The present invention relates generally to the field of medicine. More particularly, it concerns methods and compositions involving treatment of hypertriglyceridemia.
Hypertriglyceridemia is a condition in which triglyceride levels are elevated, often caused or exacerbated by uncontrolled diabetes mellitus, obesity, and sedentary habits. In certain circumstances, the underlying cause of hypertriglyceridemia is unknown and traditional treatments, such as lifestyle modulation or pharmacological therapies are ineffective. There is a need in the art for a more detailed understanding of the etiology of hypertriglyceridemia and more effective therapies in cases for which traditional therapies are ineffective.
The current disclosure fulfills the need in the art by providing a novel therapeutic strategy for patients with hypertriglyceridemia and/or chylomicronemia, wherein the patient is determined to have autoantibodies to GPIHBP1. It was unexpectedly found that autoantibodies to GPIHBP1, a GPI anchored protein of capillary endothelial cells that shuttles lipoprotein lipase to its site of action in the capillary lumen, were found to be present in patients with hypertriglyceridemia, and that the autoantibodies blocked the binding of lipoprotein lipase (LPL) to GPIHBP1. Accordingly, aspects of the disclosure relate to a method for treating hypertriglyceridemia and/or chylomicronemia in a patient comprising administering a therapeutically effective amount of an immunosuppressive treatment and/or GPIHBP1 activator to the patient; wherein the patient has been determined to have GPIHBP1 autoantibodies.
Further aspects relate to a method for classifying a subject or a method for detecting GP1HBP1 autoantibodies in a subject, the method comprising: a. obtaining a sample from the subject; and b. detecting the presence or absence of GP1HBP1 autoantibodies in the sample from the subject.
Further aspects relate to a method for diagnosing a subject, the method comprising: detecting the presence or absence of GP1HBP1 autoantibodies in a biological sample from the subject; and diagnosing the subject with GP1HBP1 autoantibody-induced hypertriglyceridemia when the presence of GP1HBP1 autoantibodies are detected.
Further aspects relate to a method for treating GP1HBP1 autoantibody-induced hypertriglyceridemia in a patient in need thereof, the method comprising administering a therapeutically effective amount of an immunosuppressive treatment and/or GPIHBP1 activator to the patient. In some embodiments, the patient has been determined to have GP1HBP1 autoantibodies.
In some embodiments of the above-disclosed aspects, the method further comprises obtaining a sample from the subject. In some embodiments, the method further comprises treating the subject diagnosed with GP1HBP1 autoantibody-induced hypertriglyceridemia with an immunosuppressive treatment and/or GPIHBP1 activator.
In some embodiments, detecting the presence or absence of GP1HBP1 autoantibodies comprises an ELISA assay. In some embodiments, detecting the presence or absence of GP1HBP1 autoantibodies comprises an assay described herein. In some embodiments, detecting GPIHBP1 autoantibodies comprises detecting the binding between antibodies isolated from a sample from the patient and GPIHBP1.
In some embodiments of the above-disclosed methods, the protein level or detected protein level of GP1HBP1 is greater than or less than 200 pg/mL. In some embodiments, the protein level or detected protein level of GP1HBP1 is greater than or less than 25, 75, 50, 100, 125, 150, 175, 200, 225, 250, 275, 300, 325, 350, 375, or 400 pg/mL (or any derivable range therein). In some embodiments, the detected autoantibodies comprise autoantibodies that bind specifically to monomeric non-reduced GPIHBP1.
In some embodiments, the method further comprises isolating GP1HBP1 autoantibodies from the subject. In some embodiments, the method further comprises detecting the binding of LPL to GP1HBP1 in the presence of the autoantibodies. In some embodiments, detecting the presence or absence of GP1HBP1 autoantibodies in the sample from the subject comprises contacting the sample from the subject with GP1HBP1 and detecting the binding between antibodies in the sample from the subject and GP1HBP1. In some embodiments, the method further comprises contacting the sample with LPL and detecting the binding between LPL and GP1HBP1 in the presence of the sample from the subject.
In some embodiments, the subject has chylomicronemia. In specific embodiments, the subject has symptoms of chylomicronemia, is at risk for chylomicronemia, has been diagnosed with chylomicronemia, and/or is being treated for chylomicronemia. In some embodiments, the expression levels of LPL and/or GPIHBP1 are determined to be normal based on comparing to control level.
In some embodiments, an immunosuppressive treatment is administered to the patient. In some embodiments, the immunosuppressive treatment is one that reduces autoantibodies in the patient. In some embodiments, the immunosuppressive treatment comprises belimumab, rituximab, plasmapheresis, WIG, Protein A-based absorbents, Anti-IL-6R, Anti-CD20, Anti-BLyS, BR3-Ig, AMG 623, Anti-BR3, TACI-Ig, Anti-CD22, LTbetaR-Ig, Anti-interferon-alpha, Anti-CD40, and Anti-CD40L, antithymocyte globulin, muromonab-CD3, and alemtuzumab. In some embodiments, the immunosuppressive treatment is one known in the art or described herein. In some embodiments, the immunosuppressive treatment comprises plasmapheresis.
In some embodiments, a GPIHBP1 activator is administered to the patient. In some embodiments, the GPIHBP1 activator is a GPIHBP1 polypeptide. In some embodiments, the GPIHBP1 polypeptide binds to the autoantibodies in the patient.
In some embodiments, the method further comprises detecting GPIHBP1 autoantibodies in the patient. In some embodiments, the autoantibodies are detected by ELISA. In some embodiments, the autoantibodies are detected by methods known in the art or described herein. In some embodiments, detecting GPIHBP1 autoantibodies comprises detecting the binding between antibodies isolated from a sample from the patient and GPIHBP1. In some embodiments, the GPIHBP1 is recombinant. In some embodiments, the recombinant GPIHBP1 comprises an amino acid sequence with at least 80% identity to SEQ ID NO:4. In some embodiments, the recombinant GPIHBP1 comprises an amino acid sequence with at least 70%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% (or any derivable range therein) identity to SEQ ID NO:4. In some embodiments, the recombinant GPIHBP1 is produced in insect cells. In some embodiments, the insect cells are Drosophila melanogaster. In some embodiments, the GPIHBP1 is monomeric non-reduced GPIHBP1.
In some embodiments, the patient or subject has been diagnosed with hypertriglyceridemia. In specific embodiments, the subject has symptoms of hypertriglyceridemia, is at risk for hypertriglyceridemia, has been diagnosed with hypertriglyceridemia, and/or is being treated for hypertriglyceridemia. In some embodiments, the patient has been previously treated for hypertriglyceridemia. In some embodiments, the patient was non-responsive to the previous treatment. In some embodiments, the patient does not have diabetes or coronary artery disease. In some embodiments, the patient is not obese. In some embodiments, the patient is not genetically deficient for GPIHBP1. In some embodiments, the expression level and/or activity level of GPIHBP1 and/or LPL in a biological sample from the patient is normal or reduced compared to a control. In some embodiments, the control is the level of GPIHBP1 in a biological sample from a patient without hypertriglyceridemia. In some embodiments, the control may be the level of a protein, antibody, or nucleic acid in a biological sample with a patient known to have GP1HBP1 autoantibodies and also, optionally, known to have hypertriglyderidemia and/or chylomicronemia. One skilled in the art would understand that, when comparing to a sample known to have GP1HBP1 autoantibodies, the level of the tested substance would be expected to be similar or within 0.5, 1, 1.5, or 2 standard deviations. In some embodiments the biological sample from the patient or control comprises capillary endothelial cells, serum, whole blood, or extracts or fractions thereof. In some embodiments, the biological sample is one described herein. In some embodiments, the hypertriglyceridemia is of unknown etiology.
