific cell surface receptors. The activated endothelial cells secrete enzymes that degrade the basement membrane of the vessels, allowing invasion of the endothelial cells into the tumor tissue. Once situated, the endothelial cells differentiate to form new vessel offshoots of pre-existing vessels. The new blood vessels provide nutrients to the tumor, facilitating further growth, and also provide a route for metastasis.
To date, numerous angiogenic factors have been identified, including the particularly potent factor VEGF. VEGF was initially purified from the conditioned media of folliculostellate cells and from a variety of cell lines. More recently a number of structural homologs and alternatively spliced forms of VEGF have been identified. The various forms of VEGF bind as high affinity ligands to a suite of VEGF receptors (VEGFRs). VEGFRs are tyrosine kinase receptors, many of which are important regulators of angiogenesis. The VEGFR family includes 3 major subtypes: VEGFR-1, VEGFR-2 (also known as Kinase Insert Domain Receptor, “KDR”, in humans), and VEGFR-3. Among VEGF forms, VEGF-A, VEGF-C and VEGF-D are known to bind and activate VEGFR-2.
VEGF, acting through its cognate receptors, can function as an endothelial specific mitogen during angiogenesis. In addition, there is substantial evidence that VEGF and VEGFRs are up-regulated in conditions characterized by inappropriate angiogenesis, such as cancer. As a result, a great deal of research has focused on the identification of therapeutics that target and inhibit VEGF or VEGFR.
Current therapeutic approaches that target or inhibit VEGF or VEGFR include antibodies, peptides, and small molecule kinase inhibitors. Of these, antibodies are the most widely used for in vivo recognition and inhibition of ligands and cellular receptors. Highly specific antibodies have been used to block receptor-ligand interaction, thereby neutralizing the biological activity of the components, and also to specifically deliver toxic agents to cells expressing the cognate receptor on its surface. Although effective, antibodies are large, complex molecules that rely on expression in recombinant mammalian cells for production. Antibodies also cause a variety of side effects that are often undesirable, including activation of complement pathways and antibody-directed cellular cytotoxicity. As a result, there remains a need for effective therapeutics that can specifically inhibit VEGF/VEGFR pathways as a treatment for disorders characterized by inappropriate angiogenesis, such as cancer.
In part, this disclosure provides novel, single domain polypeptides that bind to VEGFR-2 receptors, particularly human VEGFR-2 (also known as KDR) and mouse VEGFR-2 (also known as Flk-1). VEGFR-2 binding proteins described herein may be used, for example, to detect VEGFR-2 in vivo or in vitro. Additionally, certain VEGFR-2 binding proteins described herein may be used to treat diseases associated with VEGFR-2-mediated biological activity. For example, KDR mediates pro-angiogenic effects of VEGF, and accordingly, certain KDR binding proteins of the disclosure may be used to inhibit angiogenesis in a human patient. Certain VEGFR-2 binding proteins of the disclosure may be used to treat disorders such as cancers, inflammatory diseases, autoimmune diseases and retinopathies. Many disorders related to the hyperproliferation of cells of a tissue will include an angiogenic component, and thus it is expected that certain VEGFR-2 binding proteins described herein can be used to treat such disorders.
A single domain polypeptide described herein will generally be a polypeptide that binds to a target, such as VEGFR-2, and where target binding activity situated within a single structural domain, as differentiated from, for example, antibodies and single chain antibodies, where antigen binding activity is generally contributed by both a heavy chain variable domain and a light chain variable domain. The disclosure also provides larger proteins that may comprise single domain polypeptides that bind to target. For example, a plurality of single domain polypeptides may be connected to create a composite molecule with increased avidity. Likewise, a single domain polypeptide may be attached (e.g., as a fusion protein) to any number of other polypeptides. In certain aspects a single domain polypeptide may comprise at least five to seven beta or beta-like strands distributed among at least two beta sheets, as exemplified by immunoglobulin and immunoglobulin-like domains. A beta-like strand is a string of amino acids that participates in the stabilization of a single domain polypeptide but does not necessarily adopt a beta strand conformation. Whether a beta-like strand participates in the stabilization of the protein may be assessed by deleting the string or altering the sequence of the string and analyzing whether protein stability is diminished. Stability may be assessed by, for example, thermal denaturation and renaturation studies. Preferably, a single domain polypeptide will include no more than two beta-like strands. A beta-like strand will not usually adopt an alpha-helical conformation but may adopt a random coil structure. In the context of an immunoglobulin domain or an immunoglobulin-like domain, a beta-like strand will most often occur at the position in the structure that would otherwise be occupied by the most N-terminal beta strand or the most C-terminal beta strand. An amino acid string which, if situated in the interior of a protein sequence would normally form a beta strand, may, when situated at a position closer to an N- or C-terminus, adopt a conformation that is not clearly a beta strand and is referred to herein as a beta-like strand.
In certain embodiments, the disclosure provides single domain polypeptides that bind to VEGFR-2. Preferably the single domain polypeptides bind to human KDR, mouse Flk-1, or both. A single domain polypeptide may comprise between about 80 and about 150 amino acids that have a structural organization comprising: at least seven beta strands or beta-like strands distributed between at least two beta sheets, and at least one loop portion connecting two beta strands or beta-like strands, which loop portion participates in binding to VEGFR-2. In other words a loop portion may link two beta strands, two beta-like strands or one beta strand and one beta-like strand. Typically, one or more of the loop portions will participate in VEGFR-2 binding, although it is possible that one or more of the beta or beta-like strand portions will also participate in VEGFR-2 binding, particularly those beta or beta-like strand portions that are situated closest to the loop portions. A single domain polypeptide may comprise a structural unit that is an immunoglobulin domain or an immunoglobulin-like domain. A single domain polypeptide may bind to any part of VEGFR-2, although polypeptides that bind to an extracellular domain of a VEGFR-2 are preferred. Binding may be assessed in terms of equilibrium constants (e.g., dissociation, KD) and in terms of kinetic constants (e.g., on rate constant, kon and off rate constant, koff). A single domain polypeptide will typically be selected to bind to VEGFR-2 with a KD of less than 10−6M, or less than 10−7M, 5×10−8M, 10−8M or less than 10−9M. VEGFR-2 binding polypeptides may compete for binding with one, two or more members of the VEGF family, particularly VEGF-A, VEGF-C and VEGF-D and may inhibit one or more VEGFR-2-mediated biological events, such as proliferation of endothelial cells, permeabilization of blood vessels and increased motility in endothelial cells. VEGFR-2 binding polypeptides may be used for therapeutic purposes as well as for any purpose involving the detection or binding of VEGFR-2. Polypeptides for therapeutic use will generally have a KD of less than 5×10−8M, less than 10−8M or less than 10−9M, although higher KD values may be tolerated where the koff is sufficiently low or the kon is sufficiently high. In certain embodiments, a single domain polypeptide that binds to VEGFR-2 will comprise a consensus VEGFR-2 binding sequence selected from the group consisting of: SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO:4. Preferably, such sequence will be situated in a loop, particularly the FG loop.
In certain embodiments, the single domain polypeptide comprises an immunoglobulin (Ig) variable domain. The Ig variable domain may, for example, be selected from the group consisting of: a human VL domain, a human VH domain and a camelid VHH domain. One, two, three or more loops of the Ig variable domain may participate in binding to VEGFR-2, and typically any of the loops known as CDR1, CDR2 or CDR3 will participate in VEGFR-2 binding.
In certain embodiments, the single domain polypeptide comprises an immunoglobulin-like domain. One, two, three or more loops of the immunoglobulin-like domain may participate in binding to VEGFR-2. A preferred immunoglobulin-like domain is a fibronectin type III (Fn3) domain. Such domain may comprise, in order from N-terminus to C-terminus, a beta or beta-like strand, A; a loop, AB; a beta strand, B; a loop, BC; a beta strand C; a loop CD; a beta strand D; a loop DE; a beta strand F; a loop FG; and a beta or beta-like strand G. See
In certain embodiments, the disclosure provides a non-antibody polypeptide comprising a domain having an immunoglobulin-like fold that binds to VEGFR-2. The non-antibody polypeptide may have a molecular weight of less than 20 kDa, or less than 15 kDa and will generally be derived (by, for example, alteration of the amino acid sequence) from a reference, or “scaffold”, protein, such as an Fn3 scaffold. The non-antibody polypeptide may bind VEGFR-2 with a KD less than 10−6M, or less than 10−7M, less than 5×10−8M, less than 10−8M or less than 10−9M. The unaltered reference protein either will not meaningfully bind to VEGFR-2 or will bind with a KD of greater than 10−6M. The non-antibody polypeptide may inhibit VEGF signaling, particularly where the non-antibody polypeptide has a KD of less than 5×10−8M, less than 10−8M or less than 10−9M, although higher KD values may be tolerated where the koff is sufficiently low (e.g., less than 5×10−4 s−1). The immunoglobulin-like fold may be a 10Fn3 polypeptide.
In certain embodiments, the disclosure provides a polypeptide comprising a single domain having an immunoglobulin fold that binds to VEGFR-2. The polypeptide may have a molecular weight of less than 20 kDa, or less than 15 kDa and will generally be derived (by, for example, alteration of the amino acid sequence) from a variable domain of an immunoglobulin. The polypeptide may bind VEGFR-2 with a KD less than 10−6M, or less than 10−7M, less than 5×10−8M, less than 10−8M or less than 10−9M. The polypeptide may inhibit VEGF signaling, particularly where the polypeptide has a KD of less than 5×10−8M, less than 10−8M or less than 10−9M, although higher KD values may be tolerated where the koff is sufficiently low or where the kon is sufficiently high. In certain preferred embodiments, a single domain polypeptide having an immunoglobulin fold derived from an immunoglobulin light chain variable domain and capable of binding to VEGFR-2 may comprise an amino acid sequence selected from the group consisting of: SEQ ID NOs:514-560.
In certain preferred embodiments, the disclosure provides VEGFR-2 binding polypeptides comprising the amino acid sequence of any of SEQ ID NOs: 192-194. In the case of a polypeptide comprising the amino acid sequence of SEQ ID NO: 194, a PEG moiety or other moiety of interest, may be covalently bound to the cysteine at position 93. The PEG moiety may also be covalently bonded to an amine moiety in the polypeptide. The amine moiety may be, for example, a primary amine found at the N-terminus of a polypeptide or an amine group present in an amino acid, such as lysine or arginine. In certain embodiments, the PEG moiety is attached at a position on the polypeptide selected from the group consisting of: a) the N-terminus; b) between the N-terminus and the most N-terminal beta strand or beta-like strand; c) a loop positioned on a face of the polypeptide opposite the target-binding site; d) between the C-terminus and the most C-terminal beta strand or beta-like strand; and e) at the C-terminus.
In certain aspects, the disclosure provides short peptide sequences that mediate VEGFR-2 binding. Such sequences may mediate VEGFR-2 binding in an isolated form or when inserted into a particular protein structure, such as an immunoglobulin or immunoglobulin-like domain. Examples of such sequences include those disclosed as SEQ ID NOs:1-4 and other sequences that are at least 85%, 90%, or 95% identical to SEQ ID NOs: 1-4 and retain VEGFR-2 binding activity. Accordingly, the disclosure provides substantially pure polypeptides comprising an amino acid sequence that is at least 85% identical to the sequence of any of SEQ ID NOs: 1-4, wherein said polypeptide binds to a VEGFR-2 and competes with a VEGF species for binding to VEGFR-2. Examples of such polypeptides include a polypeptide comprising an amino acid sequence that is at least 80%, 85%, 90%, 95% or 100% identical to an amino acid sequence at least 85% identical to the sequence of any of SEQ ID NOs:6-175, 178-186, 188 and 192-194. Preferably such polypeptide will inhibit a biological activity of VEGF and may bind to VEGFR-2 with a KD less than 10−6M, or less than 10−7M, less than 5×10−8M, less than 10−8M or less than 10−9M.
In certain embodiments, any of the VEGFR-2 binding polypeptides described herein may be bound to one or more additional moieties, including, for example, a moiety that also binds to VEGFR-2 (e.g., a second identical or different VEGFR-2 binding polypeptide), a moiety that binds to a different target (e.g., to create a dual-specificity binding agent), a labeling moiety, a moiety that facilitates protein purification or a moiety that provides improved pharmacokinetics. Improved pharmacokinetics may be assessed according to the perceived therapeutic need. Often it is desirable to increase bioavailability and/or increase the time between doses, possibly by increasing the time that a protein remains available in the serum after dosing. In some instances, it is desirable to improve the continuity of the serum concentration of the protein over time (e.g., decrease the difference in serum concentration of the protein shortly after administration and shortly before the next administration). Moieties that tend to slow clearance of a protein from the blood include polyethylene glycol, sugars (e.g. sialic acid), and well-tolerated protein moieties (e.g., Fc fragment or serum albumin). The single domain polypeptide may be attached to a moiety that reduces the clearance rate of the polypeptide in a mammal (e.g., mouse, rat, or human) by greater than three-fold relative to the unmodified polypeptide. Other measures of improved pharmacokinetics may include serum half-life, which is often divided into an alpha phase and a beta phase. Either or both phases may be improved significantly by addition of an appropriate moiety. Where polyethylene glycol is employed, one or more PEG molecules may be attached at different positions in the protein, and such attachment may be achieved by reaction with amines, thiols or other suitable reactive groups. Pegylation may be achieved by site-directed pegylation, wherein a suitable reactive group is introduced into the protein to create a site where pegylation preferentially occurs. In a preferred embodiment, the protein is modified so as to have a cysteine residue at a desired position, permitting site directed pegylation on the cysteine. PEG may vary widely in molecular weight and may be branched or linear. Notably, the present disclosure establishes that pegylation is compatible with target binding activity of 10Fn3 polypeptides and, further, that pegylation does improve the pharmacokinetics of such polypeptides. Accordingly, in one embodiment, the disclosure provides pegylated forms of 10Fn3 polypeptides, regardless of the target that can be bound by such polypeptides.
In certain embodiments, the disclosure provides a formulation comprising any of the VEGFR-2 binding polypeptides disclosed herein. A formulation may be a therapeutic formulation comprising a VEGFR-2 binding polypeptide and a pharmaceutically acceptable carrier. A formulation may also be a combination formulation, comprising an additional active agent, such as an anti-cancer agent or an anti-angiogenic agent.
In certain aspects, the disclosure provides methods for using a VEGFR-2 binding protein to inhibit a VEGF biological activity in a cell or to inhibit a biological activity mediated by VEGFR-2. The cell may be situated in vivo or ex vivo, and may be, for example, a cell of a living organism, a cultured cell or a cell in a tissue sample. The method may comprise contacting said cell with any of the VEGFR-2-inhibiting polypeptides disclosed herein, in an amount and for a time sufficient to inhibit such biological activity.
In certain aspects, the disclosure provides methods for treating a subject having a condition which responds to the inhibition of VEGF or VEGFR-2. Such a method may comprise administering to said subject an effective amount of any of the VEGFR-2 inhibiting polypeptides described herein. A condition may be one that is characterized by inappropriate angiogenesis. A condition may be a hyperproliferative condition. Examples of conditions (or disorders) suitable for treatment include autoimmune disorders, inflammatory disorders, retinopathies (particularly proliferative retinopathies), and cancers. Any of the VEGFR-2 inhibiting polypeptides described herein may be used for the preparation of a medicament for the treatment of a disorder, particularly a disorder selected from the group consisting of: an autoimmune disorder, an inflammatory disorder, a retinopathy, and a cancer.
In certain aspects, the disclosure provides methods for detecting VEGFR-2 in a sample. A method may comprise contacting the sample with a VEGFR-2 binding polypeptide described herein, wherein said contacting is carried out under conditions that allow polypeptide-VEGFR-2 complex formation; and detecting said complex, thereby detecting said VEGFR-2 in said sample. Detection may be carried out using any technique known in the art, such as, for example, radiography, immunological assay, fluorescence detection, mass spectroscopy, or surface plasmon resonance. The sample will often by a biological sample, such as a biopsy, and particularly a biopsy of a tumor, a suspected tumor or a tissue suspected of undergoing unwanted angiogenesis. The sample may be from a human or other mammal. The VEGFR-2 binding polypeptide may be labeled with a labeling moiety, such as a radioactive moiety, a fluorescent moiety, a chromogenic moiety, a chemiluminescent moiety, or a hapten moiety. The VEGFR-2 binding polypeptide may be immobilized on a solid support.
Another aspect of the disclosure relates to a nucleic acid comprising a nucleic acid sequence encoding a polypeptide disclosed herein. In certain embodiments, a nucleic acid may comprise a nucleic acid sequence encoding a polypeptide selected from the group consisting of any of SEQ ID Nos. 6-175, 178-186, 188, 192-194 and 514-560. In certain embodiments, a nucleic acid comprises a nucleic acid sequence that hybridizes in stringent conditions to a nucleic acid sequence of SEQ ID NO: 176 and encodes a polypeptide that binds to human KDR with a KD of less than 1×10-6M. In particular embodiments, nucleic acid may comprise a nucleic acid sequence selected from the group consisting of SEQ ID NO: 176 and SEQ ID NO: 177.
A further aspect of the disclosure relates to an expression vector comprising a nucleic acid operably linked with a promoter, wherein the nucleic acid encodes a polypeptide disclosed herein. Another aspect of the disclosure relates to a cell comprising a nucleic acid disclosed herein. Also provided is a method of producing the polypeptide that binds VEGFR-2, e.g., KDR, comprising: expressing a nucleic acid encoding a polypeptide of the disclosure. In certain embodiments, the nucleic acid may comprise a sequence that encodes a polypeptide selected from the group consisting of any of SEQ ID Nos. 6-175, 178-186, 188, 192-194 and 514-560. In certain embodiments, the nucleic acid comprises a sequence that hybridizes in stringent conditions to a nucleic acid sequence of SEQ ID NO: 176. In certain embodiments, the nucleic acid comprises a nucleic acid sequence selected from the group consisting of SEQ ID NO: 176 and SEQ ID NO: 177. In certain embodiments, the nucleic acid is expressed in a cell. Alternatively, the nucleic acid is expressed in a cell-free system.
In certain aspects, the disclosure provides discoveries that may be applicable to any 10Fn3 polypeptide, regardless of which target the polypeptide is engineered to bind. As noted above, the disclosure demonstrates that PEG can be used successfully to improve the pharmacokinetics of a 10Fn3 polypeptide, while not interfering meaningfully with target binding. Accordingly, the disclosure provides pegylated 10Fn3 polypeptides that bind to target and have improved pharmacokinetics relative to the non-pegylated polypeptide. In a further embodiment, the disclosure demonstrates that a deletion of the first eight amino acids of a 10Fn3 polypeptide can increase target binding affinity. Accordingly, the disclosure provides 10Fn3 polypeptides lacking the initial eight amino acids (amino acids numbered in reference to the sequence of SEQ ID No:5). It is understood that one or two amino acids may be added back to the deleted form of the polypeptide so as to facilitate translation and proper processing. The disclosure demonstrates that subcutaneous administration of a 10Fn3 polypeptide results in a delayed release of polypeptide into the bloodstream and a decreased maximum serum concentration of the 10Fn3 polypeptide. Accordingly, the disclosure provides methods for administering a 10Fn3 polypeptide to a patient by a subcutaneous administration. This route of administration may be useful to achieve a delayed release relative to intravenous administration, and/or to decrease the maximum serum concentration of the 10Fn3 polypeptide by at least 25% or at least 50% relative to the maximum serum concentration achieved by intravenous administration of an equal dosage. The administered 10Fn3 polypeptide may be attached to a moiety that increases the serum half-life (or decreases clearance rate, or similarly affects another pharmacokinetic parameter) of the 10Fn3 polypeptide, such as a polyethylene glycol moiety. Preferably, the administered 10Fn3 polypeptide comprises an amino acid sequence that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90% identical to SEQ ID NO:5.
In certain aspects, the disclosure provides single domain polypeptides that bind to a preselected target protein from a first mammal and to a homolog thereof from a second mammal. Such single domain polypeptides are particularly useful where the first mammal is a human and the second mammal is a desirable mammal in which to conduct preclinical testing, such as a mouse, rat, guinea pig, dog, or non-human primate. The disclosure demonstrates that single domain polypeptides can be engineered to have such dual specificity, and that the dual specificity simplifies drug development by allowing testing of the same polypeptide in human cells, human subjects and animal models. Preferably, the preselected target protein of the first mammal and the homolog thereof from the second mammal are sufficiently similar in amino acid sequence to allow generation of dual specificity polypeptides. For example, the preselected target protein and the homolog from the second mammal may share at least 80%, 90%, or 95% identity across a region of at least 50 amino acids, and optionally may share at least 80%, 90%, or 95% identity across the entire protein sequence or across the sequence of the extracellular domain, in the case of a membrane protein. A single domain polypeptide with this type of dual specificity binding characteristic may comprise an immunoglobulin or immunoglobulin-like domain, and will preferably bind to both the preselected human target protein and to the homolog thereof with a dissociation constant of less than 1×10−6M, 1×10−7M, 5×10−8M, 1×10−8M or 1×10−9M.
This specification describes, inter alia, the identification and production of novel, single domain polypeptides that bind to VEGFR-2 receptors. VEGFR-2, also called KDR in humans and Flk-1 in mice, is the primary mediator for the pro-angiogenic effects of VEGF signaling. VEGFR-2 is bound and activated by VEGF-A, VEGF-C and VEGF-D. In endothelial cells, VEGFR-2 activation stimulates cell proliferation and migration, and in vivo, VEGFR-2 activation triggers angiogenesis and increases the permeability of the vasculature. Increased angiogenesis is well-established as an important feature of tumor growth and various retinopathies, while increased permeability of the vasculature is a significant event in many inflammatory responses.
The present disclosure provides hundreds of single domain polypeptides that bind to VEGFR-2, many of which exhibit in vitro and/or in vivo VEGF antagonist activity. Single domain polypeptides having VEGF antagonist activity will be useful in numerous therapeutic applications. Anti-KDR antibodies have been established as having in vivo utility against diseases and conditions ranging from cancers and complications resulting from cancers to proliferative retinopathies, inflammatory disorders and fibrosis. Based on the in vivo and in vitro data presented here, it is expected that the single domain polypeptides will be useful in treating the same spectrum of disorders.
In addition to therapeutic applications, VEGFR-2-binding single domain polypeptides may be used in any circumstance where it is desirable to detect VEGFR-2. For example, many stem cells express VEGFR-2, including particularly useful cells of hematopoietic lineages. KDR-binding polypeptides may be used, particularly in a labeled format, to detect stem cells and facilitate cell sorting. In vivo, labeled VEGFR-2-binding polypeptides may be used to image tissues in which VEGFR-2 is expressed. Elevated VEGFR-2 expression may be characteristic of tissues experiencing particularly high levels of angiogenic or inflammatory activity. Histological analyses of tissue samples may also benefit from detection of VEGFR-2. For example, it may be desirable to detect VEGFR-2 expression in a tumor biopsy in order to assess the likely effectiveness of an anti-VEGFR-2 or anti-VEGF therapy. Interestingly, many of the VEGFR-2 binding proteins disclosed herein bind to VEGFR-2 with nanomolar dissociation constants and yet fail to have a significant effect on VEGFR-2 mediated biological events. Accordingly, such binding proteins, may be useful for in vivo visualization techniques or cell-labeling techniques, where it will often be desirable to selectively label cells that express a VEGFR-2 without causing a significant perturbation of VEGFR-2 mediated events.
This disclosure describes the use of an in vitro display technology, termed PROfusion™, that exploits nucleic acid-protein fusions (RNA- and DNA-protein fusions) to identify novel single domain polypeptides and amino acid motifs that are important for binding to VEGFR-2. Nucleic acid-protein fusion technology is a display technology that covalently couples a protein to its encoding genetic information. PROfusion™ technology was used to screen collections of nucleic acids encoding single domain polypeptides constructed using a scaffold based on the human fibronectin type three domain (10Fn3) or constructed from the variable domains of antibody light chains. The expressed polypeptides, termed a “library” of scaffold proteins, was screened for polypeptides that could bind VEGFR-2 with high affinity. We isolated from this library of scaffold proteins novel single domain polypeptides that bind to VEGFR-2 and that, in some instances, inhibit VEGF biological activities. Furthermore, it was discovered that many independently randomized loops situated in immunoglobulin or immunoglobulin-like scaffolds tended to converge to a related set of consensus sequences that participated in VEGFR-2 binding. Therefore, it is expected that polypeptides having these consensus sequences will be useful as VEGFR-2 binding agents even when separated from the protein context in which they were identified. See, for example, SEQ ID Nos. 1-4. Such polypeptides may be used as independent, small peptide VEGFR-2 binding agents or may be situated in other proteins, particularly proteins that share an immunoglobulin or immunoglobulin-like fold.
