The present invention relates to the field of cancer immunotherapy, particularly to oncolytic virotherapy. More specifically, the invention relates to a recombinant Modified Vaccinia Virus Ankara (MVA) expressing a tumor associated antigen (TAA) and the costimulatory molecule 4-1BBL for use in the treatment, prevention and/or prevention of recurrence of tumors and metastases, wherein the recombinant MVA is intratumorally administered to a solid tumor. The invention also relates to respective methods of treatment.
Human cancers are extraordinary heterogenous in terms of tumor antigen expression and immune infiltration and composition. A common feature, however, is the host inability to mount potent immune responses that prevent tumor growth effectively. Often, naturally primed CD8+ T cells against solid tumors lack adequate stimulation and efficient penetration of tumor tissue due to the hostile tumor microenvironment.
The lack of potent immune responses against solid tumors due to the poor capacity of immune cells to infiltrate or perform effector functions in the hostile tumor microenvironment (TME) is a major challenge for cancer immunotherapy [1]. The concept of reprogramming the immunosuppressive TME into an inflammatory one by tumor-directed therapy has attracted much attention in recent years [2]. The aim is to activate immune cells that have already homed to the tumor and local lymph nodes or recruit new immune cells to the TME, while minimizing irrelevant activation of the rest of the immune system [3]. To achieve this, several strategies are being explored in preclinical models as well as in the clinic, either employing the local release and activation of biochemical signals derived from pathogen recognition and unprogrammed cell destruction or local administration of immunostimulatory monoclonal antibodies and cytokines [2].
Local oncolytic virotherapy relies on the concept of tumor-targeted therapy through specific infection and destruction of tumor cells and modulation of the TME. The recent Food and Drug Administration (FDA) approval of the first-in-class oncolytic agent IMLYGIC, a modified herpes simplex virus 1 encoding human GM-CSF, for stage III melanoma patients [4], emphasized the great potential of oncolytic viruses (OV). There is a wide spectrum of viral families that have been investigated for their oncolytic effects, including herpesvirus, poxvirus and adenovirus, among others [5].
While historically tumor cell-specific replication and direct killing activity of OVs viruses were considered the primary mode of action, initiation or augmentation of a host anti-tumor immune response is now known to be essential for oncolytic virotherapy [6]. Hence, local virotherapy can be regarded as an in situ vaccine that leads to the release of damage- or pathogen-associated molecular patterns and immunogenic cell death accompanied by tumor antigen release which ultimately results in the initiation of innate and adaptive anti-tumor immune responses [7].
A salient feature of most OVs is their tumor specificity and their capacity to spread through tumor tissue by viral replication and concomitant tumor cell lysis [8]. Despite their engineered tissue tropism for tumor cells, the use of replication-competent viruses in patients still raises safety concerns. MVA-BN is a highly attenuated vaccinia strain approved by the FDA (JYNNEOS®) as a non-replicating vaccine against smallpox and monkeypox [9]. In addition, a recombinant MVA-BN vaccine vector has recently been approved by European Medicines Agency (EMA) as part of an Ebola vaccine and others are employed in clinical trials against various infectious agents [10]. MVA is a potent inducer of Type I interferons (IFN) [11, 12, 13] and elicits robust humoral and cellular immune responses against vector-encoded heterologous antigens [14, 16]. Importantly, MVA cannot replicate in human cells as its replication ability is restricted to embryonic avian cells [15]. Thus, the excellent safety profile and immune stimulatory properties of MVA make it a prime candidate for therapeutic interventions.
MVA can accommodate large transgene inserts facilitating the incorporation of heterologous antigens and immune stimulatory molecules to elicit antigen-specific T cell responses and enhance certain immune-activating pathways. CD40L-adjuvanted MVA drastically augmented innate and adaptive immune responses upon IV injection [16, 17]. Furthermore, OVs genetically altered with co-stimulatory molecules or inflammatory cytokines increased therapeutic efficacy after intratumoral (IT) therapy [18]. Hence, IT treatment with MVA encoding a tumor associated antigen (TAA) together with a co-stimulatory molecule might enhance anti-tumor immune responses in the TME.
The tumor necrosis factor receptor (TNFR)-family member 4-1BB or CD137 is defined as a bona fide co-stimulatory molecule in T cells. 4-1BB is transiently induced upon TCR stimulation and subsequent engagement of this co-stimulatory receptor leads to elevated levels of cytokine secretion as well as the upregulation of the antiapoptotic molecules Bcl-2 and Bcl-xl. This results in increased proliferation and protection against activation-induced T cell death which is also critical for the formation of immunological memory [19, 20]. 4-1BB expression in tumor infiltrating T cells (TIL) [21], coupled with its capacity to promote survival, expansion, and enhanced effector function of activated T cells, has made it an alluring target for cancer immunotherapy. Indeed, stimulation of the co-stimulatory pathway 4-1BB/4-1BBL is beneficial in many therapeutic cancer settings including mono- or combination-therapies with agonistic 4-1BB antibodies or 4-1BBL-expressing viral vectors [22]. 4-1BB co-stimulation is also central for third-generation Chimeric Antigen Receptor (CAR) T cell therapy, as its endodomain is incorporated into the tumor binding chimeric receptor to enhance signaling and consequently tumor cell killing [23].
Nevertheless, despite the notable progress achieved so far, there is still a need in further medical uses of oncolytic virotherapy.
It is an object of the present invention to provide further medical uses of local, i.e. tumor directed virotherapy using oncolytic viruses.
Briefly, the object of the present invention is solved by a recombinant MVA expressing a TAA and the costimulatory molecule 4-1BBL for use in
In particular, the invention is defined by the appended claims and by the following aspects and their embodiments.
In one aspect, the invention provides a recombinant MVA comprising:
for use in the treatment and prevention of recurrence of a solid tumor in a subject, wherein the recombinant MVA is locally, preferably intratumorally, administered to the solid tumor.
In a further aspect, the invention provides a recombinant MVA comprising:
for use in the prevention of recurrence of a solid tumor in or after its remission in a subject, wherein the remission is induced by or follows local, preferably intratumoral, administration of the recombinant MVA to the solid tumor.
In another aspect, the invention provides a recombinant MVA comprising:
for use in the treatment, prevention and/or prevention of recurrence of a secondary tumor in a subject, wherein the recombinant MVA is locally, preferably intratumorally, administered to a related primary solid tumor, but is not administered to the secondary tumor; or
for use in the treatment and/or prevention of recurrence of a primary solid tumor in a subject, wherein the recombinant MVA is locally, preferably intratumorally, administered to a related secondary solid tumor, but is not administered to the primary solid tumor; or
for use in the treatment, prevention and/or prevention of recurrence of a secondary tumor in a subject, wherein the recombinant MVA is locally, preferably intratumorally, administered to another related secondary solid tumor, but is not administered to the first mentioned secondary tumor.
In yet another aspect, the invention provides a recombinant MVA comprising:
for use in the treatment, prevention and/or prevention of recurrence of a tumor in a subject, which tumor is in not dissectible or not accessible by surgery, wherein the recombinant MVA is locally, preferably intratumorally, administered to another related solid tumor, but is not locally, preferably intratumorally, administered to the first mentioned tumor.
In yet another aspect, the invention provides a recombinant MVA comprising:
for use in the induction of a systemic anti-tumor immune response in a subject, wherein the recombinant MVA is locally, preferably intratumorally, administered to a solid tumor.
In yet another aspect, the invention provides a recombinant MVA comprising:
for use in a systemic anti-tumor therapy, wherein the recombinant MVA is locally, preferably intratumorally, administered to a solid tumor.
In yet another aspect, the invention provides a recombinant MVA comprising:
for use in a neoadjuvant anti-tumor therapy, wherein the recombinant MVA is locally, preferably intratumorally, administered to a solid tumor.
In yet another aspect, the invention provides a recombinant MVA comprising:
for use in the induction of an anti-tumor immunological memory in a subject, wherein the recombinant MVA is locally, preferably intratumorally, administered to a solid tumor.
In yet another aspect, the invention provides a recombinant MVA comprising:
for use in the treatment of a plurality of tumors in a subject, wherein the recombinant MVA is locally, preferably intratumorally, administered to at least one, but not all, of said plurality of tumors.
The invention also provides methods of treatment for a patient having a plurality of tumors comprising locally (preferably intratumorally) administering a recombinant MVA to at least one, but not all, of said plurality of tumors, wherein the recombinant MVA comprises a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding a 4-1-BB ligand (4-1-BBL).
These aspects and their embodiments will be described in further detail in connection with the description of invention.