In some embodiments, the autoantibodies bind only to monomeric non-reduced GPIHBP1. In some embodiments, the antibodies have been determined to bind only to monomeric non-reduced GPIHBP1. In some embodiments, the autoantibodies have been determined to inhibit the binding of LPL to GPIHBP1.
In some embodiments, the method further comprises isolating GPIHBP1 autoantibodies from the patient. In some embodiments, the isolated autoantibodies are determined to inhibit the binding of LPL to GPIHBP1.
In some embodiments, the patient is one that has been determined to have low levels of LPL in a sample from the patient compared to a control. In some embodiments, the method further comprises detecting the level of LPL in a sample from the patient. In some embodiments, the level of LPL is reduced by at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100% (or any range derivable therein) compared to the control. In some embodiments, the LPL is reduced in pre-heparin plasma. In some embodiments, diagnosing the subject with GP1HBP1 autoantibody-induced hypertriglyceridemia further comprises diagnosing the subject with GP1HBP1 autoantibody-induced hypertriglyceridemia when the detected LPL level is less than 50 ng/mL. In some embodiments, diagnosing the subject with GP1HBP1 autoantibody-induced hypertriglyceridemia further comprises diagnosing the subject with GP1HBP1 autoantibody-induced hypertriglyceridemia when the detected LPL level is less than 200, 175, 150, 125, 100, 75, 50, 40, 30, 20, 10, or 5 ng/mL (or any derivable range therein).
The inhibition of binding may be at least, at most, or exactly 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100% inhibition (or any range derivable therein).
Any of the methods described herein may be implemented on tangible computer-readable medium comprising computer-readable code that, when executed by a computer, causes the computer to perform one or more operations. In some embodiments, there is a tangible computer-readable medium comprising computer-readable code that, when executed by a computer, causes the computer to perform operations comprising: a) receiving information corresponding to an expression or activity level of a gene or protein encoding GPIHBP1 or LPL or a signal intensity or level corresponding to antibody/antigen binding in an immunology assay with a sample from a patient; and b) determining a difference value in the expression or activity levels using the information corresponding to the expression or activity levels in the sample compared to a control or reference expression or activity level for the gene or quantifying the signal intensity to determine whether specific binding has occurred.
In some embodiments, receiving information comprises receiving from a tangible data storage device information corresponding to the expression or activity levels or signal intensities from a tangible storage device. In additional embodiments the medium further comprises computer-readable code that, when executed by a computer, causes the computer to perform one or more additional operations comprising: sending information corresponding to the difference value to a tangible data storage device, calculating a prognosis score for the patient, treating the patient with a therapy if the patient is determined to have GPIHBP1 autoantibodies.
As used herein the specification, “a” or “an” may mean one or more. As used herein in the claim(s), when used in conjunction with the word “comprising”, the words “a” or “an” may mean one or more than one.
The use of the term “or” in the claims is used to mean “and/or” unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive, although the disclosure supports a definition that refers to only alternatives and “and/or.” As used herein “another” may mean at least a second or more.
Throughout this application, the term “about” is used to indicate that a value includes the inherent variation of error for the device, the method being employed to determine the value, or the variation that exists among the study subjects.
Other objects, features and advantages of the present invention will become apparent from the following detailed description. It should be understood, however, that the detailed description and the specific examples, while indicating preferred embodiments of the invention, are given by way of illustration only, since various changes and modifications within the spirit and scope of the invention will become apparent to those skilled in the art from this detailed description.
The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
It was unexpectedly found that autoantibodies to GPIHBP1, a GPI anchored protein of capillary endothelial cells that shuttles lipoprotein lipase to its site of action in the capillary lumen, were found to be present in patients with hypertriglyceridemia, and that the autoantibodies blocked the binding of LPL to GPIHBP1 (
Patients that have been determined to have the GPIHBP1 autoantibodies had low levels of LPL in their plasma (Table 1), a consequence of defective GPIHBP1-mediated transport of LPL to the capillary lumen (
As used herein, the term “antibody” encompasses antibodies and antibody fragments thereof, derived from any antibody-producing mammal (e.g., mouse, rat, rabbit, and primate including human), that specifically bind to GPIHBP1 polypeptides or portions thereof. Exemplary antibodies include polyclonal, monoclonal and recombinant antibodies; multispecific antibodies (e.g., bispecific antibodies); humanized antibodies; murine antibodies; chimeric, mouse-human, mouse-primate, primate-human monoclonal antibodies; and anti-idiotype antibodies, and may be any intact molecule or fragment thereof. “Autoantibodies” refer specifically to antibodies produced by the immune system of an individual that are directed against one or more of the individual's own proteins.
Chylomicronemia refers to a disorder in which the body does not break down fats (lipids) correctly. This causes fat particles called chylomicrons to build up in the blood.
As used herein, the term “antibody fragment” refers to a portion derived from or related to a full-length anti-GPIHBP1 antibody, generally including the antigen binding or variable region thereof. Illustrative examples of antibody fragments include Fab, Fab′, F(ab)2, F(ab′)2 and Fv fragments, scFv fragments, diabodies, linear antibodies, single-chain antibody molecules and multispecific antibodies formed from antibody fragments.
As used herein, a “single-chain Fv” or “scFv” antibody fragment comprises the VH and VL domains of an antibody, wherein these domains are present in a single polypeptide chain. Generally, the Fv polypeptide further comprises a polypeptide linker between the VH and VL domains, which enables the scFv to form the desired structure for antigen binding.
The term substantially the same or not significantly different refers to a level of expression that is not significantly different than what it is compared to. Alternatively, or in conjunction, the term substantially the same refers to a level of expression that is less than 2, 1.5, or 1.25 fold different (or any range derivable therein) than the expression or activity level it is compared to.
The terms “subject” and “patient” are used interchangeably, and refer to any single subject for which therapy is desired, including humans, cattle, dogs, guinea pigs, rabbits, chickens, and so on. Also intended to be included as a subject are any subjects involved in clinical research trials not showing any clinical sign of disease, or subjects involved in epidemiological studies, or subjects used as controls.
“About” and “approximately” shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Typically, exemplary degrees of error are within 20 percent (%), preferably within 10%, and more preferably within 5% of a given value or range of values. Alternatively, and particularly in biological systems, the terms “about” and “approximately” may mean values that are within an order of magnitude, preferably within 5-fold and more preferably within 2-fold of a given value. In some embodiments it is contemplated that an numerical value discussed herein may be used with the term “about” or “approximately.”
Glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 (GPI-HBP1) also known as high density lipoprotein-binding protein 1, GPI-HBP1, and HYPL1D is a protein that in humans is encoded by the GPIHBP1 gene.
Dietary fats are packaged by intestine into triglyceride-rich lipoproteins called chylomicrons. The triglycerides in chylomicrons are hydrolyzed by lipoprotein lipase (LPL) along the luminal surface of capillaries, mainly in heart, skeletal muscle, and adipose tissue. GPIHBP1 is a capillary endothelial cell protein that provides a platform for LPL-mediated processing of chylomicrons, and shuttles LPL to its site of action in the capillary lumen.