As discussed above, the present disclosure demonstrates that single domain polypeptides having certain desirable properties, such as high affinity binding to VEGFR-2, antagonist effects with respect to one or more of VEGF-A, -C or -D and improved pharmacokinetics, can be used as effective anti-cancer agents. While it is expected that the effectiveness of such polypeptides as anti-cancer agents is related to the role of angiogenesis in cancer, we do not wish to be bound to any particular mechanism. It is formally possible that the present single domain polypeptides are effective against cancers for reasons unrelated to angiogenic processes.
To our knowledge, the present disclosure represents the first successful effort to use an Fn3-based polypeptide to achieve a therapeutic effect in vivo. Many of the improvements and discoveries made in achieving in vivo effectiveness will be broadly applicable to other Fn3-based polypeptides. In other words, although ligand binding properties of an Fn3-based polypeptide will generally be determined by a relatively small number of amino acids situated in solvent accessible loop regions, other features, such as pharmacokinetic features, of Fn3-based polypeptides will tend to be determined by the majority of the protein that is not directly involved in ligand binding and that is conserved from protein to protein regardless of the target protein. This has been the case with antibodies, where a few loops, called CDR regions, mediate antigen binding, while other features of in vivo antibody behavior are largely dictated by the conserved framework regions and constant domains.
By “inhibit” is meant a measurable reduction in a phenomenon, often used herein in reference to any of the following: the interaction of VEGF with a VEGFR, VEGF- or VEGFR-mediated angiogenesis, angiogenesis, symptoms of angiogenesis, the viability of VEGFR-containing cells, the viability of VEGF-dependent Ba/F3 cells, or VEGF- or VEGFR-mediated cellular proliferation as compared to a control sample not treated with the polypeptide. A polypeptide will inhibit a VEGF- or VEGFR-2 mediated activity if the reduction in activity or interaction is at least 10%, preferably 20%, 30%, 40%, or 50%, and more preferably 60%, 70%, 80%, 90% or more.
By “VEGF biological activity” is meant any function of any VEGF family member acting through any VEGF receptor, but particularly signaling through a VEGFR-2 receptor. The VEGF family includes VEGF-A, VEGF-B, VEGF-C, VEGF-D, and placental growth factor (PIGF), as well as various alternatively spliced forms of VEGF including VEGF121, VEGF145, VEGF165, VEGF189, and VEGF206 (Tischer et al., J. Biol. Chem, 266:11947-11954, 1991). The VEGFR family of tyrosine kinase receptors includes VEGFR-1 (also known as Flt-1), VEGFR-2 (also known as KDR (human form) or Flk-1 (mouse form)), and VEGFR-3 (also known as Flt-4). VEGF ligands bind to the VEGF receptors to induce, for example, angiogenesis, vasculogenesis, endothelial cell proliferation, vasodilation, and cell migration. VEGF ligands can also inhibit apoptosis through binding to their cognate receptors. VEGFR-2 is believed to be the VEGFR most involved in angiogenesis. A VEGFR-2 or KDR-mediated biological activity is any biological function in which VEGFR-2 or KDR participates in significantly, such that antagonism of VEGFR-2 or KDR causes a measurable decrease in the biological activity. The biological activity of VEGF and VEGFR can be measured by standard assays known in the art. Examples include ligand binding assays and Scatchard plot analysis; receptor dimerization assays; cellular phosphorylation assays; tyrosine kinase phosphorylation assays (see for example Meyer et al., Ann. N.Y. Acad. Sci. 995:200-207, 2003); endothelial cell proliferation assays such as BrdU labeling and cell counting experiments; VEGF-dependent cell proliferation assays; and angiogenesis assays. Methods for measuring angiogenesis are standard, and are described, for example, in Jain et al. (Nat. Rev. Cancer 2:266-276, 2002). Angiogenesis can be assayed by measuring the number of non-branching blood vessel segments (number of segments per unit area), the functional vascular density (total length of perfused blood vessel per unit area), the vessel diameter, the formation of vascular channels, or the vessel volume density (total of calculated blood vessel volume based on length and diameter of each segment per unit area). Exemplary assays for VEGF-mediated proliferation and angiogenesis can be found in U.S. Pat. No. 6,559,126, Lyden et al, Nature Medicine 7:1194 (2001), Jacob et al, Exp. Pathol. 15:1234 (1978) and Bae et al, J. Biol. Chem. 275:13588 (2000). These assays can be performed using either purified receptor or ligand or both, and can be performed in vitro or in vivo. These assays can also be performed in cells using a genetically introduced or the naturally-occurring ligand or receptor or both. A polypeptide that inhibits the biological activity of VEGF will cause a decrease of at least 10%, preferably 20%, 30%, 40%, or 50%, and more preferably 60%, 70%, 80%, 90% or greater decrease in the biological activity of VEGF. The inhibition of biological activity can also be measured by the IC50. Preferably, a polypeptide that inhibits the biological activity of VEGF or VEGFR-2 will have an IC50 of less than 100 nM, more preferably less than 10 nM and most preferably less than 1 nM.
The methodology described herein has been successfully used to develop single domain VEGFR-2 binding polypeptides derived from two related groups of protein structures: those proteins having an immunoglobulin fold and those proteins having an immunoglobulin-like fold. By a “polypeptide” is meant any sequence of two or more amino acids, regardless of length, post-translation modification, or function. “Polypeptide,” “peptide,” and “protein” are used interchangeably herein. Polypeptides can include natural amino acids and non-natural amino acids such as those described in U.S. Pat. No. 6,559,126, incorporated herein by reference. Polypeptides can also be modified in any of a variety of standard chemical ways (e.g., an amino acid can be modified with a protecting group; the carboxy-terminal amino acid can be made into a terminal amide group; the amino-terminal residue can be modified with groups to, e.g., enhance lipophilicity; or the polypeptide can be chemically glycosylated or otherwise modified to increase stability or in vivo half-life). Polypeptide modifications can include the attachment of another structure such as a cyclic compound or other molecule to the polypeptide and can also include polypeptides that contain one or more amino acids in an altered configuration (i.e., R or S; or, L or D). The term “single domain polypeptide” is used to indicate that the target binding activity (e.g., VEGFR-2 binding activity) of the subject polypeptide is situated within a single structural domain, as differentiated from, for example, antibodies and single chain antibodies, where antigen binding activity is generally contributed by both a heavy chain variable domain and a light chain variable domain. It is contemplated that a plurality of single domain polypeptides of the sort disclosed herein could be connected to create a composite molecule with increased avidity. Likewise, a single domain polypeptide may be attached (e.g., as a fusion protein) to any number of other polypeptides, such as fluorescent polypeptides, targeting polypeptides and polypeptides having a distinct therapeutic effect.
Single domain polypeptides of either the immunoglobulin or immunoglobulin-like scaffold will tend to share certain structural features. For example, the polypeptide may comprise between about 80 and about 150 amino acids, which amino acids are structurally organized into a set of beta or beta-like strands, forming beta sheets, where the beta or beta-like strands are connected by intervening loop portions. Examples of the structural organization for the heavy chain variable domain and the 10Fn3 domain are shown in
Scaffolds for formation of a single domain polypeptides should be highly soluble and stable in physiological conditions. Examples of immunoglobulin scaffolds are the single domain VH or VL scaffold, as well as a single domain camelid VHH domain (a form of variable heavy domain found in camelids) or other immunoglobulin variable domains found in nature or engineered in the laboratory. In the single domain format disclosed herein, an immunoglobulin polypeptide need not form a dimer with a second polypeptide in order to achieve binding activity. Accordingly, any such polypeptides that naturally contain a cysteine which mediates disulfide cross-linking to a second protein can be altered to eliminate the cysteine. Alternatively, the cysteine may be retained for use in conjugating additional moieties, such as PEG, to the single domain polypeptide.
Other scaffolds may be non-antibody scaffold proteins. By “non-antibody scaffold protein or domain” is meant a non-antibody polypeptide having an immunoglobulin-like fold. By “immunoglobulin-like fold” is meant a protein domain of between about 80-150 amino acid residues that includes two layers of antiparallel beta-sheets, and in which the flat, hydrophobic faces of the two beta-sheets are packed against each other. An example of such a scaffold is the “fibronectin-based scaffold protein”, by which is meant a polypeptide based on a fibronectin type III domain (Fn3). Fibronectin is a large protein which plays essential roles in the formation of extracellular matrix and cell-cell interactions; it consists of many repeats of three types (types I, II, and III) of small domains (Baron et al., 1991). Fn3 itself is the paradigm of a large subfamily which includes portions of cell adhesion molecules, cell surface hormone and cytokine receptors, chaperoning, and carbohydrate-binding domains for reviews, see Bork & Doolittle, Proc Natl Acad Sci USA. 1992 Oct. 1; 89(19):8990-4; Bork et al., J Mol Biol. 1994 Sep. 30; 242(4):309-20; Campbell & Spitzfaden, Structure. 1994 May 15; 2(5):333-7; Harpez & Chothia, J Mol Biol. 1994 May 13; 238(4):528-39).
Preferably, the fibronectin-based scaffold protein is a “10FN3” scaffold, by which is meant a polypeptide variant based on the tenth module of the human fibronectin type III protein in which one or more of the solvent accessible loops has been randomized or mutated, particularly one or more of the three loops identified as the BC loop (amino acids 23-30), DE loop (amino acids 52-56) and FG loop (amino acids 77-87) (the numbering scheme is based on the sequence on the tenth Type III domain of human fibronectin, with the amino acids Val-Ser-Asp-Val-Pro representing amino acids numbers 1-5 of SEQ ID NO: 5). The amino acid sequence of the wild-type tenth module of the human fibronectin type III domain is:
Thus, the wild-type BC loop comprises the sequence of DAPAVTVR (residues 23-30 of SEQ ID NO: 5); the wild-type DE loop comprises the sequence of GSKST (residues 52-56 of SEQ ID NO: 5); the wild-type FG loop comprises the sequence of GRGDSPASSKP (residues 77-87 of SEQ ID NO: 5). The sequences flanking the BC, DE, and FG loops are also termed Frameworks 1, 2, 3, and 4, e.g., in Tables 1-3.
A variety of improved mutant 10Fn3 scaffolds have been identified. A modified Asp7, which is replaced by a non-negatively charged amino acid residue (e.g., Asn, Lys, etc.). Both of these mutations have the effect of promoting greater stability of the mutant 10Fn3 at neutral pH as compared to the wild-type form. A variety of additional alterations in the 10Fn3 scaffold that are either beneficial or neutral have been disclosed. See, for example, Batori et al. Protein Eng. 2002 December; 15(12):1015-20; Koide et al., Biochemistry 2001 Aug. 28; 40(34):10326-33.
Additionally, several novel modifications to the 10Fn3 scaffold are disclosed here. Of particular significance, it was discovered that a deletion of the first 8 amino acids of the wild type human 10Fn3 led to roughly three-fold improved VEGFR-2 binding. Because the first 8 amino acids tend to fold into a position that is close to the BC, DE and FG loops, it is expected that this mutation will also improve target binding in other 10Fn3 scaffolds selected for binding to different targets. Accordingly, one may construct a library of nucleic acids encoding 10Fn3 scaffold that lack the first 8 amino acids and conduct screening in this improved library.
Both the variant and wild-type 10Fn3 proteins are characterized by the same structure, namely seven beta-strand domain sequences (designated A through G) and six loop regions (AB loop, BC loop, CD loop, DE loop, EF loop, and FG loop) which connect the seven beta-strand domain sequences. The beta strands positioned closest to the N- and C-termini may adopt a beta-like conformation in solution. In SEQ ID No:5, the AB loop corresponds to residues 15-16, the BC loop corresponds to residues 22-30, the CD loop corresponds to residues 39-45, the DE loop corresponds to residues 51-55, the EF loop corresponds to residues 60-66, and the FG loop corresponds to residues 76-87. As shown in
A single domain polypeptide disclosed herein may have at least five to seven beta or beta-like strands distributed between at least two beta sheets, and at least one loop portion connecting two beta or beta-like strands, which loop portion participates in binding to VEGFR-2, particularly KDR, with the binding characterized by a dissociation constant that is less than 1×10−6M, and preferably less than 1×10−8M. As described herein, polypeptides having a dissociation constant of less than 5×10−9M are particularly desirable for therapeutic use in vivo to inhibit VEGF signaling. Polypeptides having a dissociation constant of between 1×10−6M and 5×10−9M may be desirable for use in detecting or labeling, ex vivo or in vivo, VEGFR-2 proteins.
Optionally, the VEGFR-2 binding protein will bind specifically to VEGFR-2 relative to other related proteins from the same species. By “specifically binds” is meant a polypeptide that recognizes and interacts with a target protein (e.g., VEGFR-2) but that does not substantially recognize and interact with other molecules in a sample, for example, a biological sample. In preferred embodiments a polypeptide of the invention will specifically bind a VEGFR with a KD at least as tight as 500 nM. Preferably, the polypeptide will specifically bind a VEGFR with a KD of 1 pM to 500 nM, more preferably 1 pM to 100 nM, more preferably 1 pM to 10 nM, and most preferably 1 pM to 1 nM or lower.
In general, a library of scaffold single domain polypeptides is screened to identify specific polypeptide variants that can bind to a chosen target. These libraries may be, for example, phage display libraries or PROfusion™ libraries.
In an exemplary embodiment, we have exploited a novel in vitro RNA-protein fusion display technology to isolate polypeptides that bind to both human (KDR) and mouse (Flk-1) VEGFR-2 and inhibit VEGF-dependent biological activities. These polypeptides were identified from libraries of fibronectin-based scaffold proteins (Koide et al, JMB 284:1141 (1998)) and libraries of VL domains in which the diversity of CDR3 has been increased by swapping with CDR3 domains from a population of VH molecules. 10Fn3 comprises approximately 94 amino acid residues, as shown in SEQ ID NO:5.
In addition, as described above, amino acid sequences at the N-terminus of 10Fn3 can also be mutated or deleted. For example, randomization of the BC, DE, and FG loops can occur in the context of a full-length 10Fn3 or in the context of a 10Fn3 having a deletion or mutation of 1-8 amino acids of the N-terminus. For example, the L at position 8 can be mutated to a Q. After randomization to create a diverse library, fibronectin-based scaffold proteins can be used in a screening assay to select for polypeptides with a high affinity for a protein, in this case the VEGFR. (For a detailed description of the RNA-protein fusion technology and fibronectin-based scaffold protein library screening methods see Szostak et al., U.S. Pat. Nos. 6,258,558; 6,261,804; 6,214,553; 6,281,344; 6,207,446; 6,518,018; PCT Publication Numbers WO 00/34784; WO 01/64942; WO 02/032925; and Roberts and Szostak, Proc Natl. Acad. Sci. 94:12297-12302, 1997, herein incorporated by reference.)
For the initial selection described herein, three regions of the 10Fn3 at positions 23-29, 52-55 and 77-86 were randomized and used for in vitro selection against the extracellular domain of human VEGFR-2 (amino acids 1-764 of KDR fused to human IgGlFc). Using mRNA display (RNA-protein fusion) and in vitro selection, we sampled a 10Fn3-based library with approximately ten trillion variants. The initial selection identified polypeptides with moderate affinity (KD=10-200 nM) that competed with VEGF for binding to KDR (human VEGFR-2). Subsequently, a single clone (KD=11-13 nM) from the initial selection was subjected to mutagenesis and further selection. This affinity maturation process yielded new VEGFR binding polypeptides with dissociation constants between 60 pM to 2 nM. KDR binders are shown in Table 3. In addition, we also isolated polypeptides that could bind to Flk-1, the mouse KDR homolog, from mutagenized populations of KDR binders that initially had no detectable binding affinity to Flk-1, resulting in the isolation of polypeptides that exhibit dual specificities to both human and mouse VEGFR-2. These polypeptides are shown to bind cells that display KDR or Flk-1 extracellular domains. They also inhibited cell growth in a VEGF-dependent proliferation assay. Polypeptides that bind to KDR and Flk-1 are shown in Table 2, while a selection of preferred KDR binders and KDR/Flk-1 binders are shown in Table 1.
Using the VEGFR-2 binding polypeptides identified in these selections we determined FG loop amino acid consensus sequences required for the binding of the polypeptides to the VEGFR-2. The sequences are listed as SEQ ID NOs:1-4 below.
VEGFR-2 binding polypeptides, such as those of SEQ ID NOs: 1-4, may be formulated alone (as isolated peptides), as part of a 10Fn3 single domain polypeptide, as part of a full-length fibronectin, (with a full-length amino terminus or a deleted amino terminus) or a fragment thereof, in the context of an immunoglobulin (particularly a single domain immunoglobulin), in the context of another protein having an immunoglobulin-like fold, or in the context of another, unrelated protein. The polypeptides can also be formulated as part of a fusion protein with a heterologous protein that does not itself bind to or contribute in binding to a VEGFR. In addition, the polypeptides of the invention can also be fused to nucleic acids. The polypeptides can also be engineered as monomers, dimers, or multimers.
The CT-01 molecule above has a deletion of the first 8 amino acids and may include additional amino acids at the N- or C-termini. For example, an additional MG sequence may be placed at the N-terminus. The M will usually be cleaved off, leaving a GEV . . . sequence at the N-terminus. The re-addition of the normal 8 amino acids at the N-terminus also produces a KDR binding protein with desirable properties. The N-terminal methionine is generally cleaved off to yield a sequence:
A polypeptide disclosed herein may be modified by one or more conservative substitutions, particularly in portions of the protein that are not expected to interact with a target protein. It is expected that as many as 5%, 10%, 20% or even 30% or more of the amino acids in an immunoglobulin or immunoglobulin-like domain may be altered by a conservative substitution without substantially altering the affinity of the protein for target. It may be that such changes will alter the immunogenicity of the polypeptide in vivo, and where the immunogenicity is decreased, such changes will be desirable. As used herein, “conservative substitutions” are residues that are physically or functionally similar to the corresponding reference residues. That is, a conservative substitution and its reference residue have similar size, shape, electric charge, chemical properties including the ability to form covalent or hydrogen bonds, or the like. Preferred conservative substitutions are those fulfilling the criteria defined for an accepted point mutation in Dayhoff et al., Atlas of Protein Sequence and Structure 5:345-352 (1978 & Supp.). Examples of conservative substitutions are substitutions within the following groups: (a) valine, glycine; (b) glycine, alanine; (c) valine, isoleucine, leucine; (d) aspartic acid, glutamic acid; (e) asparagine, glutamine; (f) serine, threonine; (g) lysine, arginine, methionine; and (h) phenylalanine, tyrosine.
Polypeptides disclosed herein may also be modified in order to improve potency, bioavailability, chemical stability, and/or efficacy. For example, within one embodiment of the invention D-amino acid peptides, or retroenantio peptide sequences may be generated in order to improve the bioactivity and chemical stability of a polypeptide structure (see, e.g., Juvvadi et al., J. Am. Chem. Soc. 118: 8989-8997, 1996; Freidinger et al., Science, 210: 656-658, 1980). Lactam constraints (see Freidinger, supra), and/or azabicycloalkane amino acids as dipeptide surrogates can also be utilized to improve the biological and pharmacological properties of the native peptides (see, e.g., Hanessian et al., Tetrahedron 53:12789-12854, 1997).
Amide bond surrogates, such as thioamides, secondary and tertiary amines, heterocycles among others (see review in Spatola, A. F. in “Chemistry and Biochemistry of Amino Acids, Peptides and Proteins” Wenstein, B. Ed. Marcel Dekker, New York, 1983 Vol. 7, pp 267-357) can also be utilized to prevent enzymatic degradation of the polypeptide backbone thereby resulting in improved activity. Conversion of linear polypeptides to cyclic polypeptide analogs can also be utilized to improve metabolic stability, since cyclic polypeptides are much less sensitive to enzymatic degradation (see generally, Veber, et al. Nature 292:55-58, 1981).
Polypeptides can also be modified utilizing end group capping as esters and amides in order to slow or prevent metabolism and enhance lipophilicity. Dimers of the peptide attached by various linkers may also enhance activity and specificity (see for example: Y. Shimohigashi et al, in Peptide Chemistry 1988, Proceedings of the 26th Symposium on Peptide Chemistry, Tokyo, October 24-26, pgs. 47-50, 1989). For additional examples of polypeptide modifications, such as non-natural amino acids, see U.S. Pat. No. 6,559,126.
For use in vivo, a form suitable for pegylation may be generated. For example, a C-terminal tail comprising a cysteine was added and expressed, as shown below for a CT-01 form lacking the eight N-terminal amino acids (EIDKPCQ is added at the C-terminus (residues 88-94 of SEQ ID NO: 194)).
The pegylated form of this molecule is used in the in vivo experiments described below. A control form with a serine instead of a cysteine was also used:
The same C-terminal tails may also be added to CT-01 forms having the N-terminal eight amino acids, such as is shown in SEQ ID NO:193.
Additional variants with desirable KDR binding properties were isolated. The following core sequence has a somewhat different FG loop, and may be expressed with, for example, an N-terminal MG sequence, an N-terminal sequence that restores the 8 deleted amino acids, and/or a C-terminal tail to provide a cysteine for pegylation. EVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGL KPGVDYTITVYAVTEGPNERSLFIPISINYRT (SEQ ID NO:185). Another such variant has the core sequence:
Additionally, preferred single domain immunoglobulin polypeptides in a VL framework were isolated by similar methodology and are disclosed in
Also included in the present invention are nucleic acid sequences encoding any of the polypeptides described herein. As appreciated by those skilled in the art, because of third base degeneracy, almost every amino acid can be represented by more than one triplet codon in a coding nucleotide sequence. In addition, minor base pair changes may result in a conservative substitution in the amino acid sequence encoded but are not expected to substantially alter the biological activity of the gene product. Therefore, a nucleic acid sequence encoding a polypeptide described herein may be modified slightly in sequence and yet still encode its respective gene product.
In addition, the polypeptides of the present invention can be used as lead polypeptides that can be further mutated and screened for polypeptides that bind VEGFR with an even greater affinity. In one example, a polypeptide described herein is used as a lead polypeptide which is further mutated or randomized to produce polypeptides with amino acid mutations distinct from the lead polypeptide. The further randomized polypeptides can then be used to screen for polypeptides that inhibit VEGF biological activity as described herein (e.g., bind to a VEGFR and block binding of VEGF to the same receptor).
Polypeptides of the present invention can be produced using any standard methods known in the art.
In one example, the polypeptides are produced by recombinant DNA methods by inserting a nucleic acid sequence (e.g., a cDNA) encoding the polypeptide into a recombinant expression vector and expressing the DNA sequence under conditions promoting expression. Examples of nucleic acid sequences encoding a CT-01 polypeptide disclosed herein are:
Nucleic acids encoding any of the various polypeptides disclosed herein may be synthesized chemically. Codon usage may be selected so as to improve expression in a cell. Such codon usage will depend on the cell type selected. Specialized codon usage patterns have been developed for E. coli and other bacteria, as well as mammalian cells, plant cells, yeast cells and insect cells. See for example: Mayfield et al., Proc Natl Acad Sci USA. 2003 Jan. 21; 100(2):438-42; Sinclair et al. Protein Expr Purif. 2002 October; 26(1):96-105; Connell N D. Curr Opin Biotechnol. 2001 October; 12(5):446-9; Makrides et al. Microbiol Rev. 1996 September; 60(3):512-38; and Sharp et al. Yeast. 1991 October; 7(7):657-78.