C57BL/6 (
(
(
(
(
Naïve C57BL/6 mice or long-term survivors of
Infection with MVA, MVA-TAA or MVA-TAA-4-1BBL enhanced B16.OVA and CT26.WT tumor cell death in vitro (
In this study we combined the immune-stimulatory properties of TAA-encoding MVA with the exquisite T cell enhancing potential of 4-1BBL and evaluated therapeutic efficacy against solid tumors. We found that IT injection of MVA-TAA-4-1BBL exerted strong objective therapeutic responses in various unrelated tumor models. The therapy was due to strongly re-activated tumor-specific CD8+ T cells and the favorable induction of multiple proinflammatory chemokines and cytokines in the TME. Furthermore, IT MVA-TAA-4-1BBL injection induced systemic anti-tumor immune responses inhibiting growth of tumor deposits at distant sites. Importantly, IT MVA-TAA-4-1BBL triggered the generation of a diversified tumor-specific memory response that protected against local and metastatic recurrence.
We cloned tumor associated antigens (TAA) and the immune-stimulatory adjuvant 4-1BBL into the genome of modified vaccinia Ankara (MVA) for intratumoral virotherapy. Local treatment with MVA-TAA-4-1BBL resulted in control of established tumors. Upon intratumoral injection, MVA localized mainly to the tumor with minimal leakage to the tumor draining lymph node. In situ infection by MVA-TAA-4-1BBL triggered profound changes in the tumor microenvironment including the induction of multiple proinflammatory molecules and immunogenic cell death. This led to the reactivation and expansion of antigen-experienced, cytokine producing tumor-specific cytotoxic T cells. Strikingly, we report the induction of a systemic anti-tumor immune response by local MVA-TAA-4-1BBL treatment that controlled tumor growth at distant, untreated lesions and conferred protection against local and systemic tumor rechallenge. In all cases 4-1BBL adjuvanted MVA was superior to MVA. Hence, intratumoral 4-1BBL-adjuvanted MVA immunotherapy induced expansion of potent tumor-specific CD8+ T cells as well as favorable proinflammatory changes in the tumor microenvironment leading to elimination of tumors and protective immunological memory.
It must be noted that, as used herein, the singular forms “a”, “an”, and “the”, include plural references unless the context clearly indicates otherwise. Thus, for example, reference to “a nucleic acid sequence” includes one or more nucleic acid sequences.
As used herein, the conjunctive term “and/or” between multiple recited elements is understood as encompassing both individual and combined options. For instance, where two elements are conjoined by “and/or”, a first option refers to the applicability of the first element without the second. A second option refers to the applicability of the second element without the first. A third option refers to the applicability of the first and second elements together. Any one of these options is understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or” as used herein. Concurrent applicability of more than one of the options is also understood to fall within the meaning, and therefore satisfy the requirement of the term “and/or.”
Throughout this specification and the appended claims, unless the context requires otherwise, the word “comprise”, and variations such as “comprises” and “comprising”, will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integer or step. When used in the context of an aspect or embodiment in the description of the present invention the term “comprising” can be amended and thus replaced with the term “containing” or “including” or when used herein with the term “having.” Similarly, any of the aforementioned terms (comprising, containing, including, having), whenever used in the context of an aspect or embodiment in the description of the present invention include, by virtue, the terms “consisting of” or “consisting essentially of,” which each denotes specific legal meaning depending on jurisdiction.
When used herein “consisting of” excludes any element, step, or ingredient not specified in the claim element. When used herein, “consisting essentially of” does not exclude materials or steps that do not materially affect the basic and novel characteristics of the claim.
The term “recombinant MVA” refers to MVA having an exogenous nucleic acid sequence inserted in its genome which is not naturally present in the parent virus. A recombinant MVA thus refers to MVA made by an artificial combination of MVA nucleic acid sequences with a segment of nucleic acid sequences of synthetic or semisynthetic origin which combination does not occur or is differently arranged in nature. The artificial combination is most commonly accomplished by artificial manipulation of isolated segments of nucleic acids, using well-established genetic engineering techniques. Generally, a “recombinant MVA” as described herein refers to MVA that is produced by standard genetic engineering methods, e.g., a recombinant MVA is thus a genetically engineered or a genetically modified MVA. The term “recombinant MVA” thus includes MVA (e.g., MVA-BN) which has integrated at least one recombinant nucleic acid, preferably in the form of a transcriptional unit, in its genome. A transcriptional unit may include a promoter, enhancer, terminator and/or silencer. Recombinant MVA of the present invention is designed to express heterologous antigenic determinants, polypeptides or proteins (antigens) upon induction of the regulatory elements e.g., the promoter.
The term “subject”, as used herein, refers to a recipient of the recombinant MVA, who typically is a mammal, such as a non-primate or a primate (e.g. monkey or human), and preferably is a human. The term includes a human or animal “patient” and a laboratory animal. The terms “subject” and “patient” are used interchangeably.
The term “solid tumor” refers to localizable or settled neoplastic tissue, in contrast to, for example, leukemias or hematological cancers.
The term “primary tumor” refers to an initial or first tumor from which neoplastic cells may spread to other parts of the body and may form new (“secondary”) tumors.
The term “secondary tumor”, as used herein, refers to a tumor formed by neoplastic cells spread from a “primary tumor” or from another “secondary tumor”. Particularly, the term includes a “metastasis”.
The term “metastasis” refers to a tumor deposit deriving from a cancerous primary or secondary tumor.
The wording “related”, as used herein, means that two tumors are supposed to be responsive to the same recombinant MVA or TAA. They are, for example, of the same tumor type.
The term “spatially distant”, as used herein, relates to tumors that are clearly discernible as individual tumors, for example by optical means, and spaced from another.
The term “local” administration includes, e.g., intratumoral or topical administration to a solid tumor. Thus, local means on site. The administration can be achieved, for example, by local or topical application or by intratumoral injection of the recombinant MVA. In some embodiments, for example, in a tumor that is close to the skin or is a tumor of skin cells such as melanoma, local administration can be achieved by subcutaneous injection in the immediate vicinity of the tumor. In contrast, terms like “distant” or “systemic” mean not on site.
The term “systemic”, as used herein, means the opposite of “local”. Thus, systemic may mean that an effect is locally unrestricted, i.e. rather relates to the entire body.
The term “tumor directed virotherapy”, as used herein, means a local virotherapy in contrast to systemic tumor virotherapy.
The term “systemic anti-tumor therapy”, as used herein, means that the recombinant MVA is administered locally to a solid tumor, but the anti-tumoral activity extends to other tumors not locally treated.
The term “systemic anti-tumor immune response”, as used herein, refers to an anti-tumor immune response potentially occurring anywhere in the body.
The term “recurrence”, as used herein, refers to a relapse or return of a tumor.
The term “prevention of recurrence”, as used herein, means that a relapse of a remitted tumor, i.e. a tumor in or after remission, for example an eradicated tumor, is prevented or inhibited. At least, the tumor's full recurrence is inhibited, for example at least at 50%.
The term “prevention”, in contrast, means that the first appearance of a tumor is prevented.
The term “remission”, as used herein, relates to a tumor which, for example, is decreased or eradicated. More generally, “remission” is the reduction or disappearance of the signs and symptoms of a disease such as a tumor. The remission may be considered a partial remission or a complete or full remission. For example, a partial remission of a tumor may be defined as a 50% or greater reduction in the measurable parameters of tumor growth as may be found on physical examination, radiologic study, or by biomarker levels from a blood or urine test. A complete remission, on the other hand, is a total disappearance of the tumor, notwithstanding the possibility of a relapse.
The term “neoadjuvant therapy” refers to a treatment prior to the main therapy. Here, a neoadjuvant therapy using the recombinant MVA aims to reduce the size or extent of a tumor before, e.g., surgical excision.
In one embodiment, the recombinant MVA is a non-replicating or replication deficient MVA. Preferably, the recombinant MVA is not capable of reproductive replication in human cell lines.
In one embodiment, the recombinant MVA is derived from MVA-BN as deposited at the European Collection of Cell Cultures (ECACC) under number V00083008, or from an MVA-BN derivative.
In one embodiment, the recombinant MVA comprises:
In one embodiment, the first nucleic acid encoding a TAA and the at least one further nucleic acid encoding a TAA are the same or different.
In one embodiment the recombinant MVA comprises two, three, four, five, six, or more nucleic acids each encoding a different TAA.
In one embodiment, the TAA is a neoantigen or an endogenous self-antigen.
In one embodiment, the TAA is a transposable element (TE).
In one embodiment, the TAA is an endogenous retroviral protein (HERV).