A representative protein sequence for GPIHBP1 comprises the following protein sequence: mkalgavlla lllfgrpgrg qtqqeeeeed edhgpddyde ededeveeee tnrlpggrsr vllrcytcks lprdercnit qncshgqtct tliahgntes glltthstwc tdscqpitkt vegtqvtmtc cqsslcnvpp wqssrvqdpt gkgaggprgs setvgaalll nllaglgamg arrp (SEQ ID NO:1).
A further representative sequence for GPIHBP1 comprises the following protein sequence:
Variants and/or polypeptides with conservative amino acids are also contemplated. Substitutions may be conservative, that is, one amino acid is replaced with one of similar shape and charge. Conservative substitutions are well known in the art and include, for example, the changes of: alanine to serine; arginine to lysine; asparagine to glutamine or histidine; aspartate to glutamate; cysteine to serine; glutamine to asparagine; glutamate to aspartate; glycine to proline; histidine to asparagine or glutamine; isoleucine to leucine or valine; leucine to valine or isoleucine; lysine to arginine; methionine to leucine or isoleucine; phenylalanine to tyrosine, leucine or methionine; serine to threonine; threonine to serine; tryptophan to tyrosine; tyrosine to tryptophan or phenylalanine; and valine to isoleucine or leucine. Alternatively, substitutions may be non-conservative such that a function or activity of the polypeptide is affected. Non-conservative changes typically involve substituting a residue with one that is chemically dissimilar, such as a polar or charged amino acid for a nonpolar or uncharged amino acid, and vice versa.
In some embodiments, a GPIHBP1 activator is administered to the patient. In some embodiments, the activator comprises a GPIHBP1 polypeptide. In some embodiments, the GPIHBP1 polypeptide binds to autoantibodies in the subject, thereby reducing the amount of autoantibodies that can bind to GPIHBP1 and, in effect, acting as an indirect activator by interfering with autoantibody binding. In some embodiments, the GPIHBP1 activator increases the expression or protein activity of GPIHBP1 in the patient.
In some embodiments, an immunosuppressive therapy is administered to the patient. In some embodiments, the immunosuppressive therapy is one that reduces autoantibodies in the patient. Such immunosuppressive therapies are known in the art. For example, Belimumab has been shown to reduce autoantibodies (Stohl et al., Arthritis Rheum. 2012 July; 64(7):2328-37). Rituximab, by causing B-cell depletion, reducing the production of autoantibodies in patients (Mixalis L. Kosmidis, Ther Adv Neurol Disord. 2010 March; 3(2): 93-105). In some embodiments, the therapy that reduces autoantibodies is one that modulates B-cell function and/or comprises depleting antibodies against T cells, B cells, or both. In some embodiments, the immunosuppressive therapy that reduces autoantibodies in the subject comprises plasmapheresis.
In some embodiments, an immunosuppressive therapy is one that modulates B-cell function. Such agents include IVIG, Protein A-based absorbents, Anti-IL-6R, Anti-CD20, Anti-BLyS, BR3-Ig, AMG 623, Anti-BR3, TACI-Ig, Anti-CD22, LTbetaR-Ig, Anti-interferon-alpha, Anti-CD40, and/or Anti-CD40L. It is specifically contemplated that one or more of these agents may be excluded in some embodiments.
In some embodiments, the immunosuppressive therapy comprises depleting antibodies against T cells, B cells, or both. Exemplary therapeutics include a polyclonal antibody, horse or rabbit antithymocyte globulin, mouse monoclonal anti-CD3 antibody (muromonab-CD3), humanized monoclonal anti CD-52 antibody (alemtuzumab), and/or B-cell-depleting monoclonal anti-CD-20 antibody (rituximab). It is specifically contemplated that one or more of these therapeutics may be excluded in some embodiments.
In some embodiments, the immunosuppressive therapy comprises one known in the art or described herein such as plasmapheresis, cyclosporine, tacrolimus, sirolimus, everolimus, pimecrolimus, ABT-578, AP23573, CCI-779, interferons (IFN-β or IFN-γ), TNF binding proteins (infliximab, etanercept, or adalimumab), azathioprine, cyclosporine, corticosteroids, mycophenolic acid, fingolimod, myriocin, glucocorticoids, monoclonal antibodies, cyclophosphamide, mycophenolate mofetil, gusperimus, mizoribine, doxorubicin, adriamycin, azathiopurine, busulfan, deoxyspergualin, fludarabine, 5-fluorouracil, leflunomide (LEF); methotrexate, prednisolone, methylprednisolone, basiliximab, daclizumab, and/or muromonab. It is specifically contemplated that one or more of these agents may be excluded in some embodiments.
It is specifically contemplated that any of the active ingredients or immunosuppressant therapies or combinations thereof described herein may be excluded from the methods either alone or in a combination therapy.
In certain aspects, methods involve obtaining a sample from a subject. The methods of obtaining provided herein may include methods of blood withdrawal or tissue biopsy, such as fine needle aspiration, core needle biopsy, vacuum assisted biopsy, incisional biopsy, excisional biopsy, punch biopsy, shave biopsy or skin biopsy. Alternatively, the sample may be obtained from any other source including but not limited to blood, sweat, hair follicle, buccal tissue, tears, menses, feces, or saliva. In certain aspects the sample is obtained from the serum of a patient. In certain aspects of the current methods, any medical professional such as a doctor, nurse or medical technician may obtain a biological sample for testing. Yet further, the biological sample can be obtained without the assistance of a medical professional.
Techniques for isolating autoantibodies from a blood/serum sample are well known in the art. The IgG purification may be performed using Melon Gel Kit (cat. N. 45206) according to the manufacturer instructions (Thermo Scientific, Pierce, Rockford, USA). IgG containing effluents can be saved and frozen at −20° C. before determining the affinity of the autoantibodies.
A sample may include but is not limited to blood, tissue, cells, or biological extracts of cells or cells derived from cells of a subject. The biological sample may be a heterogeneous or homogeneous population of cells or tissues. The biological sample may be obtained using any method known to the art that can provide a sample suitable for the analytical methods described herein. The sample may be obtained by non-invasive methods including but not limited to: scraping of the skin or cervix, swabbing of the cheek, saliva collection, urine collection, feces collection, collection of menses, tears, or semen. In certain embodiments the samples are obtained by biopsy, swabbing, scraping, phlebotomy, or any other methods known in the art. In some cases, the sample may be obtained, stored, or transported using components of a kit of the present methods. Samples may be obtained at different times are stored and/or analyzed by different methods. For example, a sample may be obtained and analyzed by routine staining methods or any other cytological analysis methods.
In some embodiments the biological sample may be obtained by a physician, nurse, or other medical professional such as a medical technician, endocrinologist, cytologist, phlebotomist, radiologist, or a pulmonologist. The medical professional may indicate the appropriate test or assay to perform on the sample. In certain aspects a molecular profiling business may consult on which assays or tests are most appropriately indicated. In further aspects of the current methods, the patient or subject may obtain a biological sample for testing without the assistance of a medical professional, such as obtaining a whole blood sample, a urine sample, a fecal sample, a buccal sample, or a saliva sample.
In other cases, the sample is obtained by an invasive procedure including but not limited to: biopsy, needle aspiration, or phlebotomy. The method of needle aspiration may further include fine needle aspiration, core needle biopsy, vacuum assisted biopsy, or large core biopsy. In some embodiments, multiple samples may be obtained by the methods herein to ensure a sufficient amount of biological material.