General techniques for nucleic acid manipulation are described for example in Sambrook et al., Molecular Cloning: A Laboratory Manual, Vols. 1-3, Cold Spring Harbor Laboratory Press, 2 ed., 1989, or F. Ausubel et al., Current Protocols in Molecular Biology (Green Publishing and Wiley-Interscience: New York, 1987) and periodic updates, herein incorporated by reference. The DNA encoding the polypeptide is operably linked to suitable transcriptional or translational regulatory elements derived from mammalian, viral, or insect genes. Such regulatory elements include a transcriptional promoter, an optional operator sequence to control transcription, a sequence encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation. The ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants are additionally incorporated.
The recombinant DNA can also include any type of protein tag sequence that may be useful for purifying the protein. Examples of protein tags include but are not limited to a histidine tag, a FLAG tag, a myc tag, an HA tag, or a GST tag. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts can be found in Cloning Vectors: A Laboratory Manual, (Elsevier, New York, 1985), the relevant disclosure of which is hereby incorporated by reference.
The expression construct is introduced into the host cell using a method appropriate to the host cell, as will be apparent to one of skill in the art. A variety of methods for introducing nucleic acids into host cells are known in the art, including, but not limited to, electroporation; transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (where the vector is an infectious agent).
Suitable host cells include prokaryotes, yeast, mammalian cells, or bacterial cells. Suitable bacteria include gram negative or gram positive organisms, for example, E. coli or Bacillus spp. Yeast, preferably from the Saccharomyces species, such as S. cerevisiae, may also be used for production of polypeptides. Various mammalian or insect cell culture systems can also be employed to express recombinant proteins. Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow and Summers, (Bio/Technology, 6:47, 1988). Examples of suitable mammalian host cell lines include endothelial cells, COS-7 monkey kidney cells, CV-1, L cells, C127, 3T3, Chinese hamster ovary (CHO), human embryonic kidney cells, HeLa, 293, 293T, and BHK cell lines. Purified polypeptides are prepared by culturing suitable host/vector systems to express the recombinant proteins. For many applications, the small size of many of the polypeptides disclosed herein would make expression in E. coli as the preferred method for expression. The protein is then purified from culture media or cell extracts.
Proteins disclosed herein can also be produced using cell-translation systems. For such purposes the nucleic acids encoding the polypeptide must be modified to allow in vitro transcription to produce mRNA and to allow cell-free translation of the mRNA in the particular cell-free system being utilized (eukaryotic such as a mammalian or yeast cell-free translation system or prokaryotic such as a bacterial cell-free translation system.
VEGFR-binding polypeptides can also be produced by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd ed., 1984, The Pierce Chemical Co., Rockford, Ill.). Modifications to the protein can also be produced by chemical synthesis.
The polypeptide of the present invention can be purified by isolation/purification methods for proteins generally known in the field of protein chemistry. Non-limiting examples include extraction, recrystallization, salting out (e.g., with ammonium sulfate or sodium sulfate), centrifugation, dialysis, ultrafiltration, adsorption chromatography, ion exchange chromatography, hydrophobic chromatography, normal phase chromatography, reversed-phase chromatography, gel filtration, gel permeation chromatography, affinity chromatography, electrophoresis, countercurrent distribution or any combinations of these. After purification, polypeptides may be exchanged into different buffers and/or concentrated by any of a variety of methods known to the art, including, but not limited to, filtration and dialysis.
The purified polypeptide is preferably at least 85% pure, more preferably at least 95% pure, and most preferably at least 98% pure. Regardless of the exact numerical value of the purity, the polypeptide is sufficiently pure for use as a pharmaceutical product.
In certain embodiments, the binding polypeptides of the invention may further comprise post-translational modifications. Exemplary post-translational protein modification include phosphorylation, acetylation, methylation, ADP-ribosylation, ubiquitination, glycosylation, carbonylation, sumoylation, biotinylation or addition of a polypeptide side chain or of a hydrophobic group. As a result, the modified soluble polypeptides may contain non-amino acid elements, such as lipids, poly- or mono-saccharide, and phosphates. A preferred form of glycosylation is sialylation, which conjugates one or more sialic acid moieties to the polypeptide. Sialic acid moieties improve solubility and serum half-life while also reducing the possible immunogeneticity of the protein. See, e.g., Raju et al. Biochemistry. 2001 Jul. 31; 40(30):8868-76. Effects of such non-amino acid elements on the functionality of a polypeptide may be tested for its antagonizing role in VEGFR-2 or VEGF function, e.g., its inhibitory effect on angiogenesis or on tumor growth.
In one specific embodiment of the present invention, modified forms of the subject soluble polypeptides comprise linking the subject soluble polypeptides to nonproteinaceous polymers. In one specific embodiment, the polymer is polyethylene glycol (“PEG”), polypropylene glycol, or polyoxyalkylenes, in the manner as set forth in U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or 4,179,337. Examples of the modified polypeptide of the invention include PEGylated M5FL and PEGylated CT-01.
PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161). The term “PEG” is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented by the formula: X—O(CH2CH2O)n-1CH2CH2OH (1), where n is 20 to 2300 and X is H or a terminal modification, e.g., a C1-4 alkyl. In one embodiment, the PEG of the invention terminates on one end with hydroxy or methoxy, i.e., X is H or CH3 (“methoxy PEG”). A PEG can contain further chemical groups which are necessary for binding reactions; which results from the chemical synthesis of the molecule; or which is a spacer for optimal distance of parts of the molecule. In addition, such a PEG can consist of one or more PEG side-chains which are linked together. PEGs with more than one PEG chain are called multiarmed or branched PEGs. Branched PEGs can be prepared, for example, by the addition of polyethylene oxide to various polyols, including glycerol, pentaerythriol, and sorbitol. For example, a four-armed branched PEG can be prepared from pentaerythriol and ethylene oxide. Branched PEG are described in, for example, EP-A 0 473 084 and U.S. Pat. No. 5,932,462. One form of PEGs includes two PEG side-chains (PEG2) linked via the primary amino groups of a lysine (Monfardini, C., et al., Bioconjugate Chem. 6 (1995) 62-69).
Although PEG is well-known, this is, to our knowledge, the first demonstration that a pegylated 10Fn3 polypeptide can be pegylated and retain ligand binding activity. In a preferred embodiment, the pegylated 10Fn3 polypeptide is produced by site-directed pegylation, particularly by conjugation of PEG to a cysteine moiety at the N- or C-terminus. Accordingly, the present disclosure provides a target-binding 10Fn3 polypeptide with improved pharmacokinetic properties, the polypeptide comprising: a 10Fn3 domain having from about 80 to about 150 amino acids, wherein at least one of the loops of said 10Fn3 domain participate in target binding; and a covalently bound PEG moiety, wherein said 10Fn3 polypeptide binds to the target with a KD of less than 100 nM and has a clearance rate of less than 30 mL/hr/kg in a mammal. The PEG moiety may be attached to the 10Fn3 polypeptide by site directed pegylation, such as by attachment to a Cys residue, where the Cys residue may be positioned at the N-terminus of the 10Fn3 polypeptide or between the N-terminus and the most N-terminal beta or beta-like strand or at the C-terminus of the 10Fn3 polypeptide or between the C-terminus and the most C-terminal beta or beta-like strand. A Cys residue may be situated at other positions as well, particularly any of the loops that do not participate in target binding. A PEG moiety may also be attached by other chemistry, including by conjugation to amines.
PEG conjugation to peptides or proteins generally involves the activation of PEG and coupling of the activated PEG-intermediates directly to target proteins/peptides or to a linker, which is subsequently activated and coupled to target proteins/peptides (see Abuchowski, A. et al, J. Biol. Chem., 252, 3571 (1977) and J. Biol. Chem., 252, 3582 (1977), Zalipsky, et al., and Harris et. al., in: Poly(ethylene glycol) Chemistry: Biotechnical and Biomedical Applications; (J. M. Harris ed.) Plenum Press: New York, 1992; Chap. 21 and 22). It is noted that a binding polypeptide containing a PEG molecule is also known as a conjugated protein, whereas the protein lacking an attached PEG molecule can be referred to as unconjugated.
A variety of molecular mass forms of PEG can be selected, e.g., from about 1,000 Daltons (Da) to 100,000 Da (n is 20 to 2300), for conjugating to VEGFR-2 binding polypeptides. The number of repeating units “n” in the PEG is approximated for the molecular mass described in Daltons. It is preferred that the combined molecular mass of PEG on an activated linker is suitable for pharmaceutical use. Thus, in one embodiment, the molecular mass of the PEG molecules does not exceed 100,000 Da. For example, if three PEG molecules are attached to a linker, where each PEG molecule has the same molecular mass of 12,000 Da (each n is about 270), then the total molecular mass of PEG on the linker is about 36,000 Da (total n is about 820). The molecular masses of the PEG attached to the linker can also be different, e.g., of three molecules on a linker two PEG molecules can be 5,000 Da each (each n is about 110) and one PEG molecule can be 12,000 Da (n is about 270).
In a specific embodiment of the invention, a VEGFR-2 binding polypeptide is covalently linked to one poly(ethylene glycol) group of the formula: —CO—(CH2)x—(OCH2CH2)m—OR, with the —CO (i.e. carbonyl) of the poly(ethylene glycol) group forming an amide bond with one of the amino groups of the binding polypeptide; R being lower alkyl; x being 2 or 3; m being from about 450 to about 950; and n and m being chosen so that the molecular weight of the conjugate minus the binding polypeptide is from about 10 to 40 kDa. In one embodiment, an binding polypeptide's ε-amino group of a lysine is the available (free) amino group.
The above conjugates may be more specifically presented by formula (II): P—NHCO—(CH2)×—(OCH2CH2)m—OR (II), wherein P is the group of a binding polypeptide as described herein, (i.e. without the amino group or amino groups which form an amide linkage with the carbonyl shown in formula (II); and wherein R is lower alkyl; x is 2 or 3; m is from about 450 to about 950 and is chosen so that the molecular weight of the conjugate minus the binding polypeptide is from about 10 to about 40 kDa. As used herein, the given ranges of “m” have an orientational meaning. The ranges of “m” are determined in any case, and exactly, by the molecular weight of the PEG group.
One skilled in the art can select a suitable molecular mass for PEG, e.g., based on how the pegylated binding polypeptide will be used therapeutically, the desired dosage, circulation time, resistance to proteolysis, immunogenicity, and other considerations. For a discussion of PEG and its use to enhance the properties of proteins, see N. V. Katre, Advanced Drug Delivery Reviews 10: 91-114 (1993).
In one embodiment of the invention, PEG molecules may be activated to react with amino groups on a binding polypeptide, such as with lysines (Bencham C. O. et al., Anal. Biochem., 131, 25 (1983); Veronese, F. M. et al., Appl. Biochem., 11, 141 (1985); Zalipsky, S. et al., Polymeric Drugs and Drug Delivery Systems, adrs 9-110 ACS Symposium Series 469 (1999); Zalipsky, S. et al., Europ. Polym. J., 19, 1177-1183 (1983); Delgado, C. et al., Biotechnology and Applied Biochemistry, 12, 119-128 (1990)).
In one specific embodiment, carbonate esters of PEG are used to form the PEG-binding polypeptide conjugates. N,N′-disuccinimidylcarbonate (DSC) may be used in the reaction with PEG to form active mixed PEG-succinimidyl carbonate that may be subsequently reacted with a nucleophilic group of a linker or an amino group of a binding polypeptide (see U.S. Pat. Nos. 5,281,698 and 5,932,462). In a similar type of reaction, 1,1′-(dibenzotriazolyl)carbonate and di-(2-pyridyl)carbonate may be reacted with PEG to form PEG-benzotriazolyl and PEG-pyridyl mixed carbonate (U.S. Pat. No. 5,382,657), respectively.
Pegylation of a 10Fn3 polypeptide can be performed according to the methods of the state of the art, for example by reaction of the binding polypeptide with electrophilically active PEGs (supplier: Shearwater Corp., USA. Preferred PEG reagents of the present invention are, e.g., N-hydroxysuccinimidyl propionates (PEG-SPA), butanoates (PEG-SBA), PEG-succinimidyl propionate or branched N-hydroxysuccinimides such as mPEG2-NHS (Monfardini, C., et al., Bioconjugate Chem. 6 (1995) 62-69). Such methods may used to pegylated at an ε-amino group of a binding polypeptide lysine or the N-terminal amino group of the binding polypeptide.
In another embodiment, PEG molecules may be coupled to sulfhydryl groups on a binding polypeptide (Sartore, L., et al., Appl. Biochem. Biotechnol., 27, 45 (1991); Morpurgo et al., Biocon. Chem., 7, 363-368 (1996); Goodson et al., Bio/Technology (1990) 8, 343; U.S. Pat. No. 5,766,897). U.S. Pat. Nos. 6,610,281 and 5,766,897 describes exemplary reactive PEG species that may be coupled to sulfhydryl groups.
In some embodiments where PEG molecules are conjugated to cysteine residues on a binding polypeptide, the cysteine residues are native to the binding polypeptide, whereas in other embodiments, one or more cysteine residues are engineered into the binding polypeptide. Mutations may be introduced into an binding polypeptide coding sequence to generate cysteine residues. This might be achieved, for example, by mutating one or more amino acid residues to cysteine. Preferred amino acids for mutating to a cysteine residue include serine, threonine, alanine and other hydrophilic residues. Preferably, the residue to be mutated to cysteine is a surface-exposed residue. Algorithms are well-known in the art for predicting surface accessibility of residues based on primary sequence or a protein. Alternatively, surface residues may be predicted by comparing the amino acid sequences of binding polypeptides, given that the crystal structure of the framework based on which binding polypeptides are designed and evolved has been solved (see Himanen et al., Nature. (2001) 20-27; 414(6866):933-8) and thus the surface-exposed residues identified. In one embodiment, cysteine residues are introduced into binding polypeptides at or near the N- and/or C-terminus, or within loop regions.
In some embodiments, the pegylated binding polypeptide comprises a PEG molecule covalently attached to the alpha amino group of the N-terminal amino acid. Site specific N-terminal reductive amination is described in Pepinsky et al., (2001) JPET, 297, 1059, and U.S. Pat. No. 5,824,784. The use of a PEG-aldehyde for the reductive amination of a protein utilizing other available nucleophilic amino groups is described in U.S. Pat. No. 4,002,531, in Wieder et al., (1979) J. Biol. Chem. 254, 12579, and in Chamow et al., (1994) Bioconjugate Chem. 5, 133.
In another embodiment, pegylated binding polypeptide comprises one or more PEG molecules covalently attached to a linker, which in turn is attached to the alpha amino group of the amino acid residue at the N-terminus of the binding polypeptide. Such an approach is disclosed in U.S. Patent Publication No. 2002/0044921 and in WO94/01451.
In one embodiment, a binding polypeptide is pegylated at the C-terminus. In a specific embodiment, a protein is pegylated at the C-terminus by the introduction of C-terminal azido-methionine and the subsequent conjugation of a methyl-PEG-triarylphosphine compound via the Staudinger reaction. This C-terminal conjugation method is described in Cazalis et al., C-Terminal Site-Specific PEGylation of a Truncated Thrombomodulin Mutant with Retention of Full Bioactivity, Bioconjug Chem. 2004; 15(5):1005-1009.
Monopegylation of a binding polypeptide can also be produced according to the general methods described in WO 94/01451. WO 94/01451 describes a method for preparing a recombinant polypeptide with a modified terminal amino acid alpha-carbon reactive group. The steps of the method involve forming the recombinant polypeptide and protecting it with one or more biologically added protecting groups at the N-terminal alpha-amine and C-terminal alpha-carboxyl. The polypeptide can then be reacted with chemical protecting agents to selectively protect reactive side chain groups and thereby prevent side chain groups from being modified. The polypeptide is then cleaved with a cleavage reagent specific for the biological protecting group to form an unprotected terminal amino acid alpha-carbon reactive group. The unprotected terminal amino acid alpha-carbon reactive group is modified with a chemical modifying agent. The side chain protected terminally modified single copy polypeptide is then deprotected at the side chain groups to form a terminally modified recombinant single copy polypeptide. The number and sequence of steps in the method can be varied to achieve selective modification at the N- and/or C-terminal amino acid of the polypeptide.
The ratio of a binding polypeptide to activated PEG in the conjugation reaction can be from about 1:0.5 to 1:50, between from about 1:1 to 1:30, or from about 1:5 to 1:15. Various aqueous buffers can be used in the present method to catalyze the covalent addition of PEG to the binding polypeptide. In one embodiment, the pH of a buffer used is from about 7.0 to 9.0. In another embodiment, the pH is in a slightly basic range, e.g., from about 7.5 to 8.5. Buffers having a pKa close to neutral pH range may be used, e.g., phosphate buffer.
Conventional separation and purification techniques known in the art can be used to purify PEGylated binding polypeptide, such as size exclusion (e.g. gel filtration) and ion exchange chromatography. Products may also be separated using SDS-PAGE. Products that may be separated include mono-, di-, tri- poly- and unpegylated binding polypeptide, as well as free PEG. The percentage of mono-PEG conjugates can be controlled by pooling broader fractions around the elution peak to increase the percentage of mono-PEG in the composition. About ninety percent mono-PEG conjugates represents a good balance of yield and activity. Compositions in which, for example, at least ninety-two percent or at least ninety-six percent of the conjugates are mono-PEG species may be desired. In an embodiment of this invention the percentage of mono-PEG conjugates is from ninety percent to ninety-six percent.
In one embodiment, PEGylated binding polypeptide of the invention contain one, two or more PEG moieties. In one embodiment, the PEG moiety(ies) are bound to an amino acid residue which is on the surface of the protein and/or away from the surface that contacts the target ligand. In one embodiment, the combined or total molecular mass of PEG in PEG-binding polypeptide is from about 3,000 Da to 60,000 Da, optionally from about 10,000 Da to 36,000 Da. In a one embodiment, the PEG in pegylated binding polypeptide is a substantially linear, straight-chain PEG.
In one embodiment of the invention, the PEG in pegylated binding polypeptide is not hydrolyzed from the pegylated amino acid residue using a hydroxylamine assay, e.g., 450 mM hydroxylamine (pH 6.5) over 8 to 16 hours at room temperature, and is thus stable. In one embodiment, greater than 80% of the composition is stable mono-PEG-binding polypeptide, more preferably at least 90%, and most preferably at least 95%.
In another embodiment, the pegylated binding polypeptides of the invention will preferably retain at least 25%, 50%, 60%, 70% least 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified protein. In one embodiment, biological activity refers to its ability to bind to VEGFR-2, as assessed by KD, kon or koff. In one specific embodiment, the pegylated binding polypeptide protein shows an increase in binding to VEGFR relative to unpegylated binding polypeptide.
The serum clearance rate of PEG-modified polypeptide may be decreased by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or even 90%, relative to the clearance rate of the unmodified binding polypeptide. The PEG-modified polypeptide may have a half-life (t1/2) which is enhanced relative to the half-life of the unmodified protein. The half-life of PEG-binding polypeptide may be enhanced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 400% or 500%, or even by 1000% relative to the half-life of the unmodified binding polypeptide. In some embodiments, the protein half-life is determined in vitro, such as in a buffered saline solution or in serum. In other embodiments, the protein half-life is an in vivo half life, such as the half-life of the protein in the serum or other bodily fluid of an animal.
The present invention features methods for treating conditions or preventing pre-conditions which respond to an inhibition of VEGF biological activity. Preferred examples are conditions that are characterized by inappropriate angiogenesis. Techniques and dosages for administration vary depending on the type of specific polypeptide and the specific condition being treated but can be readily determined by the skilled artisan. In general, regulatory agencies require that a protein reagent to be used as a therapeutic is formulated so as to have acceptably low levels of pyrogens. Accordingly, therapeutic formulations will generally be distinguished from other formulations in that they are substantially pyrogen free, or at least contain no more than acceptable levels of pyrogen as determined by the appropriate regulatory agency (e.g., FDA).
Therapeutic compositions of the present invention may be administered with a pharmaceutically acceptable diluent, carrier, or excipient, in unit dosage form. Administration may be parenteral (e.g., intravenous, subcutaneous), oral, or topical, as non-limiting examples. In addition, any gene therapy technique, using nucleic acids encoding the polypeptides of the invention, may be employed, such as naked DNA delivery, recombinant genes and vectors, cell-based delivery, including ex vivo manipulation of patients' cells, and the like.
The composition can be in the form of a pill, tablet, capsule, liquid, or sustained release tablet for oral administration; or a liquid for intravenous, subcutaneous or parenteral administration; gel, lotion, ointment, cream, or a polymer or other sustained release vehicle for local administration.
Methods well known in the art for making formulations are found, for example, in “Remington: The Science and Practice of Pharmacy” (20th ed., ed. A. R. Gennaro A R., 2000, Lippincott Williams & Wilkins, Philadelphia, Pa.). Formulations for parenteral administration may, for example, contain excipients, sterile water, saline, polyalkylene glycols such as polyethylene glycol, oils of vegetable origin, or hydrogenated napthalenes. Biocompatible, biodegradable lactide polymer, lactide/glycolide copolymer, or polyoxyethylene-polyoxypropylene copolymers may be used to control the release of the compounds. Nanoparticulate formulations (e.g., biodegradable nanoparticles, solid lipid nanoparticles, liposomes) may be used to control the biodistribution of the compounds. Other potentially useful parenteral delivery systems include ethylene-vinyl acetate copolymer particles, osmotic pumps, implantable infusion systems, and liposomes. The concentration of the compound in the formulation varies depending upon a number of factors, including the dosage of the drug to be administered, and the route of administration.
The polypeptide may be optionally administered as a pharmaceutically acceptable salt, such as non-toxic acid addition salts or metal complexes that are commonly used in the pharmaceutical industry. Examples of acid addition salts include organic acids such as acetic, lactic, pamoic, maleic, citric, malic, ascorbic, succinic, benzoic, palmitic, suberic, salicylic, tartaric, methanesulfonic, toluenesulfonic, or trifluoroacetic acids or the like; polymeric acids such as tannic acid, carboxymethyl cellulose, or the like; and inorganic acid such as hydrochloric acid, hydrobromic acid, sulfuric acid phosphoric acid, or the like. Metal complexes include zinc, iron, and the like. In one example, the polypeptide is formulated in the presence of sodium acetate to increase thermal stability.
Formulations for oral use include tablets containing the active ingredient(s) in a mixture with non-toxic pharmaceutically acceptable excipients. These excipients may be, for example, inert diluents or fillers (e.g., sucrose and sorbitol), lubricating agents, glidants, and anti-adhesives (e.g., magnesium stearate, zinc stearate, stearic acid, silicas, hydrogenated vegetable oils, or talc).
Formulations for oral use may also be provided as chewable tablets, or as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium.
A therapeutically effective dose refers to a dose that produces the therapeutic effects for which it is administered. The exact dose will depend on the disorder to be treated, and may be ascertained by one skilled in the art using known techniques. In general, the polypeptide is administered at about 0.01 μg/kg to about 50 mg/kg per day, preferably 0.01 mg/kg to about 30 mg/kg per day, most preferably 0.1 mg/kg to about 20 mg/kg per day. The polypeptide may be given daily (e.g., once, twice, three times, or four times daily) or less frequently (e.g., once every other day, once or twice weekly, or monthly). In addition, as is known in the art, adjustments for age as well as the body weight, general health, sex, diet, time of administration, drug interaction, and the severity of the disease may be necessary, and will be ascertainable with routine experimentation by those skilled in the art.
The VEGFR-2 binding proteins described herein and their related variants are useful in a number of therapeutic and diagnostic applications. These include the inhibition of the biological activity of VEGF by competing for or blocking the binding to a VEGFR-2 as well as the delivery of cytotoxic or imaging moieties to cells, preferably cells expressing VEGFR-2.
The small size and stable structure of these molecules can be particularly valuable with respect to manufacturing of the drug, rapid clearance from the body for certain applications where rapid clearance is desired or formulation into novel delivery systems that are suitable or improved using a molecule with such characteristics.