In one embodiment, the TAA is a long interspersed nuclear element (LINE).
In one embodiment, the TAA is a short interspersed nuclear element (SINE).
In one embodiment, the TAA is selected from the group consisting of an endogenous retroviral (ERV) protein, an endogenous retroviral (ERV) peptide, carcinoembryonic antigen (CEA), mucin 1 cell surface associated (MUC-1), prostatic acid phosphatase (PAP), prostate specific antigen (PSA), human epidermal growth factor receptor 2 (HER-2), survivin, tyrosine related protein 1 (TRP1), tyrosine related protein 1 (TRP2), Brachyury, folate receptor alpha (FOLR1), preferentially expressed antigen of melanoma (PRAME), and the endogenous retroviral peptide MEL; and combinations thereof. Any TAA is suitable for use in the compositions and/or methods of the invention so long as it is an antigen associated with a known tumor or a tumor in the patient to be treated and is capable, when expressed, of giving rise to or stimulating an immune response.
In one embodiment, the ERV protein is from the human endogenous retroviral K (HERV-K) family, preferably is selected from a HERV-K envelope (HERV-K-env) protein and a HERV-K gag protein.
In one embodiment, the ERV peptide is from the human endogenous retroviral K (HERV-K) family, preferably is selected from a pseudogene of a HERV-K envelope protein (HERV-K-env/MEL).
In one embodiment, the recombinant MVA comprises:
In one embodiment, the nucleic acid in (i) encodes a HERV-K-env/MEL comprising a HERV-K env surface (SU) unit and a HERV-K transmembrane (TM) unit, wherein the HERV-K TM unit is mutated, preferably wherein the HERV-K TM unit is mutated such that an immunosuppressive domain is inactivated. Preferably, HERV-K-MEL is inserted within the mutated HERV-K TM unit. More preferably, HERV-K-MEL replaces a portion of the immunosuppressive domain of HERV-K TM.
In one embodiment, the nucleic acid sequence in (i) encodes an amino acid sequence comprising or consisting of an amino acid sequence as depicted in SEQ ID NO: 7.
In one embodiment, the nucleic acid sequence in (i) comprises or consists of a nucleic acid sequence as depicted in SEQ ID NO: 8.
In one embodiment, the nucleic acid in (i) encodes a HERV-K-env/MEL comprising a HERV-K env surface (SU) unit and a HERV-K transmembrane (TM) unit, wherein the HERV-K TM unit is shortened to less than 20 amino acids, preferably less than 10 amino acids, more preferably less than 8 amino acids, most preferably 6 amino acids.
In one embodiment, the nucleic acid in (i) encodes a HERVK-env/MEL comprising a HERV-K-env surface (SU) unit, wherein the RSKR furin cleavage site of the HERV-K-env SU unit is deleted. Preferably, HERV-K-MEL is attached to the C-terminus of the HERV-K-env SU unit.
In one embodiment, the nucleic acid in (i) encodes a HERVK-env/MEL comprising a heterologous membrane anchor, preferably derived from the human PDGF (platelet-derived growth factor) receptor.
In one embodiment, the nucleic acid sequence in (i) encodes an amino acid sequence comprising or consisting of an amino acid sequence as depicted in SEQ ID NO: 11.
In one embodiment, the nucleic acid sequence in (i) comprises or consists of a nucleic acid sequence as depicted in SEQ ID NO: 12.
In one embodiment, the solid tumor, primary solid tumor and/or secondary tumor is a cancerous or malignant tumor.
In one embodiment, the solid tumor, primary solid tumor and/or secondary tumor is a melanoma or a malignant breast, colon or ovarian tumor.
In one embodiment, the secondary tumor is a metastasis.
In one embodiment, the secondary tumor is a solid tumor. Alternatively, the secondary tumor is, for example, an aggregation of tumor cells floating in a bodily fluid such as blood lymph, or is present within a body cavity, e.g. the peritoneal cavity. A primary or secondary tumor to which the recombinant MVA is locally or intratumorally administered, however, is always a solid tumor.
In one embodiment, the tumor to which the recombinant MVA is not locally or intratumorally administered is not dissectible or not accessible by surgery.
In one embodiment, the primary and secondary tumors are spatially distant from each other.
In one embodiment, the secondary tumor and another secondary tumor are spatially distant from each other.
In one embodiment, the primary and secondary tumors are located within the same tissue or organ of a subject's body.
In one embodiment, the secondary tumor and another secondary tumor are located within the same tissue or organ of a subject.
In one embodiment, the primary and secondary tumors are located within different tissues or organs of a subject's body.
In one embodiment, the secondary tumor and another secondary tumor are located within different tissues or organs of a subject's body. In one embodiment, the secondary tumor is naïve, i.e. was not locally, preferably intratumorally, treated with the recombinant MVA before.
In one embodiment, the tumor is in at least partial remission, e.g. in at least more than 50% remission, preferably is in complete remission.
In one embodiment, the recombinant MVA is not administered other than locally, preferably intratumorally. Thus, the recombinant MVA is not administered, e.g., systemically, intravenously, peritoneally, parentally, subcutaneously, or intranasally to the subject.
In one embodiment, the anti-tumor immunological memory is long-term, i.e. lasting for days, weeks, months, years or decades.
The invention provides methods of treatment for a subject having more than one tumor in which fewer than all of the tumors in the subject are treated by local administration of the recombinant MVA. That is, the invention provides methods of treatment for a subject having a plurality of tumors comprising locally administering a recombinant MVA to at least one, but not all, of said plurality of tumors. In some embodiments, the step of locally administering a recombinant MVA comprises intratumoral injection. In this manner, the methods of treatment can be said to produce “treated tumors” or “injected tumors” to which the recombinant MVA has been locally or intratumorally administered or injected and “untreated tumors” or “uninjected tumors” to which the recombinant MVA was not locally administered or into which the recombinant MVA was not injected. The methods of treatment can also be said to provide a method of treating uninjected tumors in a subject by locally administering or intratumorally injecting at least one other tumor in said subject with the recombinant MVA. In some embodiments of the methods of the invention, the subject is a human patient.
In some embodiments, the methods of treatment comprise treating metastases or recurrences of a first or primary tumor by local administration (in some embodiments, by intratumoral injection) of recombinant MVA into said first or primary tumor. In some embodiments, it is not possible to determine which of a plurality of tumors in a subject was the first to occur (i.e., the “primary tumor”), and the method comprises treating at least one of the plurality of tumors by local administration or intratumoral injection of the MVA. Thus, in some embodiments, by “metastasis” or “secondary tumor” is intended that a tumor is in a different location, or has different borders, than a tumor designated as a “first tumor” or “primary tumor.”
The methods of the invention comprise treating at least one of a plurality of tumors in a subject by local administration or intratumoral injection, or treating at least two tumors, at least three, at least four, or more of said tumors, or treating all but one of said plurality of tumors in a subject. In some embodiments, methods of the invention provide that any number of tumors in the subject may be injected or treated by local administration or intratumoral injection with recombinant MVA so long as fewer than all of the tumors in the subject are so injected or treated.
While the invention is not bound by any particular mechanism or mode of action, any method is suitable in the practice of the invention so long as it stimulates an immune response against at least one TAA or tumor in said subject, or cell thereof, or produces a decrease in the volume or size of at least one secondary or uninjected tumor. By “stimulates an immune response” is intended that indicia of a new or increased immune response can be identified in the subject, such as, for example, an increase in the CD8+ T cell population and/or an increase in the amounts of IFN-gamma, TNF-alpha and/or IL-2 produced by the CD8+ T cells in a subject as illustrated in the working examples herein. In this manner, the invention also provides methods of stimulating an immune response to a TAA comprising the step of intratumorally administering a recombinant MVA of the invention to a subject.
In some embodiments, the recombinant MVA comprises: (a) a first nucleic acid encoding a tumor-associated antigen (TAA); and (b) a second nucleic acid encoding a 4-1BB ligand (4-1BBL). The recombinant MVA may further comprise additional nucleic acids encoding additional TAAs. Methods of the invention are suitable for use with a recombinant MVA encoding both at least one TAA and 4-1-BBL. In some embodiments, the recombinant MVA expresses at least one TAA and 4-1-BBL, which can be demonstrated using techniques known in the art.
Sequences of various TAAs and 4-1-BBL that are useful in the methods and compositions of the invention are known in the art and described, for example, in PCT/EP2019/081942 (published as WO 2020/104531) and European Patent Application No. 19210369.5, all of which are incorporated herein by reference in their entirety. An exemplary 4-1-BBL sequence is set forth in NCBI RefSeq NP_003802.1 (and in the amino acid sequence set forth in SEQ ID NO:3, and/or encoded by the nucleic acid sequence set forth in SEQ ID NO:4). Recombinant MVAs useful in the uses and methods of the invention are also described, for example, in European Patent Application No. 19210369.5, incorporated herein by reference.