In some embodiments of the present methods, the biological sample may be obtained from a subject directly, from a medical professional, from a third party, or from a kit provided by a molecular profiling business or a third party. In some cases, the biological sample may be obtained by the molecular profiling business after the subject, a medical professional, or a third party acquires and sends the biological sample to the molecular profiling business. In some cases, the molecular profiling business may provide suitable containers, and excipients for storage and transport of the biological sample to the molecular profiling business.
In some embodiments of the methods described herein, a medical professional need not be involved in the initial diagnosis or sample acquisition. An individual may alternatively obtain a sample through the use of an over the counter (OTC) kit. An OTC kit may contain a means for obtaining said sample as described herein, a means for storing said sample for inspection, and instructions for proper use of the kit. In some cases, molecular profiling services are included in the price for purchase of the kit. In other cases, the molecular profiling services are billed separately. A sample suitable for use by the molecular profiling business may be any material containing tissues, cells, nucleic acids, proteins, polypeptides, genes, gene fragments, expression products, gene expression products, protein expression products or fragments, or gene expression product fragments of an individual to be tested. Methods for determining sample suitability and/or adequacy are provided.
In some embodiments, the subject may be referred to a specialist surgeon or endocrinologist. The specialist may likewise obtain a biological sample for testing or refer the individual to a testing center or laboratory for submission of the biological sample. In some cases the medical professional may refer the subject to a testing center or laboratory for submission of the biological sample. In other cases, the subject may provide the sample. In some cases, a molecular profiling business may obtain the sample.
A variety of techniques can be employed to measure expression levels of polypeptides and proteins in a biological sample. Examples of such formats include, but are not limited to, enzyme immunoassay (EIA), radioimmunoassay (RIA), Western blot analysis, indirect immunofluorescence, immunodiffusion, immunoblotting, laser beads, antigen arrays, and enzyme linked immunoabsorbent assay (ELISA). A skilled artisan can readily adapt known protein/antibody detection methods for use in detecting GPIHBP1 autoantibodies.
In one embodiment, GPIHBP1 polypeptides, antibodies, or antibody fragments or derivatives, can be used in methods such as Western blots or immunofluorescence techniques to detect autoantibody expression. In some embodiments, either the antibodies or proteins (i.e. GPIHBP1 polypeptides) are immobilized on a solid support. Suitable solid phase supports or carriers include any support capable of binding an antigen or an antibody. Well-known supports or carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite.
One skilled in the art will know many other suitable carriers for binding antibody, autoantibody, or antigen, and will be able to adapt such support for use with the present disclosure. The support can then be washed with suitable buffers followed by treatment with the detectably labeled antibody, such as a labeled secondary antibody. The solid phase support can then be washed with the buffer a second time to remove unbound antibody. The amount of bound label on the solid support can then be detected by conventional means.
Immunological methods for detecting and measuring complex formation as a measure of protein expression using either specific polyclonal or monoclonal antibodies are known in the art. Examples of such techniques include enzyme-linked immunosorbent assays (ELISAs), radioimmunoassays (RIAs), fluorescence-activated cell sorting (FACS) and antibody arrays. Such immunoassays typically involve the measurement of complex formation between the protein and its specific antibody. These assays and their quantitation against purified, labeled standards are well known in the art. A two-site, monoclonal-based immunoassay utilizing antibodies reactive to two non-interfering epitopes or a competitive binding assay may be employed. In some embodiments, the immunoassay detects binding of LPL to GPIHBP1 in the presence of autoantibodies isolated from a patient sample.
Numerous labels are available and commonly known in the art. Antibodies or polypeptides can be labeled using the techniques known in the art. Radioisotope labels include, for example, 36S, 14C, 125I, 3H, and 131I. Fluorescent labels include, for example, labels such as rare earth chelates (europium chelates) or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, Lissamine, phycoerythrin and Texas Red are available. The fluorescent labels can be conjugated to the antibody variant using the techniques known in the art. Fluorescence can be quantified using a fluorimeter. Various enzyme-substrate labels are available and U.S. Pat. Nos. 4,275,149, 4,318,980 provides a review of some of these. The enzyme generally catalyzes a chemical alteration of the chromogenic substrate which can be measured using various techniques. For example, the enzyme may catalyze a color change in a substrate, which can be measured spectrophotometrically. Alternatively, the enzyme may alter the fluorescence or chemiluminescence of the substrate. Techniques for quantifying a change in fluorescence are described above. The chemiluminescent substrate becomes electronically excited by a chemical reaction and may then emit light which can be measured (using a chemiluminometer, for example) or donates energy to a fluorescent acceptor. Examples of enzymatic labels include luciferases (e.g., firefly luciferase and bacterial luciferase; U.S. Pat. No. 4,737,456), luciferin, 2,3-dihydrophthalazinediones, malate dehydrogenase, urease, peroxidase such as horseradish peroxidase (HRPO), alkaline phosphatase, .beta.-galactosidase, glucoamylase, lysozyme, saccharide oxidases (e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase), heterocyclic oxidases (such as uricase and xanthine oxidase), lactoperoxidase, microperoxidase, and the like. Techniques for conjugating enzymes to antibodies are described in O'Sullivan et al., Methods for the Preparation of Enzyme-Antibody Conjugates for Use in Enzyme Immunoassay, in Methods in Enzymology (Ed. J. Langone & H. Van Vunakis), Academic press, New York, 73: 147-166 (1981).
In some embodiments, a detection label is indirectly conjugated with an antibody or polypeptide, such as a GPIHBP1 polypeptide. The skilled artisan will be aware of various techniques for achieving this. For example, the antibody can be conjugated with biotin and any of the three broad categories of labels mentioned above can be conjugated with avidin, or vice versa. Biotin binds selectively to avidin and thus, the label can be conjugated with the antibody in this indirect manner. Alternatively, to achieve indirect conjugation of the label with the antibody, the antibody is conjugated with a small hapten (e.g., digoxin) and one of the different types of labels mentioned above is conjugated with an anti-hapten antibody (e.g., anti-digoxin antibody). In some embodiments, the antibody need not be labeled, and the presence thereof can be detected using a labeled antibody, which binds to the antibody.
In certain aspects, the compositions or agents for use in the methods, such as immunosuppressive agents or GPIHBP1 activators, are suitably contained in a pharmaceutically acceptable carrier. The carrier is non-toxic, biocompatible and is selected so as not to detrimentally affect the biological activity of the agent. The agents in some aspects of the disclosure may be formulated into preparations for local delivery (i.e. to a specific location of the body, such as skeletal muscle or other tissue) or systemic delivery, in solid, semi-solid, gel, liquid or gaseous forms such as tablets, capsules, powders, granules, ointments, solutions, depositories, inhalants and injections allowing for oral, parenteral or surgical administration. Certain aspects of the disclosure also contemplate local administration of the compositions by coating medical devices and the like.
Suitable carriers for parenteral delivery via injectable, infusion or irrigation and topical delivery include distilled water, physiological phosphate-buffered saline, normal or lactated Ringer's solutions, dextrose solution, Hank's solution, or propanediol. In addition, sterile, fixed oils may be employed as a solvent or suspending medium. For this purpose any biocompatible oil may be employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid find use in the preparation of injectables. The carrier and agent may be compounded as a liquid, suspension, polymerizable or non-polymerizable gel, paste or salve.