On the basis of their efficacy as inhibitors of VEGF biological activity, the polypeptides of the invention are effective against a number of conditions associated with inappropriate angiogenesis, including but not limited to autoimmune disorders (e.g., rheumatoid arthritis, inflammatory bowel disease or psoriasis); cardiac disorders (e.g., atherosclerosis or blood vessel restenosis); retinopathies (e.g., proliferative retinopathies generally, diabetic retinopathy, age-related macular degeneration or neovascular glaucoma), renal disease (e.g., diabetic nephropathy, malignant nephrosclerosis, thrombotic microangiopathy syndromes; transplant rejection; inflammatory renal disease; glomerulonephritis; mesangioproliferative glomerulonephritis; haemolytic-uraemic syndrome; and hypertensive nephrosclerosis); hemangioblastoma; hemangiomas; thyroid hyperplasias; tissue transplantations; chronic inflammation; Meigs's syndrome; pericardial effusion; pleural effusion; autoimmune diseases; diabetes; endometriosis; chronic asthma; undesirable fibrosis (particularly hepatic fibrosis) and cancer, as well as complications arising from cancer, such as pleural effusion and ascites. Preferably, the VEGFR-binding polypeptides of the invention can be used for the treatment of prevention of hyperproliferative diseases or cancer and the metastatic spread of cancers. Non-limiting examples of cancers include bladder, blood, bone, brain, breast, cartilage, colon kidney, liver, lung, lymph node, nervous tissue, ovary, pancreatic, prostate, skeletal muscle, skin, spinal cord, spleen, stomach, testes, thymus, thyroid, trachea, urogenital tract, ureter, urethra, uterus, or vaginal cancer. Additional treatable conditions can be found in U.S. Pat. No. 6,524,583, herein incorporated by reference. Other references describing uses for VEGFR-2 binding polypeptides include: McLeod D S et al., Invest Ophthalmol Vis Sci. 2002 February; 43(2):474-82; Watanabe et al. Exp Dermatol. 2004 November; 13(11):671-81; Yoshiji H et al., Gut. 2003 September; 52(9):1347-54; Verheul et al., Oncologist. 2000; 5 Suppl 1:45-50; Boldicke et al., Stem Cells. 2001; 19(1):24-36.
As described herein, angiogenesis-associated diseases include, but are not limited to, angiogenesis-dependent cancer, including, for example, solid tumors, blood born tumors such as leukemias, and tumor metastases; benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas; inflammatory disorders such as immune and non-immune inflammation; chronic articular rheumatism and psoriasis; ocular angiogenic diseases, for example, diabetic retinopathy, retinopathy of prematurity, macular degeneration, corneal graft rejection, neovascular glaucoma, retrolental fibroplasia, rubeosis; Osler-Webber Syndrome; myocardial angiogenesis; plaque neovascularization; telangiectasia; hemophiliac joints; angiofibroma; and wound granulation and wound healing; telangiectasia psoriasis scleroderma, pyogenic granuloma, cororany collaterals, ischemic limb angiogenesis, corneal diseases, rubeosis, arthritis, diabetic neovascularization, fractures, vasculogenesis, hematopoiesis.
A VEGFR-2 binding polypeptide can be administered alone or in combination with one or more additional therapies such as chemotherapy radiotherapy, immunotherapy, surgical intervention, or any combination of these. Long-term therapy is equally possible as is adjuvant therapy in the context of other treatment strategies, as described above.
In certain embodiments of such methods, one or more polypeptide therapeutic agents can be administered, together (simultaneously) or at different times (sequentially). In addition, polypeptide therapeutic agents can be administered with another type of compounds for treating cancer or for inhibiting angiogenesis.
In certain embodiments, the subject therapeutic agents of the invention can be used alone. Alternatively, the subject agents may be used in combination with other conventional anti-cancer therapeutic approaches directed to treatment or prevention of proliferative disorders (e.g., tumor). For example, such methods can be used in prophylactic cancer prevention, prevention of cancer recurrence and metastases after surgery, and as an adjuvant of other conventional cancer therapy. The present invention recognizes that the effectiveness of conventional cancer therapies (e.g., chemotherapy, radiation therapy, phototherapy, immunotherapy, and surgery) can be enhanced through the use of a subject polypeptide therapeutic agent.
A wide array of conventional compounds have been shown to have anti-neoplastic activities. These compounds have been used as pharmaceutical agents in chemotherapy to shrink solid tumors, prevent metastases and further growth, or decrease the number of malignant cells in leukemic or bone marrow malignancies. Although chemotherapy has been effective in treating various types of malignancies, many anti-neoplastic compounds induce undesirable side effects. It has been shown that when two or more different treatments are combined, the treatments may work synergistically and allow reduction of dosage of each of the treatments, thereby reducing the detrimental side effects exerted by each compound at higher dosages. In other instances, malignancies that are refractory to a treatment may respond to a combination therapy of two or more different treatments.
When a polypeptide therapeutic agent of the present invention is administered in combination with another conventional anti-neoplastic agent, either concomitantly or sequentially, such therapeutic agent may be found to enhance the therapeutic effect of the anti-neoplastic agent or overcome cellular resistance to such anti-neoplastic agent. This allows decrease of dosage of an anti-neoplastic agent, thereby reducing the undesirable side effects, or restores the effectiveness of an anti-neoplastic agent in resistant cells.
Pharmaceutical compounds that may be used for combinatory anti-tumor therapy include, merely to illustrate: aminoglutethimide, amsacrine, anastrozole, asparaginase, bcg, bicalutamide, bleomycin, buserelin, busulfan, campothecin, capecitabine, carboplatin, carmustine, chlorambucil, cisplatin, cladribine, clodronate, colchicine, cyclophosphamide, cyproterone, cytarabine, dacarbazine, dactinomycin, daunorubicin, dienestrol, diethylstilbestrol, docetaxel, doxorubicin, epirubicin, estradiol, estramustine, etoposide, exemestane, filgrastim, fludarabine, fludrocortisone, fluorouracil, fluoxymesterone, flutamide, gemcitabine, genistein, goserelin, hydroxyurea, idarubicin, ifosfamide, imatinib, interferon, irinotecan, ironotecan, letrozole, leucovorin, leuprolide, levamisole, lomustine, mechlorethamine, medroxyprogesterone, megestrol, melphalan, mercaptopurine, mesna, methotrexate, mitomycin, mitotane, mitoxantrone, nilutamide, nocodazole, octreotide, oxaliplatin, paclitaxel, pamidronate, pentostatin, plicamycin, porfimer, procarbazine, raltitrexed, rituximab, streptozocin, suramin, tamoxifen, temozolomide, teniposide, testosterone, thioguanine, thiotepa, titanocene dichloride, topotecan, trastuzumab, tretinoin, vinblastine, vincristine, vindesine, and vinorelbine.
Certain chemotherapeutic anti-tumor compounds may be categorized by their mechanism of action into, for example, following groups: anti-metabolites/anti-cancer agents, such as pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine) and purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (paclitaxel, docetaxel), vincristin, vinblastin, nocodazole, epothilones and navelbine, epidipodophyllotoxins (etoposide, teniposide), DNA damaging agents (actinomycin, amsacrine, anthracyclines, bleomycin, busulfan, camptothecin, carboplatin, chlorambucil, cisplatin, cyclophosphamide, cytoxan, dactinomycin, daunorubicin, doxorubicin, epirubicin, hexamethylmelamineoxaliplatin, iphosphamide, melphalan, merchlorehtamine, mitomycin, mitoxantrone, nitrosourea, plicamycin, procarbazine, taxol, taxotere, teniposide, triethylenethiophosphoramide and etoposide (VP16)); antibiotics such as dactinomycin (actinomycin D), daunorubicin, doxorubicin (adriamycin), idarubicin, anthracyclines, mitoxantrone, bleomycins, plicamycin (mithramycin) and mitomycin; enzymes (L-asparaginase which systemically metabolizes L-asparagine and deprives cells which do not have the capacity to synthesize their own asparagine); antiplatelet agents; antiproliferative/antimitotic alkylating agents such as nitrogen mustards (mechlorethamine, cyclophosphamide and analogs, melphalan, chlorambucil), ethylenimines and methylmelamines (hexamethylmelamine and thiotepa), alkyl sulfonates-busulfan, nitrosoureas (carmustine (BCNU) and analogs, streptozocin), trazenes-dacarbazinine (DTIC); antiproliferative/antimitotic antimetabolites such as folic acid analogs (methotrexate); platinum coordination complexes (cisplatin, carboplatin), procarbazine, hydroxyurea, mitotane, aminoglutethimide; hormones, hormone analogs (estrogen, tamoxifen, goserelin, bicalutamide, nilutamide) and aromatase inhibitors (letrozole, anastrozole); anticoagulants (heparin, synthetic heparin salts and other inhibitors of thrombin); fibrinolytic agents (such as tissue plasminogen activator, streptokinase and urokinase), aspirin, dipyridamole, ticlopidine, clopidogrel, abciximab; antimigratory agents; antisecretory agents (breveldin); immunosuppressives (cyclosporine, tacrolimus (FK-506), sirolimus (rapamycin), azathioprine, mycophenolate mofetil); anti-angiogenic compounds (TNP-470, genistein) and growth factor inhibitors (e.g., VEGF inhibitors, fibroblast growth factor (FGF) inhibitors); angiotensin receptor blocker; nitric oxide donors; anti-sense oligonucleotides; antibodies (trastuzumab); cell cycle inhibitors and differentiation inducers (tretinoin); mTOR inhibitors, topoisomerase inhibitors (doxorubicin (adriamycin), amsacrine, camptothecin, daunorubicin, dactinomycin, eniposide, epirubicin, etoposide, idarubicin and mitoxantrone, topotecan, irinotecan), corticosteroids (cortisone, dexamethasone, hydrocortisone, methylpednisolone, prednisone, and prenisolone); growth factor signal transduction kinase inhibitors; mitochondrial dysfunction inducers and caspase activators; and chromatin disruptors.
In certain embodiments, pharmaceutical compounds that may be used for combinatory anti-angiogenesis therapy include: (1) inhibitors of release of “angiogenic molecules,” such as bFGF (basic fibroblast growth factor); (2) neutralizers of angiogenic molecules, such as an anti-βbFGF antibodies; and (3) inhibitors of endothelial cell response to angiogenic stimuli, including collagenase inhibitor, basement membrane turnover inhibitors, angiostatic steroids, fungal-derived angiogenesis inhibitors, platelet factor 4, thrombospondin, arthritis drugs such as D-penicillamine and gold thiomalate, vitamin D3 analogs, alpha-interferon, and the like. For additional proposed inhibitors of angiogenesis, see Blood et al., Bioch. Biophys. Acta., 1032:89-118 (1990), Moses et al., Science, 248:1408-1410 (1990), Ingber et al., Lab. Invest., 59:44-51 (1988), and U.S. Pat. Nos. 5,092,885, 5,112,946, 5,192,744, 5,202,352, and 6,573,256. In addition, there are a wide variety of compounds that can be used to inhibit angiogenesis, for example, endostatin protein or derivatives, lysine binding fragments of angiostatin, melanin or melanin-promoting compounds, plasminogen fragments (e.g., Kringles 1-3 of plasminogen), tropoin subunits, antagonists of vitronectin αvβ3, peptides derived from Saposin B, antibiotics or analogs (e.g., tetracycline, or neomycin), dienogest-containing compositions, compounds comprising a MetAP-2 inhibitory core coupled to a peptide, the compound EM-138, chalcone and its analogs, and naaladase inhibitors. See, for example, U.S. Pat. Nos. 6,395,718, 6,462,075, 6,465,431, 6,475,784, 6,482,802, 6,482,810, 6,500,431, 6,500,924, 6,518,298, 6,521,439, 6,525,019, 6,538,103, 6,544,758, 6,544,947, 6,548,477, 6,559,126, and 6,569,845.
Depending on the nature of the combinatory therapy, administration of the polypeptide therapeutic agents of the invention may be continued while the other therapy is being administered and/or thereafter. Administration of the polypeptide therapeutic agents may be made in a single dose, or in multiple doses. In some instances, administration of the polypeptide therapeutic agents is commenced at least several days prior to the conventional therapy, while in other instances, administration is begun either immediately before or at the time of the administration of the conventional therapy.
The VEGFR-2 binding proteins described herein can also be detectably labeled and used to contact cells expressing VEGFR-2 for imaging applications or diagnostic applications. For diagnostic purposes, the polypeptide of the invention is preferably immobilized on a solid support. Preferred solid supports include columns (for example, affinity columns, such as agarose-based affinity columns), microchips, or beads.
In one example of a diagnostic application, a biological sample, such as serum or a tissue biopsy, from a patient suspected of having a condition characterized by inappropriate angiogenesis is contacted with a detectably labeled polypeptide of the invention to detect levels of VEGFR-2. The levels of VEGFR-2 detected are then compared to levels of VEGFR-2 detected in a normal sample also contacted with the labeled polypeptide. An increase of at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or 90% in the levels of the VEGFR-2 may be considered a diagnostic indicator of a condition characterized by inappropriate angiogenesis.
In certain embodiments, the VEGFR-2 binding polypeptides of the invention are further attached to a label that is able to be detected (e.g., the label can be a radioisotope, fluorescent compound, enzyme or enzyme co-factor). The active moiety may be a radioactive agent, such as: radioactive heavy metals such as iron chelates, radioactive chelates of gadolinium or manganese, positron emitters of oxygen, nitrogen, iron, carbon, or gallium, 43K, 52Fe, 57Co, 67Cu, 67Ga, 68Ga, 123I, 125I, 131I, 132I, or 99Tc. A binding agent affixed to such a moiety may be used as an imaging agent and is administered in an amount effective for diagnostic use in a mammal such as a human and the localization and accumulation of the imaging agent is then detected. The localization and accumulation of the imaging agent may be detected by radioscintigraphy, nuclear magnetic resonance imaging, computed tomography or positron emission tomography. Immunoscintigraphy using VEGFR-2 binding polypeptides directed at VEGFR may be used to detect and/or diagnose cancers and vasculature. For example, any of the binding polypeptide against the VEGFR-2 marker labeled with 99Technetium, 111Indium, or 125Iodine may be effectively used for such imaging. As will be evident to the skilled artisan, the amount of radioisotope to be administered is dependent upon the radioisotope. Those having ordinary skill in the art can readily formulate the amount of the imaging agent to be administered based upon the specific activity and energy of a given radionuclide used as the active moiety. Typically 0.1-100 millicuries per dose of imaging agent, preferably 1-10 millicuries, most often 2-5 millicuries are administered. Thus, compositions according to the present invention useful as imaging agents comprising a targeting moiety conjugated to a radioactive moiety comprise 0.1-100 millicuries, in some embodiments preferably 1-10 millicuries, in some embodiments preferably 2-5 millicuries, in some embodiments more preferably 1-5 millicuries.
The VEGFR-2 binding polypeptides of the present invention can also be used to deliver additional therapeutic agents (including but not limited to drug compounds, chemotherapeutic compounds, and radiotherapeutic compounds) to a cell or tissue expressing VEGFR-2. In one example, the VEGFR-2 binding polypeptide is fused to a chemotherapeutic agent for targeted delivery of the chemotherapeutic agent to a tumor cell or tissue expressing VEGFR-2.
The VEGFR-2 binding polypeptides of the present invention are useful in a variety of applications, including research, diagnostic and therapeutic applications. For instance, they can be used to isolate and/or purify receptor or portions thereof, and to study receptor structure (e.g., conformation) and function.
In certain aspects, the various binding polypeptides of the present invention can be used to detect or measure the expression of VEGFR-2, for example, on endothelial cells (e.g., venous endothelial cells), or on cells transfected with a VEGFR-2 gene. Thus, they also have utility in applications such as cell sorting and imaging (e.g., flow cytometry, and fluorescence activated cell sorting), for diagnostic or research purposes.
In certain embodiments, the binding polypeptides of fragments thereof can be labeled or unlabeled for diagnostic purposes. Typically, diagnostic assays entail detecting the formation of a complex resulting from the binding of a binding polypeptide to VEGFR-2. The binding polypeptides or fragments can be directly labeled, similar to antibodies. A variety of labels can be employed, including, but not limited to, radionuclides, fluorescers, enzymes, enzyme substrates, enzyme cofactors, enzyme inhibitors and ligands (e.g., biotin, haptens). Numerous appropriate immunoassays are known to the skilled artisan (see, for example, U.S. Pat. Nos. 3,817,827; 3,850,752; 3,901,654; and 4,098,876). When unlabeled, the binding polypeptides can be used in assays, such as agglutination assays. Unlabeled binding polypeptides can also be used in combination with another (one or more) suitable reagent which can be used to detect the binding polypeptide, such as a labeled antibody reactive with the binding polypeptide or other suitable reagent (e.g., labeled protein A).
In one embodiment, the binding polypeptides of the present invention can be utilized in enzyme immunoassays, wherein the subject polypeptides are conjugated to an enzyme. When a biological sample comprising a VEGFR-2 protein is combined with the subject binding polypeptides, binding occurs between the binding polypeptides and the VEGFR-2 protein. In one embodiment, a sample containing cells expressing a VEGFR protein (e.g., endothelial cells) is combined with the subject antibodies, and binding occurs between the binding polypeptides and cells bearing a VEGFR-2 protein recognized by the binding polypeptide. These bound cells can be separated from unbound reagents and the presence of the binding polypeptide-enzyme conjugate specifically bound to the cells can be determined, for example, by contacting the sample with a substrate of the enzyme which produces a color or other detectable change when acted on by the enzyme. In another embodiment, the subject binding polypeptides can be unlabeled, and a second, labeled polypeptide (e.g., an antibody) can be added which recognizes the subject binding polypeptide.
In certain aspects, kits for use in detecting the presence of a VEGFR-2 protein in a biological sample can also be prepared. Such kits will include an VEGFR-2 binding polypeptide which binds to a VEGFR-2 protein or portion of said receptor, as well as one or more ancillary reagents suitable for detecting the presence of a complex between the binding polypeptide and the receptor protein or portions thereof. The polypeptide compositions of the present invention can be provided in lyophilized form, either alone or in combination with additional antibodies specific for other epitopes. The binding polypeptides and/or antibodies, which can be labeled or unlabeled, can be included in the kits with adjunct ingredients (e.g., buffers, such as Tris, phosphate and carbonate, stabilizers, excipients, biocides and/or inert proteins, e.g., bovine serum albumin). For example, the binding polypeptides and/or antibodies can be provided as a lyophilized mixture with the adjunct ingredients, or the adjunct ingredients can be separately provided for combination by the user. Generally these adjunct materials will be present in less than about 5% weight based on the amount of active binding polypeptide or antibody, and usually will be present in a total amount of at least about 0.001% weight based on polypeptide or antibody concentration. Where a second antibody capable of binding to the binding polypeptide is employed, such antibody can be provided in the kit, for instance in a separate vial or container. The second antibody, if present, is typically labeled, and can be formulated in an analogous manner with the antibody formulations described above.
Similarly, the present invention also relates to a method of detecting and/or quantitating expression of VEGFR-2, wherein a composition comprising a cell or fraction thereof (e.g., membrane fraction) is contacted with a binding polypeptide which binds to a VEGFR-2 or portion of the receptor under conditions appropriate for binding thereto, and the binding is monitored. Detection of the binding polypeptide, indicative of the formation of a complex between binding polypeptide and VEGFR-2 or a portion thereof, indicates the presence of the receptor. Binding of a polypeptide to the cell can be determined by standard methods, such as those described in the working examples. The method can be used to detect expression of VEGFR-2 on cells from an individual. Optionally, a quantitative expression of VEGFR-2 on the surface of endothelial cells can be evaluated, for instance, by flow cytometry, and the staining intensity can be correlated with disease susceptibility, progression or risk.
The present invention also relates to a method of detecting the susceptibility of a mammal to certain diseases. To illustrate, the method can be used to detect the susceptibility of a mammal to diseases which progress based on the amount of VEGFR-2 present on cells and/or the number of VEGFR-2-positive cells in a mammal. In one embodiment, the invention relates to a method of detecting susceptibility of a mammal to a tumor. In this embodiment, a sample to be tested is contacted with a binding polypeptide which binds to a VEGFR-2 or portion thereof under conditions appropriate for binding thereto, wherein the sample comprises cells which express VEGFR-2 in normal individuals. The binding and/or amount of binding is detected, which indicates the susceptibility of the individual to a tumor, wherein higher levels of receptor correlate with increased susceptibility of the individual to a tumor.
The following examples are for the purposes of illustrating the invention, and should not be construed as limiting.
A library of approximately 1013 RNA-protein fusion variants was constructed based on the scaffold of the tenth type 3 domain of human fibronectin with three randomized regions at positions 23-29, 52-55 and 77-86 (amino acid nos. are referenced to SEQ ID NO:5) (three loop library; Xu et al, Chemistry & Biology 9:933-942, 2002). Similar libraries were constructed containing randomized regions only at positions 23-29 and 77-86 (two loop library) or only at positions 77-86 (one loop library). A mixture of these three libraries was used for in vitro selection against the extracellular domain of human VEGFR-2 (KDR, extracellular domain, residues 1-764 fused to human IgG1 Fc). For the purposes of this application, the amino acid positions of the loops will be defined as residues 23-30 (BC Loop), 52-56 (DE Loop) and 77-87 (FG Loop). The target binding population was analyzed by DNA sequencing after six rounds of selection and was found to be diverse, with some replicates present. Proteins encoded by fifteen independent clones were screened for binding to KDR, (
The sequence of the binding loops of the VR28 clone is shown in the first row of Table 4.
While VR28 was not the most abundant clone in the sequenced binding population (one copy out of 28 sequenced clone), its binding affinity to KDR was the best among the tested clones from this binding population, with a dissociation constant of 11-13 nM determined in a radioactive equilibrium binding assay (
A mutagenesis strategy focusing on altering sequences only in the binding loops was employed. To initially test which loops were more likely to result in improvement, loop-directed hypermutagenic PCR was carried out to introduce up to 30% mutations independently into each loop of VR28. After three rounds of selection against KDR, multiple clones with improved binding to KDR-Fc were observed. Sequence analysis of the selection pools revealed that the majority of mutations were accumulated in the FG loop while the BC and DE loops remained almost intact. This result indicated that the FG loop was the most suitable target for further modification.
Consequently, a new library of approximately 1012 variants was constructed by altering the sequence of VR28 in the FG loop using oligonucleotide mutagenesis. For each of the FG loop positions (residues 77-86 [VAQNDHELIT (SEQ ID NO:187)] as well as the following Proline [residue 87]), a 50:50 mixture of the VR28-encoding DNA and NNS was introduced at each position. DNA sequence analysis of a random sample of approximately 80 clones revealed an average of six amino acid changes per clone as expected. Lower KDR-Fc concentrations were utilized during selection to favor clones with better affinities to the target. The profile of target binding during the four rounds of selection is shown in
Sequence analysis, some of which is shown in Table 4 (K clones), revealed that while the binding population was diverse, several consensus motifs could be identified among the clones. Most noticeably, Pro87 and Leu84 were found in nearly all clones (as in VR28), suggesting that these residues may be essential for the structure of the binding site. A positively charged amino acid at position 82 appears to be required since only H82K or H82R changes were seen in the sequenced clones and an aliphatic amino acid was predominant at position 78. D81 was often mutated to a G, resulting in the loss of negative charge at this position and a gain in flexibility. In addition, the overall mutation rate in the selected population was comparable to the pool prior to selection, which suggested that the FG loop is very open to changes.
Several residues in the N-terminus of the 10Fn3 domain of human fibronectin are located in close proximity to the FG loop, as suggested by structural determinations (Main et al, Cell 71:671-678, 1992). The close proximity of the two regions could potentially have a negative impact on target binding. Two incidental mutations in the N-terminal region, L8P and L8Q, resulted in better binding to KDR in a number of selected clones, presumably due to a change of the location of the N-terminus relative to the FG loop. To further test the impact of the N-terminus, we created binding molecules for 23 different KDR binders in which the N-terminal first eight residues before the β-sheet were deleted. We then compared target binding to the non-deleted counterparts. On average, binding to KDR-Fc was about 3-fold better with the deletion, as shown in
VR28 and most of the affinity matured variants (K clones) failed to bind the mouse homolog of KDR, Flk1, as shown in
The population of clones following FG loop mutagenesis and selection against KDR for four rounds was further selected against Flk1 for an additional three rounds. As shown in
For example, E19 has a Kd of 60 pM to KDR, and 340 pM to Flk-1. These results demonstrate that a simple target switch strategy in the selection process, presumably through selection pressures exerted by both targets, has allowed the isolation of molecules with dual binding specificities to both KDR and Flk-1 from a mutagenized population of VR28, a moderate KDR binder that was not able to bind Flk-1. The selected fibronectin-based binding proteins are highly specific to VEGFR-2 (KDR) as no substantial binding to VEGFR1 was observed at high target concentration.