In certain embodiments, the nucleic acid sequence encoding 4-1-BBL encodes a 4-1-BBL having at least 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to SEQ ID NO:3. In certain embodiments, the nucleic acid sequence is the sequence set forth in SEQ ID NO:4, or encodes a 4-1-BBL having the amino acid sequence set forth in SEQ ID NO:3.
In certain embodiments, the nucleic acid sequence encoding a TAA encodes a TAA having at least 95%, 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to a previously known TAA, such as, for example, a sequence set forth in the sequence listing provided herewith. In certain embodiments, the nucleic acid sequence encodes a TAA having the amino acid sequence set forth in the sequence listing, or a TAA having an amino acid sequence known in the art.
In some embodiments, at least one individual tumor is measured before and after the local administration (e.g., intratumoral injection) of the recombinant MVA to determine whether the tumor continues to grow, or increases or decreases in size, following the administration. In some methods, additional measurements may be taken at intervals following the administration to track the response of at least one individual tumor. Such measurements may be by any suitable technique and can include visual assessment or external measurement as well as X-ray, ultrasound imaging, intravital microscopy, or any other suitable method known in the art. Measurements of tumors used to assess the response of a tumor to treatment and/or the effectiveness of a treatment can, include, for example, at least one diameter of the tumor and/or an estimation of the volume of the tumor.
In some embodiments, a method of treating a subject having one or more tumors comprises the steps of: (a) obtaining a first measurement of a tumor in said subject; (b) administering a recombinant MVA expressing at least one TAA to one or more, but less than all, of the tumors in said subject to produce treated or injected tumors and untreated or non-injected tumors; (c) obtaining a second measurement of at least one of said untreated or non-injected tumors; and (d) comparing said second measurement to a first measurement of said untreated or non-injected tumor, whereby a decrease in said measurement or a lack of increase in said measurement indicates that the tumor has regressed or decreased in volume or that tumor growth has been delayed. In some embodiments, the recombinant MVA used in these methods expresses at least one TAA and 4-1-BBL, as further discussed elsewhere herein.
In some embodiments, a method of treating a subject having a primary tumor and one or more metastases, or the possibility of metastases (i.e., having a malignant tumor), is intended to prevent new or additional metastases and comprises the steps of: (a) identifying in a subject one or more tumors at risk for metastasis; (b) locally administering a recombinant MVA expressing a TAA to at least one but not all of the tumors in said subject (in some embodiments, by intratumoral injection); (c) detecting the tumors in said subject to confirm that no new tumors or metastases are detectable in said subject. In some embodiments, the recombinant MVA used in these methods expresses a TAA and 4-1-BBL, as further discussed elsewhere herein. In some embodiments, the recombinant MVA used in these methods comprises a heterologous nucleic acid encoding a TAA and a heterologous nucleic acid encoding 4-1-BBL, but does not comprise any additional genes encoded by a heterologous nucleic acid that can affect the immune response of the subject, or that are expected to affect the immune response of a subject, when used to treat a subject as a component of an MVA or separately.
In some embodiments, the invention provides a method of treating an inaccessible tumor in a subject with a plurality of tumors, comprising the step of locally administering recombinant MVA into at least one accessible tumor of the plurality of tumors, wherein the recombinant MVA comprises a first nucleic acid encoding a tumor-associated antigen (TAA) and a second nucleic acid encoding a 4-1-BB ligand (4-1-BBL). In some embodiments, the recombinant MVA comprises at least one additional nucleic acid encoding at least one additional TAA, or at least two, three, or four or more additional nucleic acids encoding at least two, three, or four or more additional TAAs. In some embodiments, the step of locally administering the recombinant MVA comprises intratumoral injection.
By “inaccessible tumor” is intended a tumor that is difficult to treat directly by local administration of recombinant MVA such as by intratumoral injection and/or using other techniques. An “inaccessible tumor” or unresectable tumor may be located in a sensitive area of the body, for example, close to or surrounding important nerves or blood vessels, or in the brain, or in another location where surgery and/or local administration of recombinant MVA may pose a risk of damage to the subject and/or would be difficult to administer. The invention provides methods of treating an inaccessible or unresectable tumor in a subject with a plurality of tumors comprising a step of local administration to a different tumor that is more accessible and/or where local administration is less likely to cause damage to the subject. In some embodiments, the invention provides a method of treating an inaccessible tumor in a subject, comprising: (a) identifying at least one inaccessible tumor and at least one accessible tumor in a subject; and (b) locally administering a recombinant MVA expressing a TAA to at least one accessible tumor in said subject. Optionally, this method further comprises a step of monitoring said inaccessible tumor to confirm that growth of the tumor has slowed or stopped, and/or determining whether said subject has an increased immune response or new immune response subsequent to the administration of the recombinant MVA.
In some embodiments, the invention provides a method of treating a subject having a plurality of malignant tumors comprising locally administering a recombinant MVA expressing a TAA to at least one of said tumors to produce a treated tumor, wherein treatment results in reduction of tumor volume of the treated tumor and at least one other tumor that was not directly treated or injected with the recombinant MVA (also referred to as an “untreated tumor” or “uninjected tumor”).
In some embodiments, by “intratumoral injection” is intended that the administration is made into the tumor, or within the boundaries of the tumor. In some embodiments, by “local administration” is intended that the administration is made in close proximity to the tumor. One of skill in the art is aware that such injections may coincidentally also be characterized as another type of administration such as, for example, parenteral or subcutaneous, depending on the location of the tumor.
In the past, MVA was generated by 516 serial passages on chicken embryo fibroblasts of the Ankara strain of vaccinia virus (CVA) (for review see Mayr et al. 1975). This virus was renamed from CVA to MVA at passage 570 to account for its substantially altered properties. MVA was subjected to further passages up to a passage number of over 570. As a consequence of these long-term passages, the genome of the resulting MVA virus had about 31 kilobases of its genomic sequence deleted and, therefore, was described as highly host cell restricted for replication to avian cells (Meyer et al. 1991). It was shown in a variety of animal models that the resulting MVA was significantly avirulent compared to the fully replication competent starting material (Mayr and Danner 1978).
An MVA useful in the practice of the present invention includes MVA-572 (deposited as ECACC V94012707 on 27 Jan. 1994); MVA-575 (deposited as ECACC V00120707 on 7 Dec. 2000), MVA-1721 (referenced in Suter et al. 2009), NIH clone 1 (deposited as ATCC® PTA-5095 on 27 Mar. 2003) and MVA-BN (deposited at the European Collection of Cell Cultures (ECACC) under number V00083008 on 30 Aug. 2000).
More preferably the MVA used in accordance with the present invention includes MVA-BN and MVA-BN derivatives. MVA-BN has been described in WO 02/042480. “MVA-BN derivatives” refer to any virus exhibiting essentially the same replication characteristics as MVA-BN, as described herein, but exhibiting differences in one or more parts of their genomes.
MVA-BN, as well as MVA-BN derivatives, is replication incompetent, meaning a failure to reproductively replicate in vivo and in vitro. More specifically in vitro, MVA-BN or MVA-BN derivatives have been described as being capable of reproductive replication in chicken embryo fibroblasts (CEF), but not capable of reproductive replication in the human keratinocyte cell line HaCat (Boukamp et al 1988), the human bone osteosarcoma cell line 143B (ECACC Deposit No. 91112502), the human embryo kidney cell line 293 (ECACC Deposit No. 85120602), and the human cervix adenocarcinoma cell line HeLa (ATCC Deposit No. CCL-2). Additionally, MVA-BN or MVA-BN derivatives have a virus amplification ratio at least two-fold less, more preferably three-fold less than MVA-575 in Hela cells and HaCaT cell lines. Tests and assay for these properties of MVA-BN and MVA-BN derivatives are described in WO 02/42480 and WO 03/048184.
The term “not capable of reproductive replication” in human cell lines in vitro as described above is, for example, described in WO 02/42480, which also teaches how to obtain MVA having the desired properties as mentioned above. The term applies to a virus that has a virus amplification ratio in vitro at 4 days after infection of less than 1 using the assays described in WO 02/42480 or U.S. Pat. No. 6,761,893.