The carrier may also comprise a delivery vehicle to sustain (i.e., extend, delay or regulate) the delivery of the agent(s) or to enhance the delivery, uptake, stability or pharmacokinetics of the therapeutic agent(s). Such a delivery vehicle may include, by way of non-limiting examples, microparticles, microspheres, nanospheres or nanoparticles composed of proteins, liposomes, carbohydrates, synthetic organic compounds, inorganic compounds, polymeric or copolymeric hydrogels and polymeric micelles.
In certain aspects, the actual dosage amount of a composition administered to a patient or subject can be determined by physical and physiological factors such as body weight, severity of condition, the type of disease being treated, previous or concurrent therapeutic interventions, idiopathy of the patient and on the route of administration. The practitioner responsible for administration will, in any event, determine the concentration of active ingredient(s) in a composition and appropriate dose(s) for the individual subject.
In certain embodiments, pharmaceutical compositions may comprise, for example, at least about 0.1% of an active agent. In other embodiments, the active agent may comprise between about 2% to about 75% of the weight of the unit, or between about 25% to about 60%, for example, and any range derivable therein. In other non-limiting examples, a dose may also comprise from about 1 microgram/kg/body weight, about 5 microgram/kg/body weight, about 10 microgram/kg/body weight, about 50 microgram/kg/body weight, about 100 microgram/kg/body weight, about 200 microgram/kg/body weight, about 350 microgram/kg/body weight, about 500 microgram/kg/body weight, about 1 milligram/kg/body weight, about 5 milligram/kg/body weight, about 10 milligram/kg/body weight, about 50 milligram/kg/body weight, about 100 milligram/kg/body weight, about 200 milligram/kg/body weight, about 350 milligram/kg/body weight, about 500 milligram/kg/body weight, to about 1000 mg/kg/body weight or more per administration, and any range derivable therein. In non-limiting examples of a derivable range from the numbers listed herein, a range of about 5 microgram/kg/body weight to about 100 mg/kg/body weight, about 5 microgram/kg/body weight to about 500 milligram/kg/body weight can be administered.
In certain aspects, the pharmaceutical compositions are advantageously administered in the form of injectable compositions either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid prior to injection may also be prepared. These preparations also may be emulsified. A typical composition for such purpose comprises a pharmaceutically acceptable carrier. For instance, the composition may contain 10 mg or less, 25 mg, 50 mg or up to about 100 mg of human serum albumin per milliliter of phosphate buffered saline. Other pharmaceutically acceptable carriers include aqueous solutions, non-toxic excipients, including salts, preservatives, buffers and the like.
Examples of non-aqueous solvents are propylene glycol, polyethylene glycol, vegetable oil and injectable organic esters such as ethyloleate. Aqueous carriers include water, alcoholic/aqueous solutions, saline solutions, parenteral vehicles such as sodium chloride, Ringer's dextrose, etc. Intravenous vehicles include fluid and nutrient replenishers. Preservatives include antimicrobial agents, antifungal agents, anti-oxidants, chelating agents and inert gases. The pH and exact concentration of the various components the pharmaceutical composition are adjusted according to well-known parameters.
Additional formulations are suitable for oral administration. Oral formulations include such typical excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate and the like. The compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders.
In further aspects, the pharmaceutical compositions may include classic pharmaceutical preparations. Administration of pharmaceutical compositions according to certain aspects may be via any common route so long as the target tissue is available via that route. This may include oral, nasal, buccal, rectal, vaginal or topical. Alternatively, administration may be by orthotopic, intradermal, subcutaneous, intramuscular, intraperitoneal or intravenous injection. Such compositions would normally be administered as pharmaceutically acceptable compositions that include physiologically acceptable carriers, buffers or other excipients. For treatment of conditions of the lungs, aerosol delivery can be used. Volume of the aerosol is between about 0.01 ml and 0.5 ml.
An effective amount of the pharmaceutical composition is determined based on the intended goal. The term “unit dose” or “dosage” refers to physically discrete units suitable for use in a subject, each unit containing a predetermined-quantity of the pharmaceutical composition calculated to produce the desired responses discussed above in association with its administration, i.e., the appropriate route and treatment regimen. The quantity to be administered, both according to number of treatments and unit dose, depends on the protection or effect desired.
Precise amounts of the pharmaceutical composition also depend on the judgment of the practitioner and are peculiar to each individual. Factors affecting the dose include the physical and clinical state of the patient, the route of administration, the intended goal of treatment (e.g., alleviation of symptoms versus cure) and the potency, stability and toxicity of the particular therapeutic substance.
Certain aspects of the present disclosure also concern kits containing compositions of the disclosure or compositions to implement methods of the disclosure. In some embodiments, kits can be used to evaluate one or more nucleic acid and/or polypeptide molecules, such as autoantibodies, from a sample from a subject. In certain embodiments, a kit contains a GPIHBP1 polypeptide. In some embodiments, the polypeptide is a recombinant polypeptide. In some embodiments, the recombinant GPIHBP1 comprises an amino acid sequence with at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity to SEQ ID NO:4 (or any range derivable therein). In some embodiments, the recombinant GPIHBP1 is produced in insect cells. In some embodiments, the recombinant GPIHBP1 is produced in mammalian cells. In some embodiments, the GPIHBP1 is purified. In some embodiments, the GPIHBP1 comprises human GPIHBP1. In some embodiments, the GPIHBP1 comprises a C-terminal portion that is non-human. In some embodiments, the non-human c-terminal portion comprises GPIHBP1 polypeptides from mouse GPIHBP1.
In some embodiments, the kit further comprises labeled anti-human IgG.
In some embodiments, the kit further comprises a LPL polypeptide. In some embodiments, the LPL polypeptide comprises a polypeptide from human LPL or a polypeptide that is at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to a human LPL polypeptide (or any range derivable therein).
A representative polypeptide of human LPL is:
In some embodiments, the LPL polypeptide comprises a polypeptide tag. In some embodiments, the polypeptide tag is a V5 polypeptide tag. Other polypeptide tags are known in the art and include, for example, poly(His) tag, glutathione-S-transferase tag, chitin binding protein tag, maltose binding protein tag, thioredoxin tag, FLAG-gay, Myc tag, or HA tag.
In some embodiments, the kit further comprises a antibody that specifically binds to a LPL polypeptide or a polypeptide tag on the LPL polypeptide. In some embodiments, the antibody further comprises a detectable label.
Kits may comprise components, which may be individually packaged or placed in a container, such as a tube, bottle, vial, syringe, or other suitable container means.
Individual components may also be provided in a kit in concentrated amounts; in some embodiments, a component is provided individually in the same concentration as it would be in a solution with other components. Concentrations of components may be provided as 1×, 2×, 5×, 10×, or 20× or more (or any range derivable therein).
Kits for using probes, polypeptide detecting agents, and/or activators of the disclosure for prognostic or diagnostic applications are included.
In certain aspects, negative and/or positive control agents are included in some kit embodiments.
It is contemplated that any method or composition described herein can be implemented with respect to any other method or composition described herein and that different embodiments may be combined.
Any embodiment of the disclosure relating to a polypeptide or nucleic acid is contemplated also to cover embodiments whose sequences are at least 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99% identical to the polypeptide or nucleic acid.