Sequence analysis revealed some motifs similar to those observed in the KDR binder pool (Leu and Pro at residues 84 and 87 respectively; positively charged amino acid at residue 82, predominantly Arg) and some that were not maintained (aliphatic at position 78). In addition, the motif ERNGR (residues 78-82) (SEQ ID NO: 233) was present in almost all clones binding to Flk-1 (Table 4); this motif was barely discernable in the KDR binding pool. R79 and R82 appear to be particularly important for high affinity binding to Flk-1, since binding to Flk-1, but not KDR, is greatly reduced when a different residue is present at this position (
An alternative mutagenesis strategy was independently employed to produce clones capable of binding to both targets. The clone 159Q(8)L (Table 4), the product of hypermutagenic PCR affinity maturation of VR28 that binds KDR with high affinity (Kd=2 nM; Table 7) and Flk-1 with poor affinity (Kd>3000 nM), was chosen as a starting point. The first six amino acids of the FG loop were fully randomized (NNS), leaving the following five residues (ELFTP (SEQ ID NO: 234)) intact. After six rounds of selection against Flk-1, the binding pool was re-randomized at the DE loop (positions 52-56) and the selection was performed for three additional rounds against Flk-1 and one round against KDR. A number of high affinity binding molecules to both KDR and Flk-1 were thus obtained (Tables 4 and
The functionality of KDR and Flk-1 binding molecules in a cell culture model system was evaluated with E. coli produced binding molecules. Using a detection system consisting of anti-His6 tag (SEQ ID NO: 235) murine antibody (the E. coli expressed proteins were expressed with a His tag) and an anti-murine fluorescently labeled antibody the binding molecules were shown to bind specifically to mammalian cells expressing KDR or Flk-1 with low nanomolar EC50s, (
More importantly, using recombinant BA/F3 cells (DSMZ-Deutsche Sammlung von Mikroorganismen und Zellkulturen GmbH) expressing the extracellular KDR or Flk-1 domain linked to the erythropoietin receptor signaling domain, these molecules inhibited VEGF-stimulated cell proliferation in a dose dependent fashion, with IC50 3-12 nM for KDR expressing cells, and 2-5 nM for Flk-1 expressing cells. The potency of inhibition appears to be similar to control anti-KDR and anti-Flk-1 monoclonal antibodies, as shown in
A number of clones were further tested for VEGF-inhibition of the growth of HUVEC cells (Human Umbilical Vein Endothelial Cells). HUVEC cells are natural human cells that are closely related to cells in the body that respond to VEGF. As shown in
The thermal stability of KDR-binder M5FL was established using differential scanning calorimetry (DSC). Under standard PBS buffer conditions (sodium phosphate pH 7.4, 150 mM NaCl), M5FL was found to have a single non-reversible thermal melting transition at 56° C. Subsequently, sodium acetate pH 4.5 was identified as a favorable buffer for M5FL protein solubility. DSC experiments in this buffer (100 mM) demonstrated that M5FL is more stable under these conditions (Tm=67-77° C.) and that the melting transition is reversible (
The M5FL protein was produced in an E. coli expression system with a C-terminal extension to yield the following protein sequence (C-terminal extension bolded with G1-00 Cys102 italicized; a significant percentage of protein is produced with the initial methionine removed):
P
QHHHHHH
The single sulfhydryl of the cysteine residue at position 102 was used to couple to PEG variants using standard maleimide chemistry to yield two different PEGylated forms of M5FL. Both a linear 20 kD PEG and a branched 40 kD PEG (Shearwater Corporation) were conjugated to M5FL to produce M5FL-PEG20 and M5FL-PEG40, respectively. The PEGylated protein forms were purified from unreacted protein and PEG by cation exchange chromatography. Covalent linkage of the two PEG forms of M5FL was verified by SDS-PAGE (
In vitro affinity measurements were made using surface plasmon resonance (SPR) (BIAcore) with both the human and mouse VEGF-receptor target proteins immobilized via amide chemistry on the BIAcore chip. For both target proteins, both the 20 and 40 kD PEGylated M5FL forms were found to have slower on-rates (ka) relative to unmodified M5FL with little effect on off-rates (kd; Table 11).
The functionality of the PEGylated M5FL preparations was tested using the Ba/F3 system described in Example 4.
The kon, koff and KD were analyzed for a subset of KDR-binding polypeptides and compared to the EC50 for the BaF3 cell-based VEGF inhibition assay. Scatter plots showed that the kon was well-correlated with the EC50, while koff was poorly correlated. Greater than 90% of KDR-binding proteins with a kon of 105s-1 or greater had an EC50 of 10 nM or less. KD is a ratio of kon and koff, and, as expected, exhibits an intermediate degree of correlation with EC50.
Many of the KDR-binding proteins, including CT-01, were assessed for binding to VEGFR-1, VEGFR-2 and VEGFR-3. The proteins showed a high degree of selectivity for VEGFR-2.
Following the methodologies described in the preceding Examples, additional 10Fn3-based KDR binding proteins were generated. As described for the development of the M5FL protein in Example 5, above, proteins were tested for KD against human KDR and mouse Flk-1 using the BIAcore binding assay and for IC50 in a Ba/F3 assay. A protein termed CT-01 exhibited desirable properties in each of these assays and was used in further analysis.
The initial clone from which CT-01 was derived had a sequence: GEVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISG LKPGVDYTITVYAVTDGWNGRLLSIPISINYRT (SEQ ID NO:189). The FG loop sequence is underlined.
Affinity maturation as described above produced a core form of CT-01:
The CT-01 molecule above has a deletion of the first 8 amino acids and may include additional amino acids at the N- or C-termini. For example, an additional MG sequence may be placed at the N-terminus. The M will usually be cleaved off, leaving a GEV . . . sequence at the N-terminus. The re-addition of the normal 8 amino acids at the N-terminus also produces a KDR binding protein with desirable properties. The N-terminal methionine is generally cleaved off to yield a sequence:
For use in vivo, a form suitable for PEGylation may be generated. For example, a C-terminal tail comprising a cysteine was added and expressed, as shown below for a form lacking the eight N-terminal amino acids.
The PEGylated form of this molecule is used in the in vivo experiments described below. A control form with a serine instead of a cysteine was also used:
The same C-terminal tails may also be added to CT-01 forms having the N-terminal eight amino acids, such as is shown in SEQ ID NO:193.
Additional variants with desirable KDR binding properties were isolated. The following core sequence has a somewhat different FG loop, and may be expressed with, for example, an N-terminal MG sequence, an N-terminal sequence that restores the 8 deleted amino acids, and/or a C-terminal tail to provide a cysteine for PEGylation. EVVAATPTSLLISWRHPHFPTRYYRITYGETGGNSPVQEFTVPLQPPTATISGL KPGVDYTITVYAVTEGPNERSLFIPISINYRT (SEQ ID NO:185). Another such variant has the core sequence:
A comparison of these variants shows a consensus sequence for the FG loop of: D/E)GXNXRXXIP (SEQ ID NO:3). With greater particularity, the consensus sequence may be expressed as (D/E)G(R/P)N(G/E)R(S/L)(S/F)IP (SEQ ID NO:4).
As shown in
To assess whether KDR binders disclosed herein inhibited activation of this signaling pathway, Human Microvascular Endothelial Cells were treated with a VEGFR binding polypeptide (e.g., CT-01) for 30 min and stimulated with VEGF-A for 5 min. Total cell lysates were analyzed by SDS-PAGE and western analysis, using antibodies specific to phospho-VEGFR-2, non-phospho-VEGFR-2, phosphor-ERK1/2 and non-phospho-ERK1/2.
As shown in
VEGFR-2 is a receptor for three VEGF species, VEGF-A, VEGF-C and VEGF-D. Experiments were conducted to evaluate the effects of fibronectin-based KDR binding proteins on VEGF-A and VEGF-D mediated signaling through KDR.
A Ba/F3 cell line dependent on Flk-1 mediated signaling was generated. As shown in the left panel of
As shown in the middle panel of
As shown in the right panel of
Pharmacokinetic Studies: Native CT-01 or a pegylated form (40 kDa PEG, CT-01PEG40) were iodinated with 125I. 10-20 mCi of iodinated proteins were injected into adult male rats either i.v. or i.p. and iodinated proteins levels were determined at the indicated times. For tissue distribution studies, rats were sacrificed at 15 min, 2 hr and 6 hr and radioactivity levels determined. See
Intraperitoneal (i.p.) administration of PEGylated CT-01 had reservoir-like pharmacokinetics. There was no initial spike in the blood concentration of CT-01. Instead, the amount of CT-01 built up more slowly and decreased slowly. Such pharmacokinetics may be desirable where there is concern about side effects from the initial spike in CT-01 concentration upon intravenous administration. It is likely that other 10FN3-based agents would exhibit similar behavior in i.p. administration. Accordingly, this may be a generalizable mode for achieving a time-delayed dosing effect with 10FN3-based agents.
As shown in
Similar results were obtained using a CT-01 conjugated to a 20 kDa PEG moiety.
The Miles assay, as outlined in
Mice treated with a KDR binding agent showed a statistically significant decrease in the level of VEGF-mediated vessel leakage. Both 5 mg/kg and 20 mg/kg dosages with CT-01 showed significant results. Therefore, a 5 mg/kg dosage was selected for mouse tumor model studies.
B16-F10 Murine Melanoma Tumor Assay:
2×106 B16-F10 murine melanoma tumor cells were implanted subcutaneously into C57/BL male mice at Day 1. At day 6 a palpable mass was detected. On day 8 when tumors were of measurable size, daily i.p. injections of either Vehicle control, 5, 15, or 40 mg/kg CT-01PEG40 were started. The lowest dose 5 mg/kg decreased tumor growth. At day 18, mice treated with 15 and 40 mg/kg showed 50% and 66% reduction in tumor growth. See
U87 Human Glioblastoma Assay:
5×106 U87 human glioblastoma tumor cells were implanted subcutaneously into nude male mice. When tumor volume reached approximately 50 mm3 treatment started (day 0). Vehicle control, 3, 10, or 30 mg/kg CT-01PEG40 were injected i.v. every other day (EOD). The anti-Flk-1 antibody DC101 was injected at 40 mg/kg twice a week as published for its optimal dose schedule. The lowest dose 3 mg/kg decreased tumor growth. At day 12, mice treated with 10 and 30 mg/kg showed 50% reduction in tumor growth. See
The following materials and methods were used for the experiments described in Examples 1-12.
Recombinant Proteins:
Recombinant human VEGF165, murine VEGF164, human neurotrophin-4 (NT4), human and mouse vascular endothelial growth factor receptor-2 Fc chimeras (KDR-Fc and Flk-1-Fc) were purchased from R&D systems (Minneapolis, Minn.). Biotinylation of the target proteins was carried out in 1×PBS at 4° C. for 2 hours in the presence of EZ-Link™ Sulfo-NHS-LC-LC-Biotin (Pierce, Ill.). Excess of EZ-Link™ Sulfo-NHS-LC-LC-Biotin was removed by dialysis against 1×PBS. The level of biotinylation was determined by mass spectroscopy and target protein concentrations were determined using Coomassie Protein Plus Assay (Pierce, Ill.).
Primers:
The following oligonucleotides were prepared by chemical synthesis for eventual use in library construction and mutagenesis of selected clones.
Buffers
The following buffers were utilized in the experiments described herein. Buffer A (100 mM TrisHCl, 1M NaCl, 0.05% Tween-20, pH 8.0); Buffer B (1×PBS, 0.02% Triton X100); Buffer C (100 mM TrisHCl, 60 mM EDTA, 1M NaCl, 0.05% Triton X100, pH 8.0); Buffer Ca (100 mM TrisHCl, 1M NaCl, 0.05% Triton X100, pH 8.0); Buffer D (2M NaCl, 0.05% Triton); Buffer E (1×PBS, 0.05% Triton X100, pH 7.4); Buffer F (1×PBS, 0.05% Triton X100, 100 mM imidazole, pH 7.4); Buffer G (50 mM HEPES, 150 mM NaCl, 0.02% TritonX-100, 1 mg/ml bovine serum albumin, 0.1 mg/ml salmon sperm DNA, pH 7.4); Buffer H (50 mM HEPES, 150 mM NaCl, 0.02% TritonX-100, pH 7.4); Buffer I (1×PBS, 0.02% TritonX-100, 1 mg/ml bovine serum albumin, 0.1 mg/ml salmon sperm DNA, pH 7.4); Buffer J (1×PBS, 0.02% TritonX-100, pH 7.4); Buffer K (50 mM NaH2PO4, 0.5 M NaCl, 5% glycerol, 5 mM CHAPS, 25 mM imidazole, 1× Complete™ Protease Inhibitor Cocktail (Roche), pH 8.0); Buffer L (50 mM NaH2PO4, 0.5 M NaCl, 5% glycerol, 25 mM imidazole, pH 8.0); Buffer M (1×PBS, pH 7.4, 25 mM imidazole, pH 7.4); Buffer N (1×PBS, 250 mM imidazole, pH 7.4); Buffer O (10 mM HEPES, 150 mM NaCl, 0.005% Tween 20, pH 7.4).
Primary Library Construction:
The construction of the library using the tenth domain of human fibronectin as a scaffold was previously described (Xu et al, 2002, supra). Three loop regions, corresponding to positions 23-29, 52-55, and 77-86, respectively, were randomized using NNS (standard nucleotide mixtures, where N=equimolar mixture of A, G, T, C; S=equimolar mixture of G and C) as the coding scheme. Similar libraries were constructed containing randomized regions only at positions 23-29 and 77-86 (two loop library) or only at positions 77-86 (one loop library). These libraries were mixed in approximately equimolar amounts. This mixed library contained ˜1×1013 clones and was used in the KDR selection that identified VR28.
Mutagenic Library Construction:
Hypermutagenic PCR. Scaffold mutation T(69)I in VR28 clone was corrected back to wild type sequence by PCR (see below) and no change in binding characteristics of VR28 binder to KDR was observed. Mutations were introduced into the loop regions of VR28 using conditions described previously (Vartanian et al, Nuc. Acid Res. 24:2627-2631, 1996). Three rounds of hypermutagenic PCR were conducted on a VR28 template using primer pairs flanking each loop (N-terminus forward/BCDE reverse, BCDE forward/DEFG reverse, DEFG forward/C-terminus polvA). The resulting fragments were assembled using overlap extension and PCR with flanking primers T7TMV Fn and MK165-4 A20. DNA sequencing of the clones from the final PCR reaction confirmed correct assembly of the library. Up to 30% mutagenesis rate was observed in the loop regions, as compared to 1.5% in the scaffold regions.
Oligo mutagenesis. Oligo mutagenesis of the FG loop of VR28 by PCR utilized the VR28FG-50 primer, DEFG reverse primer and flanking primers. At each nucleotide position encoding the FG loop, primer VR28FG-50 contained 50% of the VR28 nucleotide and 50% of an equimolar mixture of all four nucleotides (N) or of G or C (S). This scheme was designed to result in approximately 67% of the amino acids of the VR28 FG loop being randomly replaced by another amino acid which was confirmed by DNA sequencing.
159 (Q8L) randomized sub-libraries. Oligo mutagenesis of the FG loop of Clone 159 (Q8L) clone, a three-step extension and amplification was performed. For the first extension, pairs of primers (a: F1U2/F2, b: F3159/F4, c: F5159/F6, d: F7X6159/F8) were mixed in equal concentrations (100 pmol each) and amplified for 10 cycles. For the second extension, 1/20 of the first reactions were combined (a/b and c/d) and amplification was continued for another 10 cycles. To bias the amplification in favor of extension rather than re-annealing of fully complementary fragments, a linear amplification of the half-construct products (0.5 pmol each) was performed for an additional 20 cycles using 50 pmol of either F1U2 forward primer for fragment ab, or the C2asaiA20 reverse primer for fragment cd. Finally, the extended half-construct fragments ab and cd were combined and amplified for 20 cycles without any additional components. Primer F7X6159 contained NNS at each of the first 6 coding positions of Clone 159 (Q8L) and was otherwise identical to Clone 159 (Q8L). Correct assembly of the library 159 (Q8L)-FGX6 was confirmed by DNA sequencing of clones from the final PCR reaction. The sub-library contained ˜1×109 clones.
For randomization of the DE loop of post round 6 (PR6) selection pool of the 159 (Q8L)-FGX6 library, two half-construct fragments were prepared by PCR using primers F1U2/F4 and F5X5/C2asaiA20. The F5X5 primer contained NNS at the four positions of the DE loop as well as at position 56. Then, the extended fragments ab and cd were combined and amplified for 20 cycles without any additional components.
Introduction of Point Mutations, Deletion and Random (NNS) Loop Sequences into Fibronectin-Based Scaffold Proteins:
Scaffold mutation T(69)I of VR28 binder was corrected back to wild type sequence in two-step PCR using VR28 clone as a template. Half-construct fragments, obtained with primers N-terminus forward/DEFG reverse and DEFG forward/C-terminus polvA, were combined and the whole VR28 (I69T) clone (designated as VR28 in the text) was constructed using primers T7TMV Fn and MK165-4 A20. Correction of N-terminus mutations in clone 159 (Q8 to L) was performed by PCR with primers N-terminus forward/C-terminus polvA followed by extension with primers T7TMV Fn and MK165-4 A20.
Introduction of deletion Δ1-8 into the N-terminus of fibronectin-based scaffold proteins was performed by amplification using primers T7 TMV N-terminus deletion and MK165-4 A20.
Construction of the chimeras of E clones containing NNS loop sequences was performed by two-step PCR. Loop regions were amplified using primers T7 TMV N-terminus deletion/BCDE rev (a: BC loop of E clones); N-terminus forward/hf01 BC reverse (b: BC NNS); BCDE for/Front FG reverse (c: DE loop of E clones); BCDE for/hf01 DE reverse (d: DE NNS); hf01 DE-FG forward/hf01 RT-Flag PolyA reverse (e: FG of E clones); hf01 DE-FG forward/hf01 FG reverse (f: FG NNS). Fragments b/c/e, a/d/e, a/c/f were combined and the whole pools were constructed by extension and amplification using primers T7Tmv N-terminus deletion and hf01 RTFlag PolyA reverse.
All constructs were verified and/or analyzed by DNA sequencing. All constructs and mutagenic libraries contained T7 TMV promoter at the 5′ flanking region and Flag tag or His6 tag (SEQ ID NO: 235) sequences at 3′ flanking region for RNA-protein fusion production and purification in vitro.
RNA-Protein Fusion Production
For each round of selection PCR DNA was transcribed using MegaScript transcription kit (Ambion) at 37° C. for 4 hours. Template DNA was removed by DNase I (Ambion) digestion at 37° C. for 20 minutes. RNA was purified by phenol/chloroform extraction followed by gel filtration on a NAP-25 column (Amersham). The puromycin linker PEG 6/10 (5′ Pso u age gga ugc XXX XXX CC Pu 3′ (SEQ ID NO: 236), where Pso=C6-Psoralen, u,a,g,c=2′OMe-RNA, C=standard amidities, X: Spacer Phosphoramidite 9 (9-O-Dimethoxytrityl-triethylene glycol, 1-[(2-cyanoethyl)-(N,N-diisopropyl)]-phosphoramidite); Pu=Puromycin-CPG) was synthesized as described previously (Kurz et al, Nuc. Acid Res. 28:83, 2000). The linker was annealed to the library RNA in 0.1 M NaCl, 25 mM TrisHCl, pH 7.0, by gradient temperature decrease from 85° C. to 4° C. The linker and RNA were then cross linked by exposing to UV light (365 nm) for 15 minutes. The cross-linked mixture (600 pmol RNA) was included in an in vitro translation reaction using rabbit reticulocyte lysate translation kit (Ambion) in the presence of 35S-labeled methionine at 30° C. for 60 minutes. To enhance fusion formation, 0.5 M KCl and 0.05 M MgCl2 were added to the reaction and incubated for 30 minutes at 4° C. Fusion molecules were purified using oligo-dT cellulose (Sigma) chromatography as follows. The translation and fusion mix was diluted into buffer A (100 mM TrisHCl, 1M NaCl, 0.05% Tween-20, pH 8.0) and added to oligo dT cellulose. The slurry was rotated at 4° C. for 1 hour and transferred to a spin column. Oligo dT cellulose beads were washed on the column with 10 column volumes of buffer A and eluted with 3 column volumes of H2O. Reverse transcription reaction was conducted with SuperScript II Reverse Transcription kit (Invitrogen) for 1 hour at 42° C. using primer Hu3′FLAGSTOP. To decrease potential non-specific binding through reactive cysteines the thiol groups were reacted with 1 mM of 2-nitro-5-thiocyanatobenzoic acid (NTCB) or N-ethylmaleimide (NEM) alternatively over the course of the selection. The reaction was carried out for 1 hour at room temperature. Fusion molecules were further purified by anti-FLAG affinity chromatography using M2 agarose (Sigma). The M2 beads were added to the reaction and rotated in buffer B (1×PBS, 0.02% Triton X100) for 1 hour at 4° C. Then the beads were applied to a spin column, washed with 5 column volumes of buffer B and fusion molecules were eluted with 3 column volumes of 100 μM Flag peptide DYKDDDDK (SEQ ID NO: 237) (Sigma) in buffer G. Fusion yield was calculated based on specific activity measured by scintillation counting of 35S-methionine in the samples.
For the 159 (Q8L) randomized library, RNA-protein fusion was prepared using a streamlined, semi-automated procedure in a Kingfisher™ (ThermoLabSystems). The steps were similar to the procedure described above except for several steps described below. Purification of the RNA-protein fusion molecules was performed in buffer C (100 mM TrisHCl, 60 mM EDTA, 1M NaCl, 0.05% Triton X100, pH 8.0) on magnetic oligo dT beads (GenoVision). The beads were washed with 10 reaction volumes of buffer Ca (100 mM TrisHCl, 1M NaCl, 0.05% Triton X100, pH 8.0) and fusion proteins were eluted with one volume of H2O. Reverse transcription (RT) was conducted using primer C2RT. Fusion proteins were further purified by His-tag affinity chromatography using Ni-NTA magnetic beads (Qiagen). The RT reaction was incubated with Ni-NTA beads in buffer D (2M NaCl, 0.05% Triton) for 20 minutes at room temperature, the beads were then washed with 10 reaction volumes of buffer E (1×PBS, 0.05% Triton X100, pH 7.4) and fusion molecules were eluted with one volume of buffer F (1×PBS, 0.05% Triton X100, 100 mM imidazole, pH 7.4).
Selection:
Primary selection against KDR. Fusion library (˜1013 clones in 1 ml) was incubated with 150 μl of Protein A beads (Dynal) which was pre-immobilized with 200 nM of human IgG1 for 1 hour at 30° C. prior to selection to reduce non-specific binding to both Protein A beads and Fc protein (preclear). The supernatant was then incubated in buffer G (50 mM HEPES, 150 mM NaCl, 0.02% TritonX-100, 1 mg/ml bovine serum albumin, 0.1 mg/ml salmon sperm DNA, pH 7.4) with KDR-Fc chimera for 1 hour at 30° C. with end-over-end rotation. Final concentrations of KDR-Fc were 250 nM for Round 1, 100 nM for rounds 2-4 and 10 nM for rounds 5 and 6. The target was captured on 300 μl of Protein A beads (Round 1) or 100 μl of Protein A beads (Rounds 2-6) for 30 minutes at 30° C. with end-over-end rotation and beads were washed 5 times with 1 ml of buffer G (50 mM HEPES, 150 mM NaCl, 0.02% TritonX-100, pH 7.4). Bound fusion molecules were eluted with 100 μl of 0.1 M KOH into 50 μl of 1 M TrisHCl, pH 8.0. DNA was amplified from elution by PCR using flanking primers T7TMV Fn and MK165-4 A20.