For the generation of a recombinant MVA as disclosed herein, different methods may be applicable. The DNA sequence to be inserted into the virus can be placed into an E. coli plasmid construct into which DNA homologous to a section of DNA of the poxvirus has been inserted. Separately, the DNA sequence to be inserted can be ligated to a promoter. The promoter-gene linkage can be positioned in the plasmid construct so that the promoter-gene linkage is flanked on both ends by DNA homologous to a DNA sequence flanking a region of poxvirus DNA containing a non-essential locus. The resulting plasmid construct can be amplified by propagation within E. coli bacteria and isolated. The isolated plasmid containing the DNA gene sequence to be inserted can be transfected into a cell culture, e.g., of chicken embryo fibroblasts (CEFs), at the same time the culture is infected with MVA. Recombination between homologous MVA viral DNA in the plasmid and the viral genome, respectively, can generate an MVA modified by the presence of foreign DNA sequences, i.e. nucleotides sequences encoding SARS-CoV-2 antigens.
According to a preferred embodiment, a cell of a suitable cell culture as, e.g., CEF cells, can be infected with a MVA virus. The infected cell can be, subsequently, transfected with a first plasmid vector comprising a foreign or heterologous gene or genes, such as one or more of the nucleic acids provided herein, preferably under the transcriptional control of a poxvirus expression control element. As explained above, the plasmid vector also comprises sequences capable of directing the insertion of the exogenous sequence into a selected part of the MVA viral genome. Optionally, the plasmid vector also contains a cassette comprising a marker and/or selection gene operably linked to a poxvirus promoter. The use of selection or marker cassettes simplifies the identification and isolation of the generated recombinant MVA. However, a recombinant poxvirus can also be identified by PCR technology. Subsequently, a further cell can be infected with the recombinant MVA obtained as described above and transfected with a second vector comprising a second foreign or heterologous gene or genes. In case, this gene shall be introduced into a different insertion site of the poxvirus genome, the second vector also differs in the poxvirus-homologous sequences directing the integration of the second foreign gene or genes into the genome of the poxvirus. After homologous recombination has occurred, the recombinant virus comprising two or more foreign or heterologous genes can be isolated. For introducing additional foreign genes into the recombinant virus, the steps of infection and transfection can be repeated by using the recombinant virus isolated in previous steps for infection and by using a further vector comprising a further foreign gene or genes for transfection. There are ample of other techniques known to generate recombinant MVA.
The practice of the invention will employ, if not otherwise specified, conventional techniques of immunology, molecular biology, microbiology, cell biology, and recombinant technology, which are all within the skill of the art. See e.g. Sambrook, Fritsch and Maniatis, Molecular Cloning: A Laboratory Manual, 2nd edition, 1989; Current Protocols in Molecular Biology, Ausubel F M, et al., eds, 1987; the series Methods in Enzymology (Academic Press, Inc.); PCR2: A Practical Approach, MacPherson M J, Hams B D, Taylor G R, eds, 1995; Antibodies: A Laboratory Manual, Harlow and Lane, eds, 1988.
The following examples serve to further illustrate the disclosure. They should not be understood as limiting the invention the scope of which is determined by the appended claims.
(i) Generation of MVA Recombinants
The generation of MVA recombinants was carried out as described previously [1]. MVA-BN® was developed by Bavarian Nordic and is deposited at the European Collection of Cell Cultures (ECACC) (V00083008). The generation of a recombinant MVA expressing ovalbumin (MVA-OVA) was previously described [1, 2]. The gene encoding for 4-1BBL was synthetized (Geneart, Life Technologies) and cloned into the MVA-OVA genome to generate MVA-OVA-4-1BBL. The gene encoding the mouse leukemia virus derived envelope glycoprotein Gp70 was synthesized (Geneart, Life Technologies) and cloned into the MVA and MVA-4-1BBL genome, respectively, to generate MVA-Gp70 and MVA-Gp70-4-1BBL. All viruses used in animal experiments were purified twice through a sucrose cushion.
(ii) Ethics Statement
Animal experiments were approved by the animal ethics committee of the government of Upper Bavaria (Regierung von Oberbayern, Sachgebiet 54, Tierschutz) and were carried out in accordance with the approved guidelines for animal experiments at Bavarian Nordic GmbH. The bilateral CT26.WT tumor experiment was conducted at CIMA, University of Navarra (Pamplona, Spain) in compliance with the Association for Assessment and Accreditation of Laboratory Animal Care International (AAALAC).
(iii) Mice and Tumor Cell Lines
6- to 8-week-old female C57BL/6J (H-2b) and Balb/cJ (H-2d) mice were purchased from Janvier Labs. All mice were handled, fed, bred and maintained either in the animal facilities at Bavarian Nordic GmbH, at the University of Zurich or at the University of Navarra according to institutional guidelines.
The B16.OVA melanoma cell line was a kind gift of Roman Spörri (University of Zurich). B16.F10 (ATCC® CRL-6475™) and CT26.WT (ATCC® CRL-2638™) cell lines were purchased from American Type Culture Collection (ATCC). Tumor cells were cultured in DMEM Glutamax medium supplemented with 10% FCS, 1% NEAA, 1% sodium pyruvate and 1% penicillin/streptomycin (all reagents from Gibco) in an incubator at 37° C. 5% CO2. All tumor cell lines used in experiments conducted at Bavarian Nordic were regularly tested negative for Mycoplasma by PCR.
(iv) Tumor Cell Injection
Mice were injected subcutaneously in the flank with 5×105 tumor cells. Regarding B16.OVA and B16.F10, prior to injection cells were admixed with 7 mg/ml Matrigel (Trevigen). For subcutaneous bilateral tumor experiments, 5×105 and 1×105 CT26.WT tumor cells were injected in the right flank and the left flank respectively. Tumor re-challenge experiments were performed between 3 and 6 months upon clearance of tumors. Subcutaneous re-challenge was carried out at the opposite flank using 5×105 tumor cells. Intravenous re-challenge was performed injecting 2×105 CT26.WT cells. Tumor diameter was measured at regular intervals using a caliper twice a week.
(v) Immunizations
Intratumoral injections were given into the solid tumor mass with a total volume of 50 μl containing the respective MVA recombinants. Repetitive intratumoral injections were performed at days 0, 5 and 8 after tumor grouping, and indicated in the graphs by vertical dotted lines. When indicated, blood was collected 3 days after last intratumoral immunization for peripheral blood immune cell phenotyping.
(vi) Cell Isolation
When indicated, spleens and lymph nodes were harvested from mice. Spleen and lymph node single-cell suspensions were prepared by mechanically disrupting tissues through a 40-μm cell strainer (Falcon). Spleen samples were subjected to red blood cell lysis (Sigma-Aldrich).
Blood was collected in PBS containing 2% FCS, 0.1% sodium azide and 2.5 U/ml heparin. Peripheral blood mononuclear cells (PBMCs) were prepared by lysing erythrocytes with red blood cell lysis buffer. Mononuclear cells from the abovementioned organs were washed, resuspended in RPMI+2% FCS, counted and kept on ice until further analysis. 100 μl TrueCount counting beads (BD Biosciences) were added to the tumor cell suspensions.
(vii) Peptide Restimulation
When indicated, mononuclear cells were incubated with 2.5 pg/ml of MHC class I restricted peptides [OVA257-264 (SIINFEKL); p15E604-611 (KSPWFTTL); AH16-14 (SPSYVYHQF)] for 5-6 h at 37° C. 5% CO2 in T cell medium and 10 μg/ml BFA. Peptides were purchased from GenScript.
(viii) Flow Cytometry
Mononuclear cell suspensions, BMDMs or tumor cells were stained for 30 minutes at 4° C. in the dark using fixable live/dead viability kits prior to staining (Life Technologies). Mononuclear cells were stained using antibodies from BD Biosciences, eBioscience or Biolegend. When indicated, cell suspensions were stained using a H-2 kb OVA257-264-dextramer (Immudex), a H-2Kb p15E604-611-pentamer (ProImmune) or a H-2Ld AH16-14 pentamer (Prolmmune). For FoxP3 transcription factor and Ki67 staining cells were fixed using FoxP3 Staining Kit (eBioscience). For intracellular cytokine staining, cell suspensions were stained and fixed for intracellular cytokine detection using IC Fixation & Permeabilization Staining kit (eBioscience). All cells were acquired using a digital flow cytometer (LSR II, BD Biosciences) and data were analyzed with FlowJo software version 10.3 (Tree Star).