The kit can further comprise reagents for labeling probes, nucleic acids, polypeptides, antibodies, and/or detecting agents. The kit may also include labeling reagents, including at least one of amine-modified nucleotide, poly(A) polymerase, and poly(A) polymerase buffer. Labeling reagents can include an amine-reactive dye.
The following examples are included to demonstrate certain embodiments of the invention. It should be appreciated by those of skill in the art that the techniques disclosed in the examples which follow represent techniques discovered by the inventor to function well in the practice of the invention, and thus can be considered to constitute preferred modes for its practice. However, those of skill in the art should, in light of the present disclosure, appreciate that many changes can be made in the specific embodiments which are disclosed and still obtain a like or similar result without departing from the spirit and scope of the invention. In the examples and throughout the disclosure, Protein-G variants are polypeptides comprising a Fab-binding region.
Human GPIHBP1 was cloned into a UPAR expression vector for Drosophila (Drosophila melanogaster). In some embodiments, the GPIHBP1 is modified to contain carboxyl terminal sequences from mouse GPIHPB1 so that detection or capture of the protein can be achieved with a monoclonal antibody against the carboxyl terminal region of GPIHBP1.
The sequence of the human GPIHBP1 with a N-terminus R24 epitope tag and a C-terminus 11A12 epitope tag is as follows:
CGCCAGTGTT ACAGCTGCAA GGGGAACAGC ACCCATGGAT GCTCCTCTGA
AGAGACTTTC CTCATTGACT GCCGAGGCCC CATGAATCAA TGTCTGGTAG
CCACCGGCAC TCACGAACCG AAAAACCAAA GCTATATGGT AAGAGGCTGT
GCAACCGCCT CAATGTGCCA ACATGCCCAC CTGGGTGACG CCTTCAGCAT
GAACCACATT GATGTCTCCT GCTGTACTAA AAGTGGCTGT AACCACCCAG
ACCTGGATGT CCAGTACCGC AGTGGGCTCG AGgacgacga cgataagCAG
ACACAGCAGG AGGAAGAGGA AGAGGACGAG GACCACGGGC CAGATGACTA
CGACGAGGAA GATGAGGATG AGgtgGAAGA GGAGGAGACC AACAGGCTCC
CTGGTGGCAG GAGCAGAGTG CTGCTGCGGT GCTACACCTG CAAGTCCCTG
CCCAGGGACG AGCGCTGCAA CCTGACGCAG AACTGCTCAC ATGGCCAGAC
CTGCACAACC CTCATTGCCC ACGGGAACAC CGAGTCAGGC CTCCTGACCA
CCCACTCCAC GTGGTGCACA GACAGCTGCC AGCCCATCAC CAAGACGGTG
GAGGGGACCC AGGTGACCAT GACCTGCTGC CAGTCCAGCC TGTGC
AATAT
TCCACCCTGG CAGAACCCCC AAGTCCAGAA CCCTCTGGGT GGCCGGGCAG
ACAGCCCCCT GGAAAGTGGG ACTAGACATC CTCAGGGTGG CAAGTTTAGC
CACCCCCAGG TTGTCAAGGC TGCTCATCCT CAGAGCGATG GGGCTAACTT
GCCTAAGAGT GGCAAGGCTA ACCAGCCCCA GTGA.
RQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHL
GDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGLEddddkQTQQEEEEEDEDHGPDDYDEEDED
EVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHS
TWCTDSCQPITKTVEGTQVTMTCCQSSLC
NIPPWQNPQVQNPLGGRADSPLESGTRHPQGGKF
SHPQVVKAAHPQSDGANLPKSGKANQPQ.
In the DNA and protein sequences above, the suPAR Domain III/R24 epitope tag is underlined and located at DNA position 1-286. The Enterokinase cleavage site is in lowercase and located at DNA position: 293-307. The hGPIHBP1 sequence is double underline and located at DNA position 308-655 and amino acid position Q21-G151. A silent mutation is in lowercase-double underline and located at DNA position 383-385. The mGPIHBP1 C-terminus/11A12 epitope tag is in italics and located at DNA position 656-844.
The advantage of having a uPAR tag in the expression vector (underlined region at DNA position 1-286 above), is that it allows the purification of human GPIHBP1 from the culture medium of insect cells on an antibody R24 column.
For the assay, medium from the host cells (comprising the recombinantly produced GPIHBP1) was used, and the GPIHBP1 was captured onto the wells of a 96-well plate with a monoclonal antibody (i.e. antibody R24), but one could also perform the assay by immunopurifying the UPAR-GPIHBP1 fusion protein on an immunoaffinity column, and then using the purified fusion protein to coat plates.
The UPAR tag can easily be cleaved and then the GPIHBP1 can be purified and used for coating the plates. Furthermore, one could also perform the assay by transfecting other host cells, such as mammalian cells, with an expression vector for a soluble form of human GPIHBP1, and then use a monoclonal antibody to capture the GPIHBP1.
Once the GPIHBP1 is immobilized on the plate, diluted human plasma is added. The plate is then washed, and anti-human IgG labeled with HRP is used to detect the presence of autoantibodies in the plasma sample.
In some embodiments, the assay further comprises the steps of testing for the inhibition of GPIHBP1-LPL binding by autoantibodies present in the human plasma. For this purpose, the GPIHBP1 is captured onto 96 well plates. The capture of the GPIHBP1 can be done as described above by coating the plate with the R24 antibody and adding the medium from the insect cells to capture the GPIHBP1. The plasma sample is then added. Next, a V5-tagged human LPL is added. The binding of human LPL to the immobilized GPIHBP1 is then accessed with a V5 antibody, and the amount of LPL bound to the immobilized human GPIHBP1 in the presence of the plasma sample versus the absence of the plasma sample is measured with an HRP-labeled V5 antibody. This assay is able to detect the ability of GPIHBP1 autoantibodies in a plasma to block the ability of the immobilized GPIHBP1 to bind LPL.
Glycosylphosphatidylinositol-anchored high-density lipoprotein binding protein 1 (GPIHBP1), a protein of capillary endothelial cells, binds lipoprotein lipase (LPL) and shuttles it to its site of action in the capillary lumen. A deficiency of GPIHBP1 prevents LPL from reaching the capillary lumen. Patients with GPIHBP1 deficiency have low levels of LPL in the plasma, impaired intravascular triglyceride hydrolysis, and severe hypertriglyceridemia (chylomicronemia). While characterizing a monoclonal antibody-based immunoassay for GPIHBP1, the inventors encountered two plasma samples, both from patients with chylomicronemia, that contained an interfering substance, making it impossible to measure GPIHBP1. That finding raised the possibility that those samples might contain GPIHBP1 autoantibodies.
A. Summary
Using a combination of immunoassays, western blots, and immunocytochemistry studies, the inventors tested the two plasma samples (as well as samples from other patients with chylomicronemia) for GPIHBP1 autoantibodies. The inventors also tested the ability of GPIHBP1 autoantibodies to block LPL binding to GPIHBP1.
GPIHBP1 autoantibodies were identified in six patients with chylomicronemia. These autoantibodies blocked LPL binding to GPIHBP1. Like patients with GPIHBP1 deficiency, those with GPIHBP1 autoantibodies had low levels of LPL in the plasma. Three of the six patients had systemic lupus erythematosus (SLE). One patient with SLE and GPIHBP1 autoantibodies delivered a baby whose plasma contained maternal GPIHBP1 autoantibodies; the infant had severe but transient chylomicronemia. Two chylomicronemia patients with GPIHBP1 autoantibodies responded to treatment with immunosuppressive agents.