Affinity and specificity maturation of KDR binder VR28. Clone VR28 was mutagenized by hypermutagenic PCR or oligo-directed mutagenesis as described above and fusion sub-libraries were constructed. Following pre-clear with Protein A beads selection was performed in buffer I (1×PBS, 0.02% TritonX-100, 1 mg/ml bovine serum albumin, 0.1 mg/ml salmon sperm DNA, pH 7.4) for four rounds according to procedure described above. DNA was amplified from elution by PCR using primers T7TMV Fn and MK165-4 A20. Lower target concentrations (0.1 nM KDR for first four rounds of selection) were used for libraries derived from oligo mutagenesis and then 1 nM mouse VEGF-R2 (Flk-1) was introduced for three additional rounds of selection. Primers T7 TMV N-terminus deletion and MK165-4 A20 were used for PCR in the last 3 rounds.
For specificity maturation of KDR binder 159 first 6 positions of the FG loop of clone 159 Q(8)L were randomized by PCR as described above. Binding of the fusion sub-library to biotinylated mouse VEGF-R2 (70 nM) was performed in buffer I at room temperature for 30 minutes. The rest of the selection procedure was continued in Kingfisher™ (ThermoLabSystems). The biotinylated target was captured on 50 μl of streptavidin-coated magnetic beads (Dynal) and the beads were washed with 10 volumes of buffer I and one volume of buffer J (1×PBS, 0.02% TritonX-100, pH 7.4). Bound fusion molecules were eluted with 100 μl of 0.1 M KOH into 50 μl of 1 M TrisHCl, pH 8.0. DNA was amplified from elution by PCR using primers F1U2 and C2asaiA20. After four rounds of selection an off-rate/rebinding selection against 7 nM Flk-1 was applied for another two rounds as follows. After the binding reaction with biotinylated mouse Flk-1 had progressed for 30 minutes, a 100-fold excess of non-biotinylated Flk-1 was added and the reaction continued for another 6 hours to allow time for the weak binders to dissociate. The biotinylated target was captured on 50 μl of streptavidin beads (Dynal) and beads were washed 5 times with 1 ml of buffer J. Bound fusion molecules were eluted by incubation at 75° C. for 5 minutes. Supernatant was subjected to re-binding to 7 nM Flk-1 and standard selection procedure was continued. DNA from the final elution pool was subjected to DE loop randomization (see above) and fusion sub-library was selected against 7 nM mouse VEGF-R2 for three rounds. At the fourth round an off-rate selection was applied with re-binding to 1 nM human VEGF-R2. Final DNA was amplified from elution by PCR using primers F1U2 and C2asaiA20.
Radioactive Equilibrium Binding Assay
To prepare 35S-labeled binding proteins for analysis, mRNA was prepared as described above for RNA-protein fusion production but the linker ligation step was omitted. The mRNA was expressed using rabbit reticulocyte lysate translation kit (Ambion) in the presence of 35S-labeled Met at 30° C. for 1 hour. Expressed protein was purified on M2-agarose Flag beads (Sigma) as described above. This procedure produced the encoded protein without the nucleic acid tail. In a direct binding assay, VEGF-R2-Fc fusions in concentrations ranging from 0 to 200 nM were added to a constant concentration of the purified protein (0.2 or 0.5 nM) and incubated at 30° C. for 1 hour in buffer B. The receptor-binder complexes were captured using Protein A magnetic beads for another 10 minutes at room temperature using a Kingfisher™ The beads were washed with six reaction volumes of buffer B. The protein was eluted from the beads with 100 μL of 0.1 M KOH. 50 μL of the reaction mixture and elution were dried onto a LumaPlate-96 (Packard) and the amount of 35S on the plate was measured using a TopCount NXT instrument (Packard). The amount of fibronectin-based scaffold protein bound to the target was estimated as a percent of radioactivity eluted from Protein A magnetic beads compare to radioactivity in the reaction mixture. Nonspecific binding of fibronectin-based scaffold proteins to the beads was determined by measuring binding in the absence of KDR-Fc and represented less than 1-2% of the input. Specific binding was obtained through subtraction of nonspecific binding from total binding. Data was analyzed using the GraphPad Prizm software (GraphPad Software, Inc, San Diego, Calif.), fitted using a one site, non-linear binding equation.
Expression and Purification of Soluble Fibronectin-Based Scaffold Protein Binders:
For expression in E. coli residues 1-101 of each clone followed by the His6 tag (SEQ ID NO: 235) were cloned into a pET9d-derived vector and expressed in E. coli BL21 (DE3) pLysS cells (Invitrogen). 20 ml of overnight culture was used to inoculate 1 liter of LB medium containing 50 μg/mL kanamycin and 34 μg/mL chloromphenicol. The culture was grown at 37° C. until A600 0.4-0.6. After induction with 1 mM isopropyl-β-thiogalactoside (IPTG, Invitrogen) the culture was grown for another 3 hours at 37° C. and harvested by centrifugation for 30 minutes at 3,000 g at 4° C. The cell pellet was resuspended in 50 mL of lysis buffer K (50 mM NaH2PO4, 0.5 M NaCl, 5% glycerol, 5 mM CHAPS, 25 mM imidazole, 1× Complete™ Protease Inhibitor Cocktail (Roche), pH 8.0) BufferL and sonicated on ice at 80 W for four 15 second pulses separated by ten-second pauses. The soluble fraction was separated by centrifugation for 30 minutes at 30,000 g at 4° C. The supernatant was rotated for 1 hour at 4° C. with 10 mL of TALON™ Superflow™ Metal Affinity Resin (Clontech) pre-equilibrated with wash buffer L (50 mM NaH2PO4, 0.5 M NaCl, 5% glycerol, 25 mM imidazole, pH 8.0). The resin was then washed with 10 column volumes of buffer L and 30 column volumes of buffer M (1×PBS, pH 7.4, 25 mM imidazole, pH 7.4). Protein was eluted with 5 column volumes of buffer N (1×PBS, 250 mM imidazole, pH 7.4) and dialyzed against 1×PBS at 4° C. Any precipitate was removed by filtering at 0.22 μm (Millipore).
BIAcore Analysis of the Soluble Fibronectin-Based Scaffold Proteins:
The binding kinetics of fibronectin-based scaffold proteins binding proteins to the target was measured using BIAcore 2000 biosensor (Pharmacia Biosensor). Human and mouse VEGF-R2-Fc fusions were immobilized onto a CM5 sensor chip and soluble binding proteins were injected at concentrations ranging from 0 to 100 nM in buffer O (10 mM HEPES, 150 mM NaCl, 0.005% Tween 20, pH 7.4). Sensorgrams were obtained at each concentration and were evaluated using a program, BIA Evaluation 2.0 (BIAcore), to determine the rate constants ka (kon) and kd (koff.) The affinity constant, KD was calculated from the ratio of rate constants koff/kon.
For inhibition experiments, human VEGF165 was immobilized on a surface of CM-5 chip and KDR-Fc was injected at a concentration of 20 nM in the presence of different concentrations of soluble binding proteins ranging from 0 to 100 nM. IC50 was determined at a concentration when only 50% of KDR-Fc binding to the chip was observed.
Reversible Refolding of a VEGFR Binding Polypeptide:
Differential scanning calorimetry (DSC) analysis was performed on M5FL protein in 100 mM sodium acetate buffer (pH 4.5). An initial DSC run (Scan 1) was performed in a N-DSC II calorimeter (Calorimetry Sciences Corp) by ramping the temperature from 5-95° C. at a rate of 1 degree per minute, followed by a reverse scan (not shown) back to 10 degrees, followed by a second run (Scan 2). Under these conditions, data were best fit using a two transition model (Tm=77° C. and 67° C. using Orgin software (OrginLab Corp)). See
PEGylation of the M5FL Protein:
The C102-form of the M5FL protein, which has the complete sequence of M5FL with the Ser at position 102 mutated to a Cysteine including the additional C-terminal His-tag used to purify the protein. The purified M5FL C102 protein was modified at the single cysteine residue by conjugating various maleimide-derivatized PEG forms (Shearwater). The resulting reacted proteins were run on a 4-12% polyacrylamide gel (
Construction of Cell Lines:
Plasmid construction. Plasmids, encoding chimeric receptors composed of the transmembrane and cytoplasmic domains of the human erythropoietin receptor (EpoR) fused to the extracellular domains of KDR, Flk-1, or human TrkB were constructed by a two-step PCR procedure. PCR products encoding the extracellular domains were amplified from plasmids encoding the entire receptor gene: KDR (amino acids 1 to 764) was derived from clone PR1371_H11 (OriGene Technologies, Rockville, Md.) with primers 5-RI-hKDR-1B/3-EPO/hKDR-2312B, flk-1 (amino acids 1 to 762) was derived from clone #4238984 (IMAGE) with primers 5-RI-mKDR-1/3-EPO/mKDR-2312, and human TrkB (from amino acids 1 to 430) from clone #X75958 (Invitrogen Genestorm) with primers 5-RI-hTrkB-1/3-EpoR/hTrkB-1310. PCR products encoding the EpoR transmembrane and cytoplasmic domains (amino acids 251 to 508) were amplified from clone #M60459 (Invitrogen Genestorm) with the common primer 3-XHO-EpoR-3066 and one of three gene-specific primers 5-hKDR/EPO-2274B (KDR), 5-mKDR/EPO-2274 (flk-1), and 5′hTrkB/EpoR-1274 (human TrkB), which added a short sequence complementary to the end of the receptor fragment PCR product. Second, PCR products encoding the two halves of the chimeric genes were mixed and amplified with 3-XHO-EpoR-3066 and the 5′ primers (5-RI-hKDR-1B, 5-RI-mKDR-1, and 5-RI-hTrkB-1) specific for each gene used in the previous cycle of amplification. The resulting PCR products were digested with EcoRI and XhoI and cloned into pcDNA3.1(+) (Invitrogen) to generate the plasmids phKE8 (human KDR/EpoR fusion), pmKE2 (flk-1/EpoR fusion), and phTE (TrkB/EpoR fusion).
Construction of cell lines for flow cytometry. CHO-K1 cells (American Type Culture Collection, Manassas, Va.) were stably transfected using Lipofectamine 2000 (Invitrogen) with either pcDNA 3.1 (Invitrogen) alone, pmKE2 alone, or a mixture of pcDNA 3.1 and a plasmid encoding full-length human KDR (Origene Inc., clone PR1371-H11). Stable transfectants were selected and maintained in the presence of 0.5 mg/ml of Geneticin (Invitrogen). The human KDR-expressing clone designated CHO-KDR and the murine VEGFR-2/EpoR-chimera-expressing population designated CHO-Flk were obtained by fluorescence activated cell sorting of the transfected population following staining with an anti-KDR polyclonal antiserum (R&D Systems). CHO-KDR and CHO-Flk cell lines were grown routinely in Dulbecco's modified Eagle's medium (DMEM; Gibco) supplemented with 10% (v/v) fetal bovine serum (FBS), 0.5 mg/ml Geneticin, 100 U/ml penicillin, 0.25 μg/ml amphotericin B, 100 μg/ml streptomycin and 2 mM L-glutamine.
Construction of Ba/F3 cell lines. Cell lines that would proliferate in response to VEGF binding by VEGFR-2 were constructed by transfection of the murine pre-B cell line Ba/F3 (DSMZ, Braunschweig, Germany) with phKE8 or pmKE2, receptor chimeras consisting of the extracellular domains of human or murine VEGFR-2 fused to the transmembrane and cytoplasmic domains of the human erythropoietin receptor (see above). Ba/F3 cells were maintained in minimal Ba/F3 medium (RPMI-1640 (Gibco) containing 10% FBS, 100 U/ml penicillin, 0.25 μg/ml amphotericin B, 100 μg/ml streptomycin and 2 mM L-glutamine) supplemented with 10% conditioned medium from WEHI-3B cells (DSMZ; grown in Iscove's modified Dulbecco's medium (Gibco)/10% FBS/25 μM β-mercaptoethanol) as a source of essential growth factors. Following electroporation with the plasmids pmKE2 or phKE8, stable transfectants were selected in 0.75 mg/ml Geneticin. Geneticin-resistant populations were transferred to minimal Ba/F3 medium containing 100 ng/ml of human VEGF165 (R&D Systems), and the resulting VEGF-dependent populations were designated Ba/F3-Flk and Ba/F3-KDR. Control cell line expressing a chimeric TrkB receptor (Ba/F3-TrkB) that would be responsive to stimulation by NT-4, the natural ligand for TrkB was similarly constructed using the plasmid phTE and human NT-4 (R&D Systems).
Analysis of Cell Surface Binding of Fibronectin-Based Scaffold Proteins:
Binding of fibronectin-based scaffold protein to cell-surface KDR and Flk-1 was analyzed simultaneously on VEGF-R2-expressing and control cells by flow cytometry. CHO-pcDNA3 cells (control) were released from their dishes with trypsin-EDTA, washed in Dulbecco's PBS without calcium and magnesium (D-PBS−; Invitrogen), and stained for 30 minutes at 37° C. with 1.5 μM CMTMR (5-(and-6)-(((4-chloromethyl)benzoyl)amino)-tetramethylrhodamine) (Molecular Probes). The cells were washed in D-PBS− and incubated for a further 30 minutes at 37° C., and then resuspended in blocking buffer (D-PBS−/10% fetal bovine serum) on ice. CHO-KDR or CHO-Flk cells were treated identically except that CMTMR was omitted. 75,000 of CMTMR-stained CHO-pcDNA3 cells were mixed with an equal number of unstained CHO-KDR or CHO-Flk cells in each well of a V-bottom 96-well plate. All antibodies and fibronectin-based scaffold proteins were diluted in 25 μl/well of blocking buffer, and each treatment was conducted for 1 hour at 4° C. Cell mixtures were stained with His6-tagged (SEQ ID NO: 235) fibronectin-based scaffold proteins, washed twice with cold D-PBS−, and then treated with 2.5 μg/ml anti-His6 (SEQ ID NO: 235) MAb (R&D Systems), washed, and stained with 4 μg/ml Alexa Fluor 488-conjugated anti-mouse antibody (Molecular Probes). For cells treated with an anti-KDR mouse monoclonal antibody (Accurate Chemical, Westbury, N.Y.) or an anti-flk-1 goat polyclonal antibody (R&D Systems), the anti-His6 (SEQ ID NO: 235) step was omitted, and antibody binding was detected with the species-appropriate Alexa Fluor 488 conjugated secondary antibody (Molecular Probes). Following staining, cells were resuspended in 200 μl/well D-PBS−/1% FBS/1 μg/ml 7-aminoactinomycin D (7-AAD; Molecular Probes) and analyzed by flow cytometry on a FACSCalibur (Becton Dickinson, San Jose, Calif.) equipped with a 488 nM laser. Following gating to exclude dead cells (7-AAD positive), VEGFR-2-expressing cells and CHO-pcDNA3 cells were measured independently for Alexa Fluor 488 fluorescence by gating on the CMTMR-negative or -positive populations, respectively. Control experiments showed that staining with CMTMR did not interfere with the detection of Alexa Fluor 488-conjugated antibodies on the surface of the stained cells.
Cell-surface binding was also assessed by fluorescence microscopy using the secondary antibodies described above. For these studies, antibodies were diluted in D-PBS containing calcium and magnesium (D-PBS+)/10% FBS. Cells were grown on 24- or 96-well plates, and following staining were kept in D-PBS+ for observation on an inverted fluorescence microscope.
Ba/F3 Cell Proliferation Assay:
Ba/F3 cells were washed three times in minimal Ba/F3 medium and resuspended in the same medium containing 15.8 ng/ml of proliferation factor (human VEGF165, murine VEGF164, or hNT-4 for Ba/F3-KDR, Ba/F3-Flk, or Ba/F3-TrkB cells, respectively), and 95 μl containing 5×104 Ba/F3-KDR cells or 2×104 Ba/F3-Flk or Ba/F3-TrkB cells were added per well to a 96-well tissue culture plate. 5 μl of serial dilutions of test protein in PBS was added to each well for a final volume of 100 μl Ba/F3 medium/5% PBS/15 ng/ml growth factor. After incubation for 72 hours at 37° C., proliferation was measured by addition of 20 μl of CellTiter 96® Aqueous One Solution Reagent (Promega) to each well, incubation for 4 hours at 37° C., and measurement of the absorbance at 490 nm using a microtiter plate reader (Molecular Dynamics).
HUVEC Cell Proliferation Assay:
HUVEC cells (Clonetics, Walkersville, Md.) from passage 2-6 were grown in EGM-2 medium (Clonetics). 5000 cells/well were resuspended in 200 μl starvation medium (equal volumes of DMEM (Gibco) and F-12K medium (ATCC), supplemented with 0.2% fetal bovine serum and 1× penicillin/streptomycin/fungizone solution (Gibco)), plated in 96-well tissue culture plates and incubated for 48 hours. Fibronectin-based binding proteins were added to the wells and incubated for 1 hour at 37°, and then human VEGF165 was added to a final concentration of 16 ng/ml. After 48 hours incubation, cell viability was measured by addition of 30 μl/well of a mixture of 1.9 mg/ml CellTiter96® AQueous MTS reagent (Promega) with 44 μg/ml phenazine methosulfate (Sigma) and measurement of absorbance at 490 nm as described above for Ba/F3 cells.
Light chain variable domain proteins were generated using the PROfusion™ system, as described above for use with 10Fn3-derived proteins.
All references cited herein are hereby incorporated by reference in their entirety
MGLYGHELLTP
DGKDGPVLLTP
FGLYGKELLIP
TGPNDRLLFVP
DVYNDHEIKTP
LALKGHELLTP
REENDHELLIP
EVHHDREIKTP
MAQSGHELFTP
DGRNDRKLMVP
DGQNGRLLNVP
DGWNGRLLSIP
EERNGRTLRTP
LERNGRELMTP
LERNGRELMVP
LERNGRELFTP
WERNGRELFTP
KERNGRELFTP
TERT
G
RELFTP
KERNGRELFTP
LERDGRELFTP
WERNGRELFTP
KER
SG
RELFTP
VSDVPRDLEVVAATPTSLLISW
DAPAVTV
RYYRITYGETGGNSPVQEFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT
Column ‘BC Loop (23-30)’ discloses “RHPHFPTR” (SEQ ID NO: 238) and “RHPHFPTH” (SEQ ID NO: 264). Column ‘DE Loop (52-56)’ discloses “LQPPT” (SEQ ID NO: 239), “LQPPA” (SEQ ID NO: 249), “LQPTV” (SEQ ID NO: 261), “LQPPL” (SEQ ID NO: 267), and “LQPTT” (SEQ ID NO: 270). SEQ ID NOs 240-248, 250-260, 262-263, 265-266, 268-269, and 271-272 are disclosed in the ‘FG loop (77-87)’ column. ‘WT’ disclosed as SEQ ID NO: 5.
This application is a continuation of U.S. patent application Ser. No. 15/070,572, filed Mar. 15, 2016, which is a continuation of U.S. patent application Ser. No. 14/071,069, filed Nov. 4, 2013 (now U.S. Pat. No. 9,328,157), which is a continuation of U.S. patent application Ser. No. 13/552,398, filed Jul. 18, 2012 (now U.S. Pat. No. 8,609,613), which is a continuation of U.S. patent application Ser. No. 12/788,240, filed May 26, 2010 (now U.S. Pat. No. 8,324,362), which is a continuation of U.S. patent application Ser. No. 11/448,171, filed Jun. 5, 2006 (now U.S. Pat. No. 7,858,739), which is a continuation of International Patent Application No. PCT/US04/40885, filed Dec. 6, 2004, which claims the benefit of U.S. Provisional Application No. 60/527,886, filed Dec. 5, 2003. The contents of the aforementioned applications are hereby incorporated by reference.