(ix) Quantitative Real-Time PCR for Quantification of MVA-Specific DNA Genome Copies
Genomic DNA (gDNA) was isolated from tissues using QIAamp DNA Mini Kit according to manufacturer's instructions (Qiagen) and quantified in a NanoVue spectrophotometer (Biochrom). Briefly, a standard curve starting at 5×107 genome copies (gcs) was prepared using a plasmid expressing the open reading frame 082L of MVA, target for detection of MVA backbone DNA. Then, quantitative real-time PCR was performed with TaqMan Gene Expression Master Mix (Thermo-Fisher) using specific primers MVA082L sense 5′-acgtttagccgcctttaatagag-3′, MVA082L antisense 5′-tggtcagaactatcgtcgttgg-3′, and a fluorescein probe 6FAM-aatcccaccgccttctggatctc-BBQ. Calculations were performed by the 7500 software of the Real-time PCR system (Applied Biosystems). The software determines a threshold cycle (CT) for every standard dilution, control and replicate, which is inversely proportional to the logarithm of the quantity of gcs of specific DNA. Based on the standard curve, the software determined the respective number of gcs of the target gene by using the CT value that is measured for each replicate. The quantity (gcs) of a sample is calculated by the average quantity of its duplicate determination.
(x) Statistical Analysis
Statistical analyses were performed as described in the figure legends using GraphPad Prism version 7.02 for Windows (GraphPad Software, La Jolla, Calif.). For immunological data, results are presented as ‘mean’ and ‘standard error of the mean’ (SEM). Either analysis of variance (ANOVA) with multiple comparisons test or one-tailed unpaired Student's t tests were used to determine statistical significance between treatment groups. For tumor-bearing mice survival after treatment, Log rank tests were performed to determine statistical significance between treatment groups.
IT application of poxviruses has been shown to effectively induce anti-tumor responses in various tumor models [24-28]. However, most of these studies have been conducted with replicating viruses. Here, we tested whether local treatment of established tumors using the non-replicating poxvirus MVA encoding a Tumor Associated Antigen (TAA defined above) and the co-stimulatory molecule 4-1BBL would convey potent anti-tumor effects.
IT injections of MVA encoding the TAA ovalbumin (herein referred to as MVA-OVA) controlled tumor growth and prolonged survival of mice bearing established B16.OVA melanomas (
Next, we evaluated other independent, established tumor models. IT administration of MVA encoding the endogenous retroviral antigen Gp70 [29 30] (herein referred to as MVA-Gp70) resulted in anti-tumor effects in B16.F10 melanomas (
Having established that T cells rapidly expanded in the TdLN after IT MVA injection raised the question whether replication-deficient MVA would reside exclusively at the site of injection or transit to other organs. To address this, we determined the presence of MVA-derived genomic DNA (gDNA) in tumor, TdLN, NdLN, spleen and blood 6 hours after IT injection. Importantly, MVA gDNA was detected at high amounts in B16.F10 tumors with minimal appearance in the TdLN (
We demonstrated that after IT application MVA infection is primarily constrained to the tumor and thus virus-induced anti-tumor immune responses most likely originated in the tumor. Therefore, we hypothesized that IT injection of MVA-TAA-4-1BBL might induce changes in the TME. IT injection of B16.OVA tumors either with MVA or MVA-OVA led to an upregulation of the proinflammatory molecules IFNγ and TNFα compared to PBS. This effect was significantly increased by MVA-OVA-4-1BBL (
Replicating viruses induce death of infected tumor cells and immune cells [33-35]. Infection with MVA, MVA-TAA or MVA-TAA-4-1BBL enhanced B16.OVA and CT26.WT tumor cell death in vitro (
Our results suggest that local injection of MVA resulted in IT expression of MVA encoded genes, leading to the induction of inflammation, cell death of infected cells and release of immunogenic mediators in the TME.
The aim of tumor-directed immunotherapy is to generate a systemic anti-tumor immune response that also eradicates distant metastases. As local treatment with MVA-TAA-4-1BBL not only induced robust tumor-specific T cell responses in the TME but also in the blood, we next assessed the systemic anti-tumor potential of IT MVA immunotherapy on distant tumor deposits. CT26.WT tumor cells were implanted subcutaneously to the right and the left flank of Balb/c mice (
One of the main goals of cancer vaccines is to achieve long-term protective immunological memory to prevent tumor recurrence. Therefore, we first assessed whether IT MVA-TAA-4-1BBL-induced anti-tumor responses generate immunological memory that protects against local tumor rechallenge (
OVA-specific CD8+ T cells could be readily detected prior to rechallenge in mice that had rejected the tumor after IT treatment with MVA-OVA-4-1BBL, but not with MVA-OVA (
IT MVA-TAA-4-1BBL injection induced systemic immune responses that mediate control of local recurrent tumors and untreated lesions. We reasoned that the tumor-specific T cell memory generated by IT MVA injection might also protect against metastatic recurrences (
Taken together, local immunotherapy using MVA genetically modified to express a tumor antigen together with the co-stimulatory molecule 4-1BBL conveyed strong anti-tumor activity by combining innate and adaptive immune activation. This not only resulted in the induction of systemic anti-tumor effects but also in the generation of a potent tumor-specific memory response that protected against local and systemic tumor rechallenge.
In the present study, we took a novel approach for tumor-directed virotherapy and used a non-replicating MVA genetically modified to express TAAs and the costimulatory molecule 4-1BBL. This combines the excellent immune-stimulatory properties of MVA [12] and its high safety profile [35] with the immune-activating potential of 4-1BBL [22]. IT MVA-TAA-4-1BBL injection activates a sequence of immediate and long-term immune events, ultimately resulting in tumor eradication. The induction of multiple proinflammatory mediators by IT MVA treatment is indicative of a fundamental alteration of the previously immune-suppressive TME that facilitates the reactivation and expansion of tumor specific T cells. MVA-encoded 4-1BBL triggered drastic qualitative and quantitative changes in cytotoxic anti-tumor immune responses that were essential for both, therapeutic efficacy and formation of local and systemic long-term immunologic memory against the primary tumor.
We show for the first time that IT injection of non-replicating MVA conveys potent therapeutic anti-tumor effects. Interestingly, it has been reported that IT delivery of heat inactivated MVA but not MVA induced strong anti-tumor effects mainly depending on the activation of cytotoxic T cells [25]. In contrast to this study, we utilized active MVA encoding for TAA with and without additionally expressing 4-1BBL. Importantly, MVA-TAA alone was already effective in delaying tumor growth and the adjuvantation with 4-1BBL significantly improved therapeutic efficacy, leading to rejection of established tumors within multiple models. Moreover, the anti-tumor effect was independent of the choice of tumor antigen. Apart from the model antigen OVA, we investigated the endogenous retroviral protein Gp70 for its immunogenic potential as TAA. Endogenous retroviral elements are epigenetically silenced in healthy tissues but re-activated and expressed in various cancers [36]. Likewise, Gp70 is highly expressed in several murine tumor cell lines [37]. In humans, there is growing evidence that these non-coding regions might have potent immunogenic properties and therefore represent excellent TAA targets for cancer immunotherapy [38-40]. Given the self-nature of Gp70 [41], the strong therapeutic effects obtained by IT MVA-Gp70-4-1BBL treatment in Gp70-expressing tumor models implies that local MVA therapy cannot only induce the rejection of tumors expressing neoantigens but also break tolerance to endogenous self-antigens.
IT virotherapy repurposes virus-induced inflammation and cell death to alter the immunosuppressive TME [50]. This cascade of events would enhance antitumor-specific immunity. Likewise, our data show that MVA infection promotes tumor cell death and hence HMGB1 release (
An important aspect of tumor-directed immunotherapy is the generation of a systemic anti-tumor immune response that eradicates distant metastases and induces long-term tumor immunity. We showed that local MVA-TAA-4-1BBL treatment not only elicited immune responses within the TME, but also led to systemic antigen-specific CD8+ T cell responses in the blood. Moreover, across many individual experiments and different TAAs employed, mice that had rejected melanomas upon IT MVA-TAA-4-1BBL treatment developed vitiligo. Vitiligo is caused by autoreactive CD8 T cells that target the hair pigmenting melanocytes in the skin. These cells have been activated by IT MVA-TAA-4-1BBL virotherapy most likely through antigen spread, a phenomenon that describes the diversification of epitope specificity from the initial focused, dominant epitope-specific immune response, e.g. Gp70 or OVA. Tumor antigen spread is a desirable feature of cancer immunotherapy because it broadens the anti-tumor response and prevents the likelihood of tumor escape by TAA loss.
In addition, our data obtained from the bilateral tumor model unambiguously demonstrated that IT MVA-TAA-4-1BBL injection resulted in significant anti-tumor effects in untreated lesions. These results therefore strongly indicate that the anti-tumor response triggered by local MVA-TAA-4-1BBL administration was associated with system-wide immunity against the primary tumor.