GPIHBP1 autoantibodies block the ability of GPIHBP1 to bind and transport LPL, thereby interfering with LPL-mediated processing of triglyceride-rich lipoproteins and causing severe hypertriglyceridemia.
B. Introduction
Glycosylphosphatidylinositol-anchored high-density lipoprotein binding protein 1 (GPIHBP1), a protein in the lymphocyte antigen 6 (Ly6) superfamily that is expressed on the surface of capillary endothelial cells, binds lipoprotein lipase (LPL) in the interstitial spaces (where LPL is secreted by myocytes and adipocytes) and shuttles it to its site of action in the capillary lumen. In the setting of GPIHBP1 deficiency, LPL is mislocalized in the interstitial spaces and never reaches the capillary lumen, preventing the lipolytic processing of triglyceride-rich lipoproteins and causing severe hypertriglyceridemia (chylomicronemia). Many GPIHBP1 missense mutations causing chylomicronemia have been identified. All of these mutations disrupt the folding of GPIHBP1's Ly6 domain (the domain that binds LPL with high affinity) and block the ability of GPIHBP1 to bind LPL and transport it to the capillary lumen. A “signature” of GPIHBP1 deficiency in humans is low levels of LPL in the pre- and post-heparin plasma (reflecting a virtual absence of LPL inside capillaries). The inventors used monoclonal antibodies against human GPIHBP1 to create an enzyme-linked immunosorbent assay (ELISA) that can detect GPIHBP1 in human plasma.
The inventors encountered two plasma samples, both from patients with chylomicronemia, that contained an interfering substance, rendering it impossible to measure GPIHBP1 in those samples—or even to detect recombinant GPIHBP1 that had been spiked into those samples. The inventors hypothesized that the ELISA interference might be caused by GPIHBP1 autoantibodies. It was further hypothesized that these autoantibodies would abolish binding of LPL to GPIHBP1 and thereby cause chylomicronemia.
In this example, the inventors report the discovery of six patients with chylomicronemia who had high-titer specific GPIHBP1 autoantibodies, and the inventors show that these antibodies block the binding of LPL to GPIHBP1.
C. Methods
1. Study Patients
The initial study cohort, selected to assist in the development of the ELISA for GPIHBP1, included 23 patients known to have mutations in GPIHBP1 or LPL, 8 hypertriglyceridemic patients without mutations in GPIHBP1 or LPL, and 9 controls. After identification of two patients with GPIHBP1 autoantibodies (one with systemic lupus erythematosus [SLE], both with hypertriglyceridemia) in this initial cohort of 40 patients, the inventors then screened another 162 patients, seeking additional cases with such autoantibodies. These included 40 patients with SLE from the UCLA rheumatology clinic (half on immunosuppressive therapy), and 122 patients from lipid clinics (all with hypertriglyceridemia of unknown etiology).
All plasma samples from study patients (202 total) were either archived specimens obtained under institutional approval or samples sent from other investigators to the last author without identifiers and were therefore deemed by ULCA's Office of Human Use Protection to be exempt from institutional review board approval. Patient numbers throughout this report are the sample numbers recorded for specimen identification by the laboratory of the last author.
2. Enzyme-Linked Immunosorbent Assays (ELISAs)
A monoclonal antibody-based sandwich ELISA similar to those used to measure LPL and apolipoprotein B levels was developed to measure GPIHBP1 levels on plasma samples from study patients. 96-well ELISA plates were coated with the GPIHBP1-specific monoclonal antibody RF4. After adding plasma samples or standards, bound GPIHBP1 was detected with horseradish peroxidase (HRP)-labeled GPIHBP1-specific monoclonal antibody RE3.
To detect GPIHBP1 autoantibodies in plasma, 96-well plates were coated with human GPIHBP1 or GPIHBP1 containing an amino-terminal urokinase-type plasminogen activator receptor (uPAR) tag. After blocking with bovine serum albumin (BSA), plasma samples were added. After washing the plates, antibody binding to GPIHBP1 was detected with HRP-labeled goat anti-human Ig(G+M). The amount of GPIHBP1 autoantibodies (in arbitrary units) was judged by comparing ELISA signals to those in a parallel ELISA in which plates were coated with known amounts of human IgG. ELISAs were also used to test for autoantibodies against three other Ly6 proteins (CD177, C4.4A, and CD59).
To test the ability of GPIHBP1 autoantibodies to block LPL binding to GPIHBP1, 96-well plates coated with GPIHBP1 were incubated with dilutions of plasma samples overnight at 4° C. Plates were then incubated for 1 h at 4° C. with V5-tagged human LPL (200 ng/well). After washing, an HRP-V5 antibody was added to quantify bound LPL. In parallel, an HRP-labeled goat anti-human Ig(G+M) was added to document autoantibody binding to GPIHBP1. The presence of GPIHBP1 on the plates was verified with the HRP-labeled monoclonal antibody 11A12. As a control, the inventors tested the ability of the monoclonal antibody RE3 to block binding of LPL to GPIHBP1. Details regarding ELISAs are in other methods of this example.
3. Western Blot Assay of LPL-GPIHBP1 Binding
Cells expressing S-protein-tagged GPIHBP1 were incubated with V5-tagged human LPL. After washing and lysis, cell extracts were size-fractionated by SDS-PAGE, and the amount of LPL bound to cells was determined by western blot with a V5 antibody. To determine if GPIHBP1 autoantibodies blocked binding of LPL to GPIHBP1, the same assay was performed except that transfected cells were preincubated with plasma samples containing GPIHBP1 autoantibodies.
4. Immunocytochemistry
To visualize binding of GPIHBP1 autoantibodies, Chinese hamster ovary (CHO) cells expressing S-protein-tagged GPIHBP1 were incubated for 2 h at 4° C. with human plasma samples. After washing, cells were incubated with Alexa Fluor 488-conjugated goat anti-human Ig(G+M) for 1 h at 4° C. and then fixed with paraformaldehyde. GPIHBP1 expression was assessed with the monoclonal antibody RG3 or with an antibody against the S-protein tag.
To test the ability of the GPIHBP1 autoantibodies to block LPL binding, S-protein-tagged GPIHBP1-transfected cells were incubated for 1 h at 4° C. with human plasma samples. After washing, the cells were incubated for 1 h at 4° C. with V5-tagged human LPL. After washing the cells and fixation with methanol, cells were stained with an Alexa Fluor 488-conjugated goat anti-human Ig(G+M); a rabbit antibody against the S-protein tag followed by an Alexa Fluor 647-conjugated donkey anti-rabbit IgG; and an Alexa Fluor 555-conjugated mouse anti-V5 antibody
5. V5-Tagged Human LPL
A stable CHO cell line expressing V5-tagged human LPL was adapted for growth in 95% serum-free/protein-free medium (ProCHO-AT, Lonza). Conditioned medium was concentrated 10-fold with Amicon Ultra 30 k MWCO filters (Millipore). The amount of LPL in conditioned medium was determined by western blotting against an LPL standard with an anti-V5 antibody (ThermoFisher Scientific).