Number | Name | Date | Kind |
---|---|---|---|
3773919 | Boswell et al. | Nov 1973 | A |
4863457 | Lee | Sep 1989 | A |
4997652 | Wong | Mar 1991 | A |
5164188 | Wong | Nov 1992 | A |
5235041 | Cappello et al. | Aug 1993 | A |
5443505 | Wong et al. | Aug 1995 | A |
5501856 | Ohtori et al. | Mar 1996 | A |
5514581 | Ferrari et al. | May 1996 | A |
5516522 | Peyman et al. | May 1996 | A |
5545620 | Wahl et al. | Aug 1996 | A |
5641648 | Ferrari et al. | Jun 1997 | A |
5766242 | Wong et al. | Jun 1998 | A |
5770697 | Ferrari et al. | Jun 1998 | A |
5792742 | Gold et al. | Aug 1998 | A |
5824072 | Wong | Oct 1998 | A |
5869079 | Wong et al. | Feb 1999 | A |
5922676 | Pasqualini et al. | Jul 1999 | A |
6018030 | Ferrari et al. | Jan 2000 | A |
6207446 | Szostak et al. | Mar 2001 | B1 |
6214553 | Szostak et al. | Apr 2001 | B1 |
6255458 | Lonberg et al. | Jul 2001 | B1 |
6258558 | Szostak et al. | Jul 2001 | B1 |
6261804 | Szostak et al. | Jul 2001 | B1 |
6281344 | Szostak et al. | Aug 2001 | B1 |
6342219 | Thorpe et al. | Jan 2002 | B1 |
6348333 | Niwa et al. | Feb 2002 | B1 |
6369116 | Wong et al. | Apr 2002 | B1 |
6383775 | Duff et al. | May 2002 | B1 |
6462189 | Koide | Oct 2002 | B1 |
6518018 | Szostak et al. | Feb 2003 | B1 |
6524583 | Thorpe et al. | Feb 2003 | B1 |
6559126 | Tournaire et al. | May 2003 | B2 |
6660492 | Bode et al. | Dec 2003 | B1 |
6699493 | Wong | Mar 2004 | B2 |
6818418 | Lipovsek et al. | Nov 2004 | B1 |
7053701 | Vice | May 2006 | B2 |
7115396 | Lipovsek et al. | Oct 2006 | B2 |
7556925 | Koide et al. | Jul 2009 | B2 |
7598352 | Koide | Oct 2009 | B2 |
7847062 | Chen et al. | Dec 2010 | B2 |
7858739 | Chen et al. | Dec 2010 | B2 |
7858759 | Brandt et al. | Dec 2010 | B2 |
8067201 | Morin et al. | Nov 2011 | B2 |
8221765 | Camphausen et al. | Jul 2012 | B2 |
8258265 | Koide | Sep 2012 | B2 |
8263741 | Koide | Sep 2012 | B2 |
8278419 | Jacobs et al. | Oct 2012 | B2 |
8293482 | Jacobs et al. | Oct 2012 | B2 |
8324362 | Chen et al. | Dec 2012 | B2 |
8343501 | Emanuel et al. | Jan 2013 | B2 |
8470332 | Camphausen et al. | Jun 2013 | B2 |
8524244 | Camphausen et al. | Sep 2013 | B2 |
8609613 | Chen et al. | Dec 2013 | B2 |
8728483 | Camphausen et al. | May 2014 | B2 |
8969289 | Gosselin et al. | Mar 2015 | B2 |
9017655 | Emanuel et al. | Apr 2015 | B2 |
9234028 | Camphausen et al. | Jan 2016 | B2 |
9328157 | Chen et al. | May 2016 | B2 |
9540424 | Gosselin et al. | Jan 2017 | B2 |
9605039 | Lipovsek et al. | Mar 2017 | B2 |
9771411 | Emanuel et al. | Sep 2017 | B2 |
9862758 | Chen et al. | Jan 2018 | B2 |
9902762 | Camphausen et al. | Feb 2018 | B2 |
9920108 | Camphausen | Mar 2018 | B2 |
10183987 | Emanuel et al. | Jan 2019 | B2 |
10221232 | Camphausen et al. | Mar 2019 | B2 |
10221438 | Gosselin et al. | Mar 2019 | B2 |
10273286 | Camphausen et al. | Apr 2019 | B2 |
20020019517 | Koide | Feb 2002 | A1 |
20020061307 | Whitlow et al. | May 2002 | A1 |
20030104520 | Ellington et al. | Jun 2003 | A1 |
20030170753 | Koide | Sep 2003 | A1 |
20030186385 | Koide | Oct 2003 | A1 |
20050244469 | Whitcup et al. | Nov 2005 | A1 |
20050255548 | Lipovsek et al. | Nov 2005 | A1 |
20050281861 | Hughes et al. | Dec 2005 | A1 |
20060182783 | Hughes et al. | Aug 2006 | A1 |
20060210604 | Dadey et al. | Sep 2006 | A1 |
20060246059 | Lipovsek et al. | Nov 2006 | A1 |
20060246549 | Kurz et al. | Nov 2006 | A1 |
20060270604 | Lipovsek et al. | Nov 2006 | A1 |
20070059336 | Hughes et al. | Mar 2007 | A1 |
20070072933 | Peyman | Mar 2007 | A1 |
20070082365 | Lipovsek et al. | Apr 2007 | A1 |
20070088014 | Edelman et al. | Apr 2007 | A1 |
20070099879 | Sheibani et al. | May 2007 | A1 |
20070160533 | Chen et al. | Jul 2007 | A1 |
20070203089 | Rodrigues et al. | Aug 2007 | A1 |
20080108798 | Lipovsek et al. | May 2008 | A1 |
20080220049 | Chen et al. | Sep 2008 | A1 |
20080268051 | Hughes et al. | Oct 2008 | A1 |
20090176654 | Cappuccilli et al. | Jul 2009 | A1 |
20100144601 | Jacobs et al. | Jun 2010 | A1 |
20100152063 | Cappuccilli et al. | Jun 2010 | A1 |
20100273216 | Morin et al. | Oct 2010 | A1 |
20100298541 | Wu et al. | Nov 2010 | A1 |
20100322930 | Kolbinger et al. | Dec 2010 | A1 |
20110021746 | Cappuccilli et al. | Jan 2011 | A1 |
20110038866 | Hastewell et al. | Feb 2011 | A1 |
20110123545 | Marsh et al. | May 2011 | A1 |
20110124527 | Cappuccilli et al. | May 2011 | A1 |
20110274623 | Jacobs | Nov 2011 | A1 |
20110275535 | Loew | Nov 2011 | A1 |
20110305663 | Gosselin et al. | Dec 2011 | A1 |
20120208704 | Loew et al. | Aug 2012 | A1 |
20120270797 | Wittrup et al. | Oct 2012 | A1 |
20130079243 | Diem et al. | Mar 2013 | A1 |
20130079280 | Baca et al. | Mar 2013 | A1 |
20130096019 | Jacobs et al. | Apr 2013 | A1 |
20130096058 | Baca et al. | Apr 2013 | A1 |
20130237684 | Koide | Sep 2013 | A1 |
20130267676 | Koide | Oct 2013 | A1 |
20130310317 | Camphausen et al. | Nov 2013 | A1 |
20140057807 | Loew et al. | Feb 2014 | A1 |
20140094595 | Lipovsek et al. | Apr 2014 | A1 |
20140349929 | Camphausen et al. | Nov 2014 | A1 |
20150152147 | Gosselin et al. | Jun 2015 | A1 |
20150252097 | Camphausen et al. | Sep 2015 | A1 |
20150259398 | Emanuel et al. | Sep 2015 | A1 |
20160152688 | Camphausen et al. | Jun 2016 | A1 |
20170145464 | Gosselin et al. | May 2017 | A1 |
20170166627 | Camphausen et al. | Jun 2017 | A1 |
20170275342 | Lipovsek et al. | Sep 2017 | A1 |
20170334958 | Lipovsek et al. | Nov 2017 | A1 |
20180037631 | Emanuel et al. | Feb 2018 | A1 |
20180244755 | Camphausen et al. | Aug 2018 | A1 |
20180265572 | Camphausen et al. | Sep 2018 | A1 |
20190153069 | Emanuel et al. | May 2019 | A1 |
20190202894 | Camphausen et al. | Jul 2019 | A1 |
20190203248 | Gosselin et al. | Jul 2019 | A1 |
20190263892 | Camphausen et al. | Aug 2019 | A1 |
Number | Date | Country |
---|---|---|
0430539 | Jun 1991 | EP |
0488401 | Jun 1992 | EP |
0654256 | May 1995 | EP |
1266025 | Nov 2006 | EP |
1137941 | Aug 2009 | EP |
2141243 | Jan 2010 | EP |
2385067 | Nov 2011 | EP |
2439212 | Apr 2012 | EP |
2379718 | Mar 2013 | EP |
4-108827 | Apr 1992 | JP |
9513765 | May 1995 | WO |
9812226 | Mar 1998 | WO |
9831700 | Jul 1998 | WO |
9856915 | Dec 1998 | WO |
9951773 | Oct 1999 | WO |
0034784 | Jun 2000 | WO |
0164942 | Sep 2001 | WO |
0204523 | Jan 2002 | WO |
0232925 | Apr 2002 | WO |
02081497 | Oct 2002 | WO |
03022858 | Mar 2003 | WO |
03075840 | Sep 2003 | WO |
03104418 | Dec 2003 | WO |
2005056764 | Jun 2005 | WO |
2008031098 | Mar 2008 | WO |
2008066752 | Jun 2008 | WO |
2008097497 | Aug 2008 | WO |
2009023184 | Feb 2009 | WO |
2009025806 | Feb 2009 | WO |
2009058379 | May 2009 | WO |
2009073115 | Jun 2009 | WO |
2009083804 | Jul 2009 | WO |
2009086116 | Jul 2009 | WO |
2009102421 | Aug 2009 | WO |
2009133208 | Nov 2009 | WO |
2009142773 | Nov 2009 | WO |
2010051274 | May 2010 | WO |
2010051310 | May 2010 | WO |
2010060095 | May 2010 | WO |
2010069913 | Jun 2010 | WO |
2010093627 | Aug 2010 | WO |
2010093771 | Aug 2010 | WO |
2011020033 | Feb 2011 | WO |
2011035202 | Mar 2011 | WO |
2011051333 | May 2011 | WO |
2011051466 | May 2011 | WO |
2011092233 | Aug 2011 | WO |
2011100700 | Aug 2011 | WO |
2011103105 | Aug 2011 | WO |
2011130324 | Oct 2011 | WO |
2011130328 | Oct 2011 | WO |
2011130354 | Oct 2011 | WO |
2011137319 | Nov 2011 | WO |
2011140086 | Nov 2011 | WO |
2011150133 | Dec 2011 | WO |
2012016245 | Feb 2012 | WO |
2012088006 | Jun 2012 | WO |
2012142515 | Oct 2012 | WO |
2012158678 | Nov 2012 | WO |
2012158739 | Nov 2012 | WO |
2013049275 | Apr 2013 | WO |
Entry |
---|
Huang, Hu et al., “Blockade of VEGFR1 and 2 Suppresses Pathological Angiogenesis and Vascular Leakage in the Eye,” PLoS One, vol. 6(6):e21411, doi:10.1371/journal.pone.0021411, 14 pages (2011). |
Hynes, Richard O. et al., “Integrins: Versatility, Modulation, and Signaling in Cell Adhesion,” Cell, vol. 69:11-25 (1992). |
International Preliminary Report on Patentability and Written Opinion for Application No. PCT/US2004/040885, 6 pages, dated Feb. 21, 2006. |
International Search Report for Application No. PCT/US04/40885, 3 pages, dated Feb. 21, 2006. |
Jain, Rakesh K. et al., “Dissecting Tumour Pathophysiology Using Intravital Microscopy,” Nature Reviews Cancer, vol. 2:266-276 (2002). |
Jakob, W. et al., “The chick embryo chorioallantoic membrane as a bioassay for angiogenesis factors: Reactions induced by carrier materials,” Experimentelle Pathologie, vol. 15(5):241-249 (1978). |
Jung, Gyoo Yeol et al., “A Functional Protein Chip for Pathway Optimization and in Vitro Metabolic Engineering,” Science, vol. 304:428-431 (2004). |
Keefe, Anthony D. et al., “Functional proteins from a random-sequence library,” Nature, vol. 410:715-718 (2001). |
King, C.A. et al., “DNA vaccines with single-chain Fv fused to fragment C of tetanus toxin induce protective immunity against lymphoma and myeloma,” Nature Medicine, vol. 4(11):1281-1286 (1998). |
Kohler, G. et al., “Continuous cultures of fused cells secreting antibody of predefined specificity,” vol. 256:495-497 (1975). |
Koide, Akiko et al., “Stabilization of a Fibronectin Type III Domain by the Removal of Unfavorable Electrostatic Interactions on the Protein Surface,” Biochemistry, vol. 40:10326-10333 (2001). |
Koide, Akiko et al., “The Fibronectin Type III Domain as a Scaffold for Novel Binding Proteins,” J. Mol. Biol., vol. 284:1141-1151 (1998). |
Koide, Shohei et al., “Directed Evolution of Fibronectin Type III Domain to Novel Ligand Binding Proteins,” FASEB J., vol. 11(9):A1155, Abstract No. 1739 (1997). |
Koide, Shohei et al., “Directed Evolution of Fibronectin Type III Domain to Novel Ligand Binding Proteins,” FASEB J., vol. 11(9):A837, Abstract No. M40 (1997). |
Ku, Jung et al., “Alternate protein frameworks for molecular recognition,” Proc. Natl. Acad. Sci. USA, vol. 92:6552-6556 (1995). |
Kurz, Markus et al., “Psoralen photo-crosslinked mRNA-puromycin conjugates: a novel template for the rapid and facile preparation of mRNA-protein fusions,” Nucleic Acids Research, vol. 28(18):e83, 5 pages, (2000). |
Leahy, D.J. et al., “2.0 a crystal structure of a four-domain segment of human fibronectin encomopassing the RGD loop and synergy region,” Cell, vol. 84(1):155-164 (1996). |
Leahy, Daniel J. et al., “Structure of a Fibronectin Type III Domain from Tenascin Phased by MAD Analysis of the Selenomethionyl Protein,” Science, vol. 258:987-991 (1992). |
Lee, G. et al., “Strong Inhibition of Fibrogen Binding to Platelet Receptor Alpha2b beta 3 by RGD Sequences Installed into a Presentation Scaffold,” Prot. Eng., vol. 6:745-754 (1993). |
Lipovsek, Dasa et al., “In-vitro protein evolution by ribosome display and mRNA display,” Journal of Immunological Methods, vol. 290:51-67 (2004). |
Litvinovich, Sergei V. et al., “Interactions Between Type III Domains in the 110 kDa Cell-binding Fragments of Fibronectin,” J. Mol. Biol., vol. 248:611-626 (1995). |
Lombardo, A. et al., “Conformational flexibility and crystallization of tandemly linked type III modules of human fibronectin,” Protein Science, vol. 5:1934-1938 (1996). |
Lu, Dan et al., “Tailoring in Vitro Selection for a Picomolar Affinity Human Antibody Directed against Vascular Endothelial Growth Factor Receptor 2 for Enhanced Neutralizing Activity,” The Journal of Biological Chemistry, vol. 278(44):43496-43507 (2003). |
Lyden, David et al., “Impaired recruitment of bone-marrow-derived endothelial and hematopoietic precursor cells blocks tumor angiogenesis and growth,” Nature Medicine, vol. 7(11):1194-1201 (2001). |
Maeda, Hiroshi, “SMANCS and polymer-conjugated macromolecular drugs: advantages in cancer chemotherapy,” Advanced Drug Delivery Reviews, vol. 46:169-185 (2001). |
Main, Alison L. et al., “The Three-Dimensional Structure of the Tenth Type III Module of Fibronectin: An Insight into RGD-Mediated Interactions,” Cell, vol. 71:671-678 (1992). |
Mao, Y. et al., “Fibronectin fibrillogenesis, a cell-mediated matrix assembly process,” Matrix Biol., vol. 24(6):389-399 (2005). |
Markland, William et al., “Iterative Optimization of High-Affinity Protease Inhibitors Using Phage Display 1. Plasmin.,” Biochemistry, vol. 35(24):8045-8057 (1996). |
Markland, William et al., “Iterative Optimization of High-Affinity Protease Inhibitors Using Phage Display 2. Plasma Kallikrein and Thrombin,” Biochemistry, vol. 35:8058-8067 (1996). |
Maruyama, Kazuo et al., “Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides,” Gene, vol. 138:171-174 (1994). |
Matsushima, Ayako et al., “Modification of E. coli Asparaginase with 2,4-Bis(O-Methoxypolyethylene Glycol)-6-Chloro-S-Triazine(Activated Peg2); Disappearance of Binding Ability Towards Anti-Serum and Retention of Enzymic Activity,” Chemistry Letters, pp. 773-776 (1980). |
McConnell, Stephen J. et al., “Tendamistat as a Scaffold for Conformationally Constrained Phage Peptide Libraries,” J. Mol. Biol., vol. 250:460-470 (1995). |
McLeod, D. Scott et al., “Localization of VEGF Receptor-2 (KDR/Flk-1) and Effects of Blocking It in Oxygen-Induced Reginopathy,” Investigative Ophthalmology & Visual Science, vol. 43(2):474-482 (2002). |
McPherson, Michael et al., “Drug Receptor Identification from Multiple Tissues Using Cellular-Derived mRNA Display Libraries,” Chemistry & Biology, vol. 9:691-698 (2002). |
Meinke, A. et al., “Cellulose-Binding Polypeptides from Cellulomonas fimi: Endoglucanase D (CenD), a Family A beta-1,4-Glucanase,” Journal of Bacteriology, vol. 175(7):1910-1918 (1993). |
Meissner, Markus et al., “Suppression of VEGFR2 Expression in Human Endothelial Cells by Dimethylfumarate Treatment: Evidence for Anti-Angiogenic Action,” Journal of Investigative Dermatology, vol. 131:1356-1364 (2011). |
Meyer, Rosana D. et al., “Comparative Structure-Function Analysis of VEGFR-1 and VEGFR-2,” Ann. N.Y. Acad. Sci., vol. 995:200-207 (2003). |
Muller, Christoph W. et al., “Structure of the NF-kappaB p50 homodimer bound to DNA,” Nature, vol. 373:311-317 (1995). |
Muyldermans, Serge, “Single domain camel antibodies: current status,” Reviews in Molecular Biotechnology, vol. 74:277-302 (2001). |
Nemoto, Naoto et al., “In vitro virus: Bonding of mRNA bearing puromycin at the 3′-terminal end to the C-terminal end of its encoded protein on the ribosome in vitro,” FEBS Letters, vol. 414:405-408 (1997). |
Ng, Eugene W.M. et al., “Targeting angiogenesis, the underlying disorder in neovascular age-related macular degeneration,” Can. J. Ophthalmol., vol. 40:352-368 (2005). |
Ngo, J. Thomas et al., “Computational Complexity, Protein Structure Prediction, and the Levinthal Paradox,” The Protein Folding Problem and Tertiary Structure Prediction, K. Merz (Ed.). Birkhauser, Boston, Chapter 14, pp. 432-440 and 492-495 (1994). |
Nilsen, Timothy W., “Trans-Splicing in Protozoa and Helminths,” Infections Agents and Disease, vol. 1:212-218 (1992). |
Nord, Karin et al., “A combinatorial library of an alpha-helical bacterial receptor domain,” Prot. Eng., vol. 8:601-608 (1995). |
Nord, Karin et al., “Binding proteins selected from combinatorial libraries of an alpha-helical bacterial receptor domain,” Nature Biotechnology, vol. 15:772-777 (1997). |
Nygren, Per-Ake et al., “Scaffolds for engineering novel binding sites in proteins,” Current Opinion in Structural Biology, vol. 7:463-469 (1997). |
Parker, M.H. et al., “Antibody mimics based on human fibronectin type three domain engineered for thermostability and high-affinity binding to vascular endothelial growth factor receptor two,” Protein Engineering, Design & Selection, vol. 18(9):435-444 (2005). |
Patel, Neela et al., “A Selective and Oral Small Molecule Inhibitor of Vascular Epithelial Growth Factor Receptor (VEGFR)-2 and VEGFR-1 Inhibits Neovascularization and Vascular Permeability,” The Journal of Pharmacology and Experimental Therapeutics, vol. 306(3):838-845 (2003). |
Phillips, Anthony J., “The challenge of gene therapy and DNA delivery,” Journal of Pharmacy and Pharmacology, vol. 53:1169-1174 (2001). |
Plaxco, Kevin W. et al., “A Comparison of the Folding Kinetics and Thermodynamics of Two Homologous Fibronectin Type III Modules,” J. Mol. Biol., vol. 270:763-770 (1997). |
Apte, Aaron N. et al., “Anchor-Ligated cDNA Libraries: A Technique for Generating a cDNA Library for the Immediate Cloning of the 5′ Ends of mRNAs,” BioTechniques, vol. 15(5):890-893 (1993). |
Bae, Dong-Goo et al., “Arginine-rich Anti-vascular Endothelial Growth Factor Peptides Inhibit Tumor Growth and Metastasis by Blocking Angiogenesis,” The Journal of Biological Chemistry, vol. 275(18):13588-13596 (2000). |
Baggio, Rick et al., “Identification of epitope-like consensus motifs using mRNA display,” Journal of Molecular Recognition, vol. 15:126-134 (2002). |
Baron, Martin et al., “H NMR Assignment and Secondary Structure of the Cell Adhesion Type III Module of Fibronectin,” Biochemistry, vol. 31:2068-2073 (1992). |
Baron, Martin et al., “Protein modules,” TIBS, vol. 16:13-17 (1991). |
Batori, Vincent et al., “Exploring the potential of the monobody scaffold: effects of loop elongation on the stability of a fibronectin type III domain,” Protein Engineering, vol. 15(12):1015-1020 (2002). |
Bianchi, Elisabetta et al., “High Level Expression and Rational Mutagenesis of a Designed Protein, the Minibody,” J. Mol. Biol., vol. 236:649-659 (1994). |
Boder, Eric T. et al., “Directed evolution of antibody fragments with monovalent femtomolar antigen-binding affinity,” PNAS, vol. 97(20):10701-10705 (2000). |
Boder, Eric T. et al., “Yeast surface display for screening combinatorial polypeptide libraries,” Nature Biotechnology, vol. 15:553-557 (1997). |
Boldicke, Thomas et al., “Anti-VEGFR-2 scFvs for Cell Isolation. Single-Chain Antibodies Recognizing the Human Vascular Endothelial Growth Factor Receptor-2 (VEGFR-2/flk-1) on the Surface of Primary Endothelial Cells and Preselected CD34+ Cells from Cord Blood,” Stem Cells, vol. 19:24-36 (2001). |
Bork, P. et al.,“The Immunoglobulin Fold, Structural Classification, Sequence Patterns and Common Core,” J. Mol. Biol., vol. 242:309-320 (1994). |
Bork, Peer et al., “Proposed acquisition of an animal protein domain by bacteria,” Proc. Natl. Acad. Sci. USA, vol. 89:8990-8994 (1992). |
Bork, Peer, “Go hunting in sequence databases but watch out for the traps,” TIG, vol. 12(10):425-427 (1996). |
Bork, Peer, “Powers and Pitfalls in Sequence Analysis: The 70% Hurdle,” Genome Research, vol. 10(4):398-400 (2000). |
Brenchley, P.E.C. et al., “Angiogenesis in inflammatory joint disease: a target for therapeutic intervention,” Clin. Exp. Immunol., vol. 121:426-429 (2000). |
Brenner, Steven E., “Errors in genome annotation,” TIG, vol. 15(4):132-133 (1999). |
Brock, Kenny V. et al., “Nucleotide sequencing of 5′ and 3′ termini of bovine viral diarrhea virus RNA ligation and PCR,” Journal of Virological Methods, vol. 38:39-46 (1992). |
Bruzik, James P. et al., “Spliced leader RNAs from lower eukaryotes are trans-spliced in mammalian cells,” Nature, vol. 360:692-695 (1992). |
Caliceti, Paolo et al., “Pharmacokinetic and biodistribution properties of poly(ethylene glycol)-protein conjugates,” Advanced Drug Delivery Reviews, vol. 55:1261-1277 (2003). |
Campbell, Iain D. et al., “Building proteins with fibronectin type III modules. Fibronectin type III modules are versatile components of many proteins. Recent structures of module pairs show how these modules are joined together,” Structure, vol. 2:333-337 (1994). |
Carvalho, Jozelio Freire et al., “Vascular Endothelial Growth Factor (VEGF) in Autoimmune Diseases,” Journal of Clinical Immunology, vol. 27(3):246-256 (2007). |
Choy, E.H.S. et al., “Efficacy of a novel PEGylated humanized anti-TNF fragment (CDP870) in patients with rheumatoid arthritis: a phase II double-blinded, randomized, dose-escalating trial,” Rheumatology, vol. 41:1133-1137 (2002). |
Clackson, Tim et al., “In vitro selection from protein and peptide libraries,” TIBTECH, vol. 12:173-184 (1994). |
Clackson, Tim et al., “Making antibody fragments using phage display libraries,” Nature, vol. 352:624-628 (1991). |
Claffey, Kevin P. et al., “Vascular Endothelial Growth Factor, Regulation by Cell Differentiation and Activated Second Messenger Pathways,” The Journal of Biological Chemistry, vol. 267(23):16317-16322 (1992). |
Clarke, Jane et al., “Folding and Stability of a Fibronectin Type III Domain of Human Tenascin,” J. Mol. Biol., vol. 270:771-778 (1997). |
Connelly, R.J. et al., “Mitogenic properties of a bispecific single-chain Fv-Ig fusion generated from CD2-specific mAb to distinct epitopes,” International Immunity, vol. 10(12):1863-1872 (1998). |