The ability of the immune system to maintain memory of previous antigen encounters is the basis for long-term immunity. Here, we defined the components of immunological memory induced upon IT MVA administration. Circulating TAA-specific CD8+ T cells were detected in mice several months after tumor clearance regardless of the tumor model or mouse strain used. CD8+ T cell frequencies were significantly increased when 4-1BBL-adjuvanted MVA was used. We found that mice that were previously cured with IT MVA-TAA-4-1BBL were more resistant to subcutaneous tumor rechallenge with B16.OVA or B16.F10 than MVA-TAA treated counterparts. Analysis of tissues from those mice showed that T cell memory subsets were not only found in the circulation but in multiple anatomical sites, suggesting immune surveillance. Increased frequencies of antigen-specific CD8+ TCM and TEM subsets were detected in spleen and blood after local tumor rechallenge of cured mice that previously received MVA encoding 4-1BBL. It is well established that 4-1BBL/4-1BB signals are particularly potent in enhancing the expansion and maintenance of CD8 effector and memory T cells [43-45]. Likewise, MVA-encoded 4-1BBL costimulation enhanced the activation and effector function of tumor-specific cytotoxic T cells which resulted in the formation of a potent and diverse memory compartment.
In addition to circulating CD8+ TCM and TEM subsets, resident CD8+ TRM cells have been shown to cooperate in anti-tumor immunity [32, 33, 46]. Interestingly, cured mice after IT 4-1BBL-adjuvanted MVA showed increased frequencies of tumor-specific TRM cells exclusively in the TdLN after local rechallenge either with B16.OVA or B16.F10. Although CD8+ TRM cells were first identified in the tissues, they can also migrate from the tissues and accumulate in the draining LN of mice upon antigen reencounter [34, 46, 47]. In line with our results, 4-1BB has been shown to promote the establishment of an influenza-specific CD8+ TRM pool in the lung upon intranasal immunization [48]. We postulate a relationship between the expansion of tumor-specific CD8+ TRM cells in the TdLN and the better response to local secondary tumor rechallenge by cured mice upon IT 4-1BBL adjuvanted MVA.
In cancers, memory CD8+ T cells are often dysfunctional due to suboptimal differentiation or maintenance conditions and chronic antigen exposure [49]. This phenomenon is associated with the inability to secrete IL-2 and TNFα [50, 51]. Importantly, IT 4-1BBL adjuvanted MVA generated a highly competent CD8+ T cell memory pool, that upon reencounter of tumor antigen expanded and produced significant amounts of IFNγ, TNFα and IL-2 compared to IT MVA in all rechallenge models tested.
In summary, we describe a novel therapeutic platform based on the local injection of a non-replicating MVA expressing a tumor antigen in conjunction with 4-1BBL. IT virus injection induced profound proinflammatory changes in the TME leading to reactivation and expansion of tumor-specific CD8+ T cells. In addition, we demonstrated the generation of a diverse CD8+ T cell memory population protecting from local and systemic tumor rechallenge. Together with the excellent safety profile of MVA, our preclinical data provide a strong rationale for exploring this approach in the clinic.
Final remark: Several documents are cited throughout the text of this specification. Each of the documents cited herein (including all patents, patent applications, scientific publications, manufacturer's specifications, instructions, etc.) are hereby incorporated by reference in their entirety. To the extent, the material incorporated by reference contradicts or is inconsistent with this specification, the specification will supersede any such material. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention.
7.1 Construction of MVA Recombinants
Generation of recombinant MVA viruses that embody elements of the present disclosure was done by insertion of the indicated transgenes with their promoters into the vector MVA-BN. Transgenes were inserted using recombination plasmids containing the transgenes and a selection cassette, as well as sequences homologous to the targeted loci within MVA-BN. Homologous recombination between the viral genome and the recombination plasmid was achieved by transfection of the recombination plasmid into MVA-BN infected CEF cells. The selection cassette was then deleted during a second step with help of a plasmid expressing CRE-recombinase, which specifically targets loxP sites flanking the selection cassette, therefore excising the intervening sequence. Alternatively, deletion of the selection cassette was achieved by MVA-mediated recombination using MVA-derived internal repeat sequences.
For generation of recombinant MVA-mBN viruses, CEF cell cultures were each inoculated with MVA-BN and transfected each with the corresponding recombination plasmid. In turn, samples from these cell cultures were inoculated into CEF cultures in medium containing drugs inducing selective pressure, and fluorescence-expressing viral clones were isolated by plaque purification. Loss of the fluorescent-protein-containing selection cassette from these viral clones was mediated in a second step by CRE-mediated recombination involving two loxP sites flanking the selection cassette in each construct or MVA-mediated internal recombination After the second recombination step only the transgene sequences (e.g., 4-1BBL) with their promoters inserted in the targeted loci of MVA-BN were retained. Stocks of plaque-purified virus lacking the selection cassette were prepared. Expression of the identified transgenes is demonstrated in cells inoculated with the described construct.
7.2 Recombinant MVAs Comprising HERV-K Antigens
An MVA-based vector (“MVA-mBN489,” also referred to as “MVA-HERV-Prame-FOLR1-4-1-BBL-CD40L”) was designed comprising TAAs that are proteins of the K superfamily of human endogenous retroviruses (HERV-K), specifically, ERV-K-env and ERV-K-gag. The MVA also was designed to encode human FOLR1 and PRAME, and to express h4-1BBL and hCD40L.
A similar MVA-based vector referred to as “MVA-HERV-Prame-FOLR1-4-1-BBL” was designed to express the TAAs ERV-K-env and ERV-K-gag and human FOLR1 and PRAME, and to express h4-1BBL. Specifically, vector “MVA-BN-4IT” (“MVA-mBN494” or “MVA-HERV-FOLR1-PRAME-h4-1-BBL”) is schematically illustrated in
Another MVA-based vector referred to as “MVA-HERV-Prame-FOLR-CD40L was designed to express the TAAs ERV-K-env and ERV-K-gag and human FOLR1 and PRAME, and to express hCD40L. Each of these constructs is useful in methods of the invention.
Exemplary sequences are known in the art and are also set forth in the sequence listing provided. Any sequence can be used in the compositions and methods of the invention so long as it provides the necessary function to the relevant MVA.
For the ERV-K env and gag sequences described above, an amino acid consensus sequence was produced from at least 10 representative sequences, and a potential immunosuppressive domain was inactivated by mutations and replaced in part with the immunodominant T-cell epitope HERV-K-mel as shown below. Suitable sequences are set forth in SEQ ID NO:5 (ERV-K-gag synthetic protein consensus sequence); SEQ ID NO:6 (ERV-K-gag synthetic nucleotide sequence); SEQ ID NO:7 (ERV-K-env/MEL synthetic protein sequence); and SEQ ID NO:8 (ERV-K-env/MEL nucleotide sequence).
QTVIWMGDRLMSLEHRFQL
Modified Consensus Amino Acid Sequence of ERVK-Env (Above):
For some of these MVAs, hFOLR1 and PRAME were designed to be produced as a fusion protein. FOLR1 (folate receptor alpha) belongs to the family of folate receptors. It has a high affinity to folic acid and derivatives thereof, and is either secreted or expressed on the cell surface as a membrane protein. The transmembrane protein is anchored to the plasma membrane through a GPI (glycosylphosphatidylinositol) anchor which is most likely attached in the endoplasmic reticulum (ER) through a serine (Ser) residue in the C-terminal region of the protein. To avoid modification of FOLR1 with the GPI-anchor and full processing of the hFOLR1-hPRAME fusion protein in the ER, the C-terminal region from aa 234 to 257 (including the Ser residue) was deleted.
PRAME (Preferentially expressed antigen of melanoma) is a transcriptional regulator protein. It was first described as an antigen in human melanoma, which triggers autologous cytotoxic T cell-mediated immune responses and is expressed in variety of solid and hematological cancers. PRAME inhibits retinoic acid signaling via binding to retinoic acid receptors and thereby might provide a growth advantage to cancer cells. Functionality of PRAME requires nuclear localization, so potential nuclear localization signals (NLS) in PRAME were modified by targeted mutations in the hFOLR1-hPRAME fusion protein.
Thus, for the amino acid sequence of the hFOLR1-hPRAME fusion protein, FOLR1 was modified by deleting the C-terminal GPI anchor signal, while in PRAME, two potential nuclear localization signals were inactivated by amino acid substitutions. In this fusion protein, the N-terminal signal sequence of hFOLR1 should result in ER-targeting and incomplete processing of the fusion protein to serve as an additional safeguard to avoid nuclear localization of PRAME.
The protein sequences of human FOLR1 and human PRAME were based on NCBI RefSeq NP_000793.1 and NP_001278644.1, respectively. In addition to the modifications described above, the nucleotide sequence of the fusion protein was optimized for human codon usage, and poly-nt stretches, repetitive elements, and negative cis-acting elements were removed and the nucleotide sequence is set forth in SEQ ID NO:10 (“hFOLR1Δ_hPRAMEΔ fusion” nucleotide sequence), while the fusion protein sequence is set forth in SEQ ID NO:9.
ERRRLWGSIQSRYISMSVWTSPRRLVELAGQSLLKDEA
LAIAALELLPRELFPPLFMAAFDGRHSQTLKAMVQAWPFTCLPLGVLMKG
QHLHLETFKAVLDGLDVLLAQEVRPRRWKLQVLDLRKNSHQDFWTVWSGN
RASLYSFPEPEAAQPMTTKAKVDGLSTEAEQPFIPVEVLVDLFLKEGACD
ELFSYLIEKVAAKKNVLRLCCKKLKIFAMPMQDIKMILKMVQLDSIEDLE
VTCTWKLPTLAKFSPYLGQMINLRRLLLSHIHASSYISPEKEEQYIAQFT
SQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDV
MHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECG
ITDDQLLALLPSLSHCSQLTTLSFYGNSISISALQSLLQHLIGLSNLTHV
LYPVPLESYEDIHGTLHLERLAYLHARLRELLCELGRPSMVWLSANPCPH
CGDRTFYDPEPILCPCFMPN
Sequence of the hFOLR1-hPRAME Fusion Protein (Above):
The protein sequence of the membrane-bound human 4-1BBL used in this MVA shows 100% identity to NCBI RefSeq NP_003802.1, and the protein sequence of the membrane-bound human CD40L used shows 100% identity to NCBI RefSeq NP_000065.1. For both 4-1BBL and CD40L, the nucleotide sequence was optimized for human codon usage, and poly-nt stretches, repetitive elements, and negative cis-acting elements were removed.
The hCD40L amino acid sequence from NCBI RefSeq NP_000065.1. is set forth in SEQ ID NO:1, while the nucleotide sequence of hCD40L is set forth in SEQ ID NO:2. The h4-1BBL amino acid sequence from NCBI RefSeq NP_003802.1 is set forth in SEQ ID NO:3, while the nucleotide sequence of h4-1BBL is set forth in SEQ ID NO:4.
Each coding region was placed under the control of a different promoter, except that ERV-K-gag and h4-1BBL were both placed under the control of the Pr1328 promoter. The Pr1328 promoter (100 bp in length) is an exact homologue of the Vaccinia Virus Promoter PrB2R. It drives strong immediate early expression as well as late expression at a lower level. In the recombinant MVA-mBN489, the Pr13.5 long promoter drives expression of ERVK-env/MEL. This promoter compromises 124 bp of the intergenic region between 014L/13.5L driving the expression of the native MVA13.5L gene and exhibits a very strong early expression caused by two early promoter core sequences (see Wennier et al. (2013) PLoS One 8(8): e73511). The MVA1-40k promoter, used here to drive expression of hCD40L, was originally isolated as a 161 bp fragment from the vaccinia virus Wyeth Hind III H region in 1986. It compromises 158 bp of the Vaccinia Virus Wyeth and MVA genome within the intergenic region of 094L/095R driving the late gene transcription factor VLTF-4. The promoter PrH5m, used here to drive expression of the hFOLR1-hPRAME fusion protein, is a modified version of the Vaccinia virus H5 gene promoter. It consists of strong early and late elements resulting in expression during both early and late phases of infection of the recombinant MVA (see Wyatt et al. (1996) Vaccine 14: 1451-58).
Based on MVA-mBN494 (see above) still another vector was designed to contain a modification in ERVK-env/MEL. The resulting vector was referred to as “MVA-mBN502” and is schematically illustrated in
Natively, HERV-K-env consists of a signal peptide, which is cleaved off post-translationally, a surface (SU) and a transmembrane unit (TM). Cleavage into the two domains is achieved by cellular proteases. An RSKR cleavage motif is required and sufficient for cleavage of the full-length 90 kDa protein into SU (ca. 60 kDa) and TM (ca. 40 kDa) domains. As described above for the preparation of MVA-mBN494, an amino acid consensus sequence for env derived from at least ten representative sequences was generated, and a potential immunosuppressive domain in the TM was inactivated by mutations. The introduced mutations replaced a substantial portion of the immunosuppressive domain by the immunodominant T-cell epitope HERV-K-mel. This transgene (used in MVA-mBN494) was termed ERVK-env/MEL (
As compared to MVA-mBN494, the TM domain in ERVK-env/MEL is deleted in MVA-mBN502. This ERVK-env/MEL variant was designated “ERVK-env/MEL_03” and consists of the entire SU domain except for the RSKR furin cleavage site, which was deleted. The MEL peptide was inserted at the C-terminal end, followed by 6 amino acids of the TM domain (excluding the fusion peptide sequence, which is strongly hydrophobic). In addition, this modified ERVK-env/MEL was targeted to the plasma membrane by adding a membrane anchor derived from the human PDGF (platelet-derived growth factor) receptor. This membrane anchor was attached to the SU domain via a flexible glycine-containing linker (
7.3 Bioactivity of MVA-HERV-FOLR1-PRAME-h4-1-BBL (MVA-BN-417)
It was investigated whether infection with MVA-BN-4IT (i.e., MVA-HERV-FOLR1-PRAME-h4-1-BBL; see also above) would result in the presentation of vaccine-derived tumor antigens by HLA molecules on human cells. To this end, HLA-ABC peptide complexes on antigen presenting cells were immunoprecipitated, and it was analyzed which HLA-bound peptides could be identified by mass spectrometry.
First, the human monocytic cell line THP-1 was differentiated into macrophages (Daigneault et al. PLoS One, 2010), which exert antigen presenting capabilities, since antigens can be loaded to HLA class I (Nyambura L. et al. J. Immunol 2016). Indeed, THP-1 cells express HLA-A*0201+ which is one of the most frequent haplotypes in the USA and Europe (approximately 30% of the population). Apart of HLA-A*02:01:01G, THP-1 cells were reported to express HLA-B*15 and HLA-C*03 (Battle R. et al., Int. J. of Cancer). Here, 8×105/ml THP-1 cells were cultured in the presence of 200 ng/ml PMA (phorbol-12-myristate-13-acetate) for 3 days before medium was exchanged and cells were cultured for additional 2 days in the absence of PMA. On day 5 cells were infected with MVA-BN-4IT with an InfU (infectious unit) of 4 for 12 hours. As shown in
Next, a “ProPresent” HLA-ABC ligandome analysis (ProImmune) was performed. In MVA-BN-4IT infected cells, four tumor antigen-derived peptides were identified: The HERV-K env peptide ILTEVLKGV, the HERV-K gag peptide YLSFIKILL and the PRAME peptides ALQSLLQHL and SLLQHLIGL. The two identified PRAME peptides are largely overlapping and most likely share a common core epitope. Both peptides are predicted to bind very strongly to HLA-A*02:01, whereby ALQSLLQHL has almost a similar binding rank to HLA-B*15. Notably, the PRAME peptide SLLQHLIGL has already been described as an immunogenic HLA-A*0201-presented cytotoxic T lymphocyte epitope in human (Kessler J H. et al., J Exp Med., 2001). Altogether, the data demonstrate that the antigens expressed by MVA-BN-4IT can be loaded into HLA of infected cells.
Furthermore, MVA-BN-4IT was tested for its capability of expressing 4-1-BBL in a functional form that binds to its receptor, 4-1-BB. For that purpose, a commercial kit (“4-1BB Bioassay”, Promega) was used. The assay consists of a genetically engineered Jurkat T cell line expressing h4-1-BB and a luciferase reporter driven by a response element (RE) that can respond to 4-1-BB ligand stimulation. When h4-1-BB is stimulated by h4-1-BBL the RE activates cellular luciferase production within the cell. After cell lysis and addition of “Bio-Glo” reagent (Promega), luminescence is measured using a luminometer and quantified. Briefly, HeLa cells were plated (1×106) and infected (TCID50=2) each with the MVA-based constructs indicated in
Number | Date | Country | Kind |
---|---|---|---|
19210369.5 | Nov 2019 | EP | regional |
20191226.8 | Aug 2020 | EP | regional |
20193706.7 | Aug 2020 | EP | regional |
Filing Document | Filing Date | Country | Kind |
---|---|---|---|
PCT/EP2020/082888 | 11/20/2020 | WO |