Copie, Valerie et al., “Solution Structure and Dynamics of Linked Cell Attachment Modules of Mouse Fibronectin Containing the RGD and Synergy Regions: Comparison with the Human Fibronectin Crystal Structure,” J. Mol. Biol., vol. 277:663-682 (1998). |
Cota, Ernesto et al., “Two Proteins with the Same Structure Respond very Differently to Mutation: The Role of Plasticity in Protein Stability,” J. Mol. Biol., vol. 302:713-725 (2000). |
Cujec, Thomas P. et al., “Selection of v-Abl Tyrosine Kinase Substrate Sequences from Randomized Peptide and Cellular Proteomic Libraries Using mRNA Display,” Chemistry & Biology, vol. 9:253-264 (2002). |
DGENE Search Results, STN Search Results, 33 pages (2005). |
Dickinson, Craig D. et al., “Crystal Structure of the Tenth Type III Cell Adhesion Module of Human Fibronectin,” J. Mol. Biol., vol. 236:1079-1092 (1994). |
Dickinson, Craig D. et al., “Crystals of the Cell-binding Module Module of Fibronectin Obtained from a Series of Recombinant Fragments Differing in Length,” J. Mol. Biol., vol. 238:123-127 (1994). |
Doerks, Tobias et al., “Protein annotation: detective work for function prediction,” TIG, vol. 14(6):248-250 (1998). |
Ely, Kathryn R. et al., “Common molecular scaffold for two unrelated RGD molecules,” Protein Engineering, vol. 8(8):823-827 (1995). |
Ferguson, Kimberly et al., “The SL1 trans-spliced leader RNA performs an essential embryonic function in Caenorhabditis elegans that can also be supplied by SL2 RNA,” Genes & Development, vol. 10:1543-1556 (1996). |
GenBank Accession No. AAC48614, MacLeod, J.N., “Fibronectin mRNA splice variant in articular cartilage lacks bases encoding the V, III-15, and I-10 protein segments,” J. Biol. Chem., vol. 271(31):18954-18960 (1996), 2 pages, (1996). |
GenBank Accession No. ABB78921, Lipovsek, D. et al., “New non-antibody proteins having an immunoglobulin fold, useful in research, therapeutic or diagnostic fields, particularly as scaffolds for designing proteins with specific properties, e.g. for binding any antigen of interest,” 33 pages, (2005). |
GenBank Accession No. CAA26536, Kornblihtt, A.R. et al., “Isolation and characterizations of cDNA clones for human and bovine fibronectins,” Proc. Natl. Acad. Sci. USA, vol. 80(11):3218-3222 (1983), 6 pages, (2005). |
GenBank Accession No. P07589, Elsik, C.G. et al., “The genome sequence of taurine cattle: a window to ruminant biology and evolution,” Science, vol. 324(5926):522-528 (2009), 16 pages (2012). |
GenBank Accession No. X02761, Kornblihtt, A.R. et al., “Isolation and characterization of cDNA clones for human and bovine fibronectins,” Proc. Natl. Acad. Sci. USA, vol. 80(11):3218-3222 (1983), 4 pages, (2005). |
Ghosh, Gourisankar et al., “Structure of NF-kappaB p50 homodimer bound to a kappaB site,” Nature, vol. 373:303-310 (1995). |
Gill, Davinder S. et al., “Biopharmaceutical drug discovery using novel protein scaffolds,” Current Opinion in Biotechnology, vol. 17:653-658 (2006). |
Grant, Richard P. et al., “Structural Requirements for Biological Activity of the Ninth and Tenth Fill Domains of Human Fibronectin,” The Journal of Biological Chemistry, vol. 272(10):6159-6166 (1997). |
Hamers-Casterman, C. et la., “Naturally occurring antibodies devoid of light chains,” Nature, vol. 363:446-448 (1993). |
Hammond, Philip W. et al., “In Vitro Selection and Characterization of Bcl-XL-binding Proteins from a Mix of Tissue-specific mRNA Display Libraries,” The Journal of Biological Chemistry, vol. 276(24):20898-20906 (2001). |
Harpaz, Yahouda et al., “Many of the Immunoglobulin Superfamily Domains in Cell Adhesion Molecules and Surface Receptors Belong to a New Structural Set Which is Clos to That Containing Variable Domains,” J. Mol. Biol., vol. 238:528-539 (1994). |
Hey, Thomas et al., “Artificial, non-antibody binding proteins for pharmaceutical and industrial applications,” Trends in Biotechnology, vol. 23(10):514-522 (2005). |
Hocking, Denise C. et al., “A Novel Role for the Integrin-binding III-10 Module in Fibronectin Matrix Assembly,” The Journal of Cell Biology, vol. 133(2):431-444 (1996). |
Hocking, Denise C. et al., “Activation of Distinct alpha5beta1-mediated Signaling Pathways by Fibronectin's Cell Adhesion and Matrix Assembly Domains,” The Journal of Cell Biology, vol. 141(1):241-253 (1998). |
Plaxco, Kevin W. et al., “Rapid refolding of a proline-rich all-beta-sheet fibronectin type III module,” Proc. Natl. Acad. Sci. USA, vol. 93:10703-10706 (1996). |
Posey, J. et al., “A Phase I Trial of an Anti-KDR (VEGFR2) Chimeric Antibody in Patients wtih Liver Metastases in Colorectal Cancer (CRC),” American Society of Clinical Oncology, Slides from the annual meeting, 20 pages, (2002). |
Potts, Jennifer R. et al., “Fibronectin structure and assembly,” Current Opinion in Cell Biology, vol. 6:648-655 (1994). |
Potts, Jennifer R. et al., “Structure and Function of Fibronectin Modules,” Matrix Biology, vol. 15:313-320 (1996). |
Proescholdt, Martin A. et al., “Vascular Endothelial Growth Factor Is Expressed in Multiple Sclerosis Plaques and Can Induce Inflammatory Lesions in Experimental Allergic Encephalomyelitis Rats,” Journal of Neuropathology and Experimental Neurology, vol. 61(10):914-925 (2002). |
Richards, Julie et al., “Engineered Fibronectin Type III Domain with a RGDWXE Sequence Binds with Enhanced Affinity and Specificity to Human alphavbeta3 Integrin,” J. Mol. Biol., vol. 326:1475-1488 (2003). |
Roberts, Richard W. et al., “RNA-peptide fusions for the in vitro selection of peptides and proteins,” Proc. Natl. Acad. Sci. USA, vol. 94:12297-12302 (1997). |
Roberts, Richard W., “Totally in vitro protein selection using mRNA-protein fusions and ribosome display,” Current Opinion in Chemical Biology, vol. 3:268-273 (1999). |
Rottgen, Peter et al., “A human pancreatic secretory trypsin inhibitor presenting a hypervariable highly constrained epitope via monovalent phagemid display,” Gene, vol. 164:243-250 (1995). |
Shibata, K. et al., “A attempt to substitute the cell binding domain of human fibronectin in lambda phage J protein: Computer design and expression,” Biochimie, vol. 75:459-465 (1993). |
Shibuya, Masabumi, “Vascular endothelial growth factor receptor-2: Its unique segnaling and specific ligand, VEGF-E,” Cancer Sci., vol. 94(9):751-756 (2003). |
Shima, David T. et al., “The Mouse Gene for Vascular Endothelial Growth Factor,” The Journal of Biological Chemistry, vol. 271(7):3877-3883 (1996). |
Skolnick, Jeffrey et al., “From genes to protein structure and function: novel applications of computational approaches in the genomic era,” TibTech, vol. 18:34-39 (2000). |
Smith, George P. et al., “Phage Display,” Chem. Rev., vol. 97:391-410 (1997). |
Smith, Temple F. et al., “The challenges of genome sequence annotation of ‘The devil is in the details’,” Nature Biotechnology, vol. 15:1222-1223 (1997). |
Takahashi, Satoru, “Target Therapy for Cancer: Anti-Cancer Drugs Targeting Growth-Factor Signaling Molecules. VAscular Endothelial Growth Factor (VEGF), VEGF Receptors and Their Inhibitors for Antiangiogenic Tumor Therapy,” Biol. Pharm. Bull, vol. 34(12):1785-1788 (2011). |
Tang, Lisa et al., “Pharmacokinetic Aspects of Biotechnology Products,” Journal of Pharmaceutical Sciences, vol. 93(9):2184-2204 (2004). |
Tischer, Edmund et al., “The Human Gene for Vascular Endothelial Growth Factor, Multiple Protein Forms are Encoded Through Alternative Exon Splicing,” The Journal of Biological Chemistry, vol. 266(18):11947-11954 (1991). |
Tramontano, Anna et al., “The Making of the Minibody: an Engineered beta-Protein for the Display of Conformationally Constrained Peptides,” Journal of Molecular Recognition, vol. 7:9-24 (1994). |
Trinh, Ryan et al., “Optimization of codon pair use within the (GGGGS)3 linker sequence results in enhanced protein expression,” Molecular Immunology, vol. 40:717-722 (2004). |
Verheul, H.M.W. et al., “Targeting Vascular Endothelial Growth Factor Blockade: Ascites and Pleural Effusion Formation,” The Oncologist, vol. 5(Suppl. 1):45-50 (2000). |
Vuento, M. et al., “Purification of fibronectin from human plasma by affinity chromatography under non-denaturing conditions,” Biochem. J., vol. 183(2):331-337 (1979). |
Wang, Cheng-I et al., “Isolation of a High Affinity Inhibitor of Urokinase-type Plasminogen Activator by Phage Display of Ecotin,” The Journal of Biological Chemistry, vol. 270(20):12250-12256 (1995). |
Watanabe et al., “Anti-Vascular Endothelial Growth Factor Receptor-2 (Flk-1/KDR) Antibody Suppresses Contact Hypersensitivity,” Exp. Dermatol., vol. 13(11):671-681 (2004). |
Watanabe, Takeshi et al., “Gene Cloning of Chitinase A1 from Bacillus circulans WL-12 Revealed Its Evolutionary Relationship to Serratia Chitinase and to the Type III Homology Units of Fibronectin,” The Journal of Biological Chemistry, vol. 265:15659-15665 (1990). |
Wells, James A. et al., “Additivity of Mutational Effects in Proteins,” Biochemistry, vol. 29:8509-8517 (1990). |
Williams, Alan F. et al., “The Immunoglobulin Superfamily-Domains for Cell Surface Recognition,” Ann. Rev. Immunol., vol. 6:381-405 (1988). |
Williams, Michael J. et al., “Solution of Molecular Proteins by Nuclear Magnetic Resonance,” Methods in Enzymology, vol. 245:451-469 (1994). |
Wilson, David S. et al., “The use of mRNA display to select high-affinity protein-binding peptides,” PNAS, vol. 98(7):3750-3755 (2001). |
Xu, Lihui et al., “Directed Evolution of High-Affinity Antibody Mimics Using mRNA Display,” Chemistry & Biology, vol. 9:933-942 (2002). |
Yang, Karen et al., “Tailoring structure-function and pharmacokinetic properties of single-chain Fv proteins by site-specific PEGylation,” Protein Engineering, vol. 16(10):761-770(2003). |
Yoshiji, H. et al., “Vascular endothelial growth factor and receptor interaction is a prerequisite for murine hepatic fibrogenesis,” Gut, vol. 52:1347-1354 (2003). |
Zdanov, Alexander et al., “Structure of a single-chain antibody variable domain (Fv) fragment complexed with a carbohydrate antigen at 1.7-A resolution,” Proc. Natl. Acad. Sci. USA, vol. 91:6423-6427 (1994). |
Zhou, Tianhong et al., “Development of a multiple-drug delivery implant for intraocular management of proliferative vitreoretinopathy,” Journal of Controlled Release, vol. 55:281-295 (1998). |
Zhu, Z. et al., “Inhibition of human leukemia in an animal model with human antibodies directed against vascular endothelial growth factor receptor 2. Correlation between antibody affinity and biological activity,” Leukemia, vol. 17:604-611 (2003). |
U.S. Appl. No. 11/448,171, filed Jun. 5, 2006, Yan Chen. |
U.S. Appl. No. 11/482,641, filed Jul. 7, 2006, Yan Chen. |
U.S. Appl. No. 12/788/240, filed May 26, 2010, Yan Chen. |
U.S. Appl. No. 13/552,398, filed Jul. 18, 2012, Yan Chen. |
U.S. Appl. No. 14/071,069, filed Nov. 4, 2013, Yan Chen. |
U.S. Appl. No. 15/070,572, filed Mar. 15, 2016, Yan Chen. |
U.S. Appl. No. 09/515,260, filed Feb. 29, 2000, Dasa Lipovsek. |
U.S. Appl. No. 10/728,078, filed Dec. 3, 2003, Dasa Lipovsek. |
U.S. Appl. No. 11/483,918, filed Jul. 7, 2006, Dasa Lipovsek. |
U.S. Appl. No. 11/543,316, filed Oct. 3, 2006, Dasa Lipovsek. |
U.S. Appl. No. 11/890,627, filed Aug. 6, 2007, Dasa Lipovsek. |
U.S. Appl. No. 15/583,561, filed May 1, 2017, Dasa Lipovsek. |
U.S. Appl. No. 15/440,730, filed Feb. 23, 2017, Dasa Lipovsek. |
U.S. Appl. No. 12/312,725, filed Jan. 20, 2010, Ray Camphausen. |
U.S. Appl. No. 13/892,418, filed May 13, 2013, Ray Camphausen. |
U.S. Appl. No. 14/659,028, filed Mar. 16, 2015, Ray Camphausen. |
U.S. Appl. No. 15/404,749, filed Jan. 12, 2017, Ray Camphausen. |
U.S. Appl. No. 12/867,406, filed Oct. 29, 2010, Ray Camphausen. |
U.S. Appl. No. 13/956,952, filed Aug. 1, 2013, Ray Camphausen. |
U.S. Appl. No. 14/954,596, filed Nov. 30, 2015, Ray Camphausen. |
U.S. Appl. No. 15/886,118, filed Feb. 1, 2018, Ray Camphausen. |
U.S. Appl. No. 12/470,989, filed May 22, 2009, Ray Camphausen. |
U.S. Appl. No. 13/533,382, filed Jun. 26, 2012, Ray Camphausen. |
U.S. Appl. No. 14/229,415, filed Mar. 28, 2014, Ray Camphausen. |
U.S. Appl. No. 15/866,919, filed Jan. 10, 2018, Ray Camphausen. |
U.S. Appl. No. 12/625,217, filed Nov. 24, 2009, Stuart Emanuel. |
U.S. Appl. No. 13/692,555, filed Dec. 3, 2012, Stuart Emanuel. |
U.S. Appl. No. 14/664,290, filed Mar. 20, 2015, Stuart Emanuel. |
U.S. Appl. No. 15/684,595, filed Aug. 23, 2017, Stuart Emanuel. |
U.S. Appl. No. 13/098,851, filed May 2, 2011, Michael L. Gosselin. |
U.S. Appl. No. 14/552,823, filed Nov. 25, 2014, Michael L. Gosselin. |
U.S. Appl. No. 15/363,724, filed Nov. 29, 2016, Michael L. Gosselin. |
U.S. Appl. No. 13/699,458, filed Mar. 28, 2013, Ray Camphausen. |
U.S. Appl. No. 15/385,222, filed Dec. 20, 2016, Ray Camphausen. |
U.S. Appl. No. 09/515,260, Dec. 18, 2003, Maury A. Audet. |
U.S. Appl. No. 09/515,260, Mar. 11, 2003, Maury A. Audet. |
U.S. Appl. No. 09/515,260, Jun. 18, 2002, Holly G. Schnizer. |
U.S. Appl. No. 09/515,260, Sep. 7, 2001, Holly G. Schnizer. |
U.S. Appl. No. 09/515,260, Jun. 1, 2001, Holly G. Schnizer. |
U.S. Appl. No. 10/728,078, Mar. 10, 2006, Maury A. Audet. |
U.S. Appl. No. 10/728,078, Jul. 1, 2005, Maury A. Audet. |
U.S. Appl. No. 10/728,078, Feb. 9, 2005, Maury A. Audet. |
U.S. Appl. No. 11/483,918, Dec. 29, 2009, Maury A. Audet. |
U.S. Appl. No. 11/483,918, Jun. 12, 2009, Maury A. Audet. |
U.S. Appl. No. 11/483,918, Dec. 15, 2008, Maury A. Audet. |
U.S. Appl. No. 11/483,918, Mar. 24, 2008, Maury A. Audet. |
U.S. Appl. No. 11/483,918, Sep. 10, 2007, Maury A. Audet. |
U.S. Appl. No. 11/483,918, Apr. 11, 2007, Maury A. Audet. |
U.S. Appl. No. 11/543,316, Nov. 16, 2016, Maury A. Audet. |
U.S. Appl. No. 11/543,316, Feb. 12, 2016, Maury A. Audet. |
U.S. Appl. No. 11/543,316, Jul. 10, 2015, Maury A. Audet. |
U.S. Appl. No. 11/543,316, Apr. 20, 2011, Maury A. Audet. |
U.S. Appl. No. 11/543,316, Aug. 4, 2010, Maury A. Audet. |
U.S. Appl. No. 11/543,316, Nov. 12, 2009, Maury A. Audet. |
U.S. Appl. No. 11/543,316, Apr. 3, 2009, Maury A. Audet. |
U.S. Appl. No. 11/890,627, Nov. 16, 2009, Maury A. Audet. |
U.S. Appl. No. 11/890,627, Apr. 2, 2009, Maury A. Audet. |
U.S. Appl. No. 11/448,171, Feb. 26, 2010, Zachary C. Howard. |
U.S. Appl. No. 11/448,171, Sep. 25, 2009, Zachary C. Howard. |
U.S. Appl. No. 11/448,171, Feb. 2, 2009, Zachary C. Howard. |
U.S. Appl. No. 11/448,171, Jun. 12, 2008, Zachary C. Howard. |
U.S. Appl. No. 11/482,641, Jan. 28, 2010, Zachary C. Howard. |
U.S. Appl. No. 11/482,641, Jun. 8, 2009, Zachary C. Howard. |
U.S. Appl. No. 11/482,641, Oct. 28, 2008, Zachary C. Howard. |
U.S. Appl. No. 11/482,641, Mar. 27, 2008, Zachary C. Howard. |
U.S. Appl. No. 11/482,641, Nov. 28, 2007, Zachary C. Howard. |
U.S. Appl. No. 12/788,240, Apr. 4, 2012, Zachary C. Howard. |
U.S. Appl. No. 12/788,240, Oct. 27, 2011, Zachary C. Howard. |
U.S. Appl. No. 12/788,240, Aug. 2, 2011, Zachary C. Howard. |
U.S. Appl. No. 13/552,398, Aug. 5, 2013, Zachary C. Howard. |
U.S. Appl. No. 13/552,398, Mar. 15, 2013, Zachary C. Howard. |
U.S. Appl. No. 13/552,398, Nov. 21, 2012, Zachary C. Howard. |
U.S. Appl. No. 13/552,398, Sep. 21, 2012, Zachary C. Howard. |
U.S. Appl. No. 14/071,069, Jul. 30, 2015, Zachary C. Howard. |
U.S. Appl. No. 14/071,069, Apr. 16, 2015, Zachary C. Howard. |
U.S. Appl. No. 14/071,069, Dec. 12, 2014, Zachary C. Howard. |
U.S. Appl. No. 14/071,069, Sep. 18, 2014, Zachary C. Howard. |
U.S. Appl. No. 12/312,725, Feb. 13, 2013, Bridget E. Bunner. |
U.S. Appl. No. 12/312,725, Sep. 27, 2012, Bridget E. Bunner. |
U.S. Appl. No. 12/312,725, Apr. 19, 2012, Bridget E. Bunner. |
U.S. Appl. No. 12/312,725, Feb. 3, 2012, Bridget E. Bunner. |
U.S. Appl. No. 13/892,418, Dec. 15, 2014, Bridget E. Bunner. |
U.S. Appl. No. 13/892,418, Sep. 24, 2014, Bridget E. Bunner. |
U.S. Appl. No. 12/867,406, May 3, 2013, Bridget E. Bunner. |
U.S. Appl. No. 12/867,406, Nov. 6, 2012, Bridget E. Bunner. |
U.S. Appl. No. 12/867,406, Aug. 24, 2012, Bridget E. Bunner. |
U.S. Appl. No. 13/956,952, Mar. 18, 1015, Bridget E. Bunner. |
U.S. Appl. No. 13/956,952, Jan. 2, 2015, Bridget E. Bunner. |
U.S. Appl. No. 12/470,989, Mar. 16, 2012, Bridget E. Bunner. |
U.S. Appl. No. 12/470,989, Sep. 1, 2011, Bridget E. Bunner. |
U.S. Appl. No. 12/470,989, Mar. 18, 2011, Bridget E. Bunner. |
U.S. Appl. No. 13/533,382, Jan. 2, 2014, Bridget E. Bunner. |
U.S. Appl. No. 13/533,382, May 24, 2013, Bridget E. Bunner. |
U.S. Appl. No. 13/533,382, Dec. 10, 2012, Bridget E. Bunner. |
U.S. Appl. No. 13/625,217, Aug. 22, 2012, Bridget E. Bunner. |
U.S. Appl. No. 12/625,217, Apr. 2, 2012, Bridget E. Bunner. |
U.S. Appl. No. 12/625,217, Jan. 19, 2012, Bridget E. Bunner. |
U.S. Appl. No. 13/692,555, Dec. 23, 2014, Bridget E. Bunner. |
U.S. Appl. No. 13/692,555, Jul. 25, 2014, Bridget E. Bunner. |
U.S. Appl. No. 13/692,555, Mar. 3, 2014, Bridget E. Bunner. |
U.S. Appl. No. 13/098,851, Aug. 27, 2014, Anand U. Desai. |
U.S. Appl. No. 13/098,851, May 20, 2014, Anand U. Desai. |
U.S. Appl. No. 13/098,851, Dec. 4, 2013, Anand U. Desai. |
U.S. Appl. No. 13/098,851, Mar. 18, 2013, Anand U. Desai. |
U.S. Appl. No. 13/699,458, Sep. 29, 2016, Bridget E. Bunner. |
U.S. Appl. No. 13/699,458, Apr. 13, 2016, Bridget E. Bunner. |
U.S. Appl. No. 13/699,458, Oct. 27, 2015, Bridget E. Bunner. |
U.S. Appl. No. 13/699,458, Jul. 13, 2015, Bridget E. Bunner. |
U.S. Appl. No. 13/699,458, Feb. 12, 2015, Bridget E. Bunner. |
U.S. Appl. No. 13/699,458, Nov. 7, 2014, Bridget E. Bunner. |
U.S. Appl. No. 14/229,415, Oct. 11, 2017, Bridget E. Bunner. |
U.S. Appl. No. 14/229,415, Jun. 16, 2017, Bridget E. Bunner. |
U.S. Appl. No. 14/229,415, Jan. 9, 2017, Bridget E. Bunner. |
U.S. Appl. No. 14/229,415, Aug. 1, 2016, Bridget E. Bunner. |
U.S. Appl. No. 14/229,415, Feb. 9, 2016, Bridget E. Bunner. |
U.S. Appl. No. 14/481,641, Jul. 1, 2016, Zachary J. Miknis. |
U.S. Appl. No. 14/481,641, Nov. 20, 2015, Zachary J. Miknis. |
U.S. Appl. No. 14/552,823, Aug. 31, 2016, Anand U. Desai. |
U.S. Appl. No. 14/552,823, Mar. 24, 2016, Anand U. Desai. |
U.S. Appl. No. 14/659,028, Oct. 12, 2016, Bridget E. Bunner. |
U.S. Appl. No. 14/659,028, Jul. 1, 2016, Bridget E. Bunner. |
U.S. Appl. No. 15/404,749, Dec. 1, 2017, Bridget E. Bunner. |
U.S. Appl. No. 14/664,290, May 23, 2017, Bridget E. Bunner. |
U.S. Appl. No. 14/664,290, Jan. 13, 2017, Bridget E. Bunner. |
U.S. Appl. No. 14/664,290, Sep. 20, 2016, Bridget E. Bunner. |
U.S. Appl. No. 15/684,595, Nov. 24, 2017, Bridget E. Bunner. |
U.S. Appl. No. 14/954,596, Nov. 2, 2017, Bridget E. Bunner. |
U.S. Appl. No. 14/954,596, Jul. 27, 2017, Bridget E. Bunner. |
U.S. Appl. No. 15/070,572, Aug. 31, 2017, Zachary C. Howard. |
U.S. Appl. No. 15/070,572, May 22, 2017, Zachary C. Howard. |
U.S. Appl. No. 15/070,572, Nov. 9, 2016, Zachary C. Howard. |
U.S. Appl. No. 15/070,572, Jul. 21, 2016, Zachary C. Howard. |
U.S. Appl. No. 15/385,222, Dec. 27, 2017, Bridget E. Bunner. |
U.S. Appl. No. 16/244,851, filed Jan. 10, 2019, Ray Camphausen. |
U.S. Appl. No. 16/206,551, filed Nov. 30, 2018, Stuart Emanuel. |
U.S. Appl. No. 16/244,921, filed Jan. 10, 2019, Michael L. Gosselin. |
U.S. Appl. No. 16/298,493, filed Mar. 11, 2019, Ray Camphausen. |
U.S. Appl. No. 15/385,222, Dec. 10, 2018, B. Bunner. |
U.S. Appl. No. 15/385,222, Apr. 30, 2018, B. Bunner. |
U.S. Appl. No. 15/404,749, Oct. 11, 2018, B. Bunner. |
U.S. Appl. No. 15/404,749, Apr. 2, 2018, B. Bunner. |
U.S. Appl. No. 15/866,919, Jun. 2, 2020, B. Bunner. |
U.S. Appl. No. 15/866,919, Jan. 19, 2020, B. Bunner. |
U.S. Appl. No. 15/866,919, Jun. 24, 2019, B. Bunner. |
U.S. Appl. No. 15/886,118, Feb. 12, 2020, B. Bunner. |
U.S. Appl. No. 15/886,118, May 30, 2019, B. Bunner. |
U.S. Appl. No. 15/886,118, Sep. 17, 2019, B. Bunner. |
U.S. Appl. No. 15/886,118, May 20, 2019, B. Bunner. |
U.S. Appl. No. 16/206,551, May 15, 2020, B. Bunner. |
U.S. Appl. No. 16/244,851, Mar. 19, 2020, B. Bunner. |
U.S. Appl. No. 16/244,921, Apr. 15, 2020, A. Desai. |
U.S. Appl. No. 16/298,493, Apr. 15, 2020, B. Bunner. |
Number | Date | Country | |
---|---|---|---|
20180162926 A1 | Jun 2018 | US |
Number | Date | Country | |
---|---|---|---|
60527886 | Dec 2003 | US |
Number | Date | Country | |
---|---|---|---|
Parent | 15070572 | Mar 2016 | US |
Child | 15826196 | US | |
Parent | 14071069 | Nov 2013 | US |
Child | 15070572 | US | |
Parent | 13552398 | Jul 2012 | US |
Child | 14071069 | US | |
Parent | 12788240 | May 2010 | US |
Child | 13552398 | US | |
Parent | 11448171 | Jun 2006 | US |
Child | 12788240 | US | |
Parent | PCT/US2004/040885 | Dec 2004 | US |
Child | 11448171 | US |