6. A Sandwich ELISA to Measure LPL and GPIHBP1 Levels in Human Plasma
LPL levels were determined with a sandwich immunoassay at Immuno-Biological Laboratories, Fukojioka, Japan, and a GPIHBP1 sandwich ELISA was recently developed. For the GPIHBP1 ELISA, 96-well plates were coated with mAb RF4 (against GPIHBP1's acidic domain; 1 μg/well), and blocked in PBS containing 1% BSA and 0.05% NaN3 before incubating with serial dilutions of the plasma samples or rhGPIHBP1 standards overnight at 4° C. After washing, the amount of captured GPIHBP1 was measured by incubating for 30 min at 4° C. with HRP-labeled mAb RE3 Fab′ (against GPIHBP1's Ly6 domain; 0.5 μg/well). After washing, the plate was incubated with TMB substrate (Kem-en-Tec) for 30 min at room temperature. The reaction was stopped with 2 M sulfuric acid, and the optical density (OD) was read at 450 nm.
7. ELISAs to Detect GPIHBP1 Autoantibodies in Human Plasma
ELISA plates were coated with mAb R24 (0.5 μg/well) overnight at 4° C. Plates were washed and then blocked for 4 h at room temperature in Starting block buffer (Pierce). R24-tagged rhGPIHBP1 from the conditioned medium of stably transfected Drosophila S2 cells was added (0.5 μg/well) and incubated for 2 h at 4° C. After washing, plates were incubated in the presence of plasma samples (triplicates, 1:500 in blocking buffer) overnight at 4° C. After washing, plates were incubated for 30 min at room temperature with an HRP-labeled goat anti-human Ig(G+M) (Jackson ImmunoResearch, 1:50,000 in blocking buffer), and the GPIHBP1 autoantibody titer for each sample was determined against a human IgG standard curve. After washing plates extensively, 50 μl of ultra TMB ELISA substrate (Pierce) was added per well. The plate was incubated at room temperature for 5 min before stopping the reaction with 50 μl of 2 M sulfuric acid. The OD was immediately read at 450 nm on a Spectra Max 190 plate reader (Molecular Devices).
8. A Second ELISA to Detect GPIHBP1 Autoantibodies in Human Plasma
ELISA plates were directly coated (0.5 μg/well) with purified rhGPIHBP1, rhCD177, rhC4.4A, or rhCD59 overnight at 4° C. Plates were washed and then blocked for 4 h at room temperature in Starting block buffer (Pierce). After washing, plates were incubated in the presence of plasma samples (triplicates; 1:500 in blocking buffer for plasma 38, 101, 103, 111, 157, and 164 (1:12,500 for plasma 102) overnight at 4° C. After washing, the plate was incubated for 30 min at room temperature with an HRP-labeled goat anti-human Ig(G+M) (Jackson ImmunoResearch, 1:50,000 in blocking buffer). The GPIHBP1 autoantibody titer for each sample was judged against a human IgG standard (in which different amounts of human IgG were coated directly on the plate). In this way, the inventors obtained a measurement of titers of GPIHBP1 in arbitrary units. Plates were washed extensively, and 50 μl of ultra TMB ELISA substrate (Pierce) was added per well. The plate was incubated at room temperature for 5 min before stopping the reaction with 50 μl of 2 M sulfuric acid; the OD was read at 450 nm.
9. An ELISA to Assess the Ability of the GPIHBP1 Autoantibodies to Block LPL Binding
Briefly, ELISA plates were coated with mAb R24 (0.5 μg/well) and blocked in Starting block buffer (Pierce). Next, rhGPIHBP1 was added (0.5 μg/well) in the presence or absence of serial 1:2 dilutions of plasma samples (or dilutions of mAb RE3) and incubated overnight at 4° C. The next day, the plate was incubated for 1 h at 4° C. with V5-tagged human LPL (200 ng/well). After washing, LPL bound to GPIHBP1 was detected by incubating for 1 h at 4° C. with an HRP-V5 antibody (ThermoFisher Scientific, 1:5,000). Autoantibodies bound to GPIHBP1 were detected by incubating duplicate wells with an HRP-labeled goat anti-human Ig(G+M) (Jackson ImmunoResearch, 1:50,000). In a control experiment, the ability of mAb RE3 to block the binding of LPL to GPIHBP1 was tested. After washing, each well was incubated with TMB substrate (Pierce). After 5 min, the reaction was stopped with 2 M sulfuric acid; the OD was read at 450 nm.
10. A Cell-Based LPL-GPIHBP1 Binding Assay
Expression vectors for S-protein-tagged wild-type (wt) GPIHBP1, GPIHBP1-G175R, and GPIHBP1-W109S (or the empty vector) were transfected into CHO pgsA-745 cells or human umbilical vein endothelial cells (HUVEC). After 1 day, the cells were washed three times in PBS and incubated for 1 h at 4° C. with V5-tagged human LPL (900 ng/well). Then the cells were washed six times in PBS, and cell lysates were collected in RIPA buffer (Sigma) containing a protease inhibitor cocktail (Roche). Proteins were separated by SDS-PAGE, and western blots were performed under reducing conditions with a goat antibody against the S-protein tag (Abcam, 5 μg/ml), followed by an IRdye680-donkey anti-goat IgG (LI-COR, 1:2000) and an IRdye800-V5 antibody (1:500).
When testing the ability of GPIHBP1 autoantibodies to block LPL binding to GPIHBP1 on GPIHBP1-expressing CHO pgsA-745 cells, the cells were pre-incubated for 1 h at 4° C. with plasma sample 3 (negative for GPIHBP1 autoantibodies; 1:20 dilution in PBS), plasma sample 38 (positive for GPIHBP1 autoantibodies; 1:20 in PBS), or mAb RG3 (20 μg/ml) before adding the LPL.
11. Immunocytochemistry Studies to Test the Ability of GPIHBP1 Autoantibodies in Plasma 38 to Bind to GPIHBP1
CHO pgsA-745 cells were transfected with expression vectors for S-protein-tagged versions of wild-type human GPIHBP1 or human CD59. The next day, cells were washed three times with PBS. The cells were first blocked in 10% goat serum for 1 h at 4° C. and then incubated for 2 h at 4° C. with plasma 38 (diluted 1:20 in PBS). Cells were washed six times in 3% goat serum and incubated for 1 h at 4° C. with Alexa488-conjugated goat anti-human Ig(G+M) (Jackson ImmunoResearch, 2.5 μg/ml). After washing, cells were fixed in 3% PFA, and immunocytochemistry studies were performed on nonpermeabilized cells with a rabbit antibody against the S-protein tag (Abcam, 0.4 μg/ml, 1-h incubation at room temperature), an Alexa568-conjugated donkey anti-rabbit IgG (ThermoFisher Scientific, 2.5 μg/ml, 30-min incubation at room temperature), mAb RG3 (5 μg/ml, 1-h incubation at room temperature), and an Alexa647-conjugated donkey anti-mouse IgG (ThermoFisher Scientific, 2.5 μg/ml, 30-min incubation at room temperature). Coverslips were then mounted on slides with Prolong antifade plus DAPI (ThermoFisher Scientific).
In another experiment, the ability of the GPIHBP1 autoantibodies in plasma 38 was compared to the ability of mAb RF4 to bind to GPIHBP1 on GPIHBP1-transfected cells. Briefly, the cells were incubated for 2 h with plasma 38 (diluted 1:100 in PBS) at 4° C. Next, the cells were fixed in 3% PFA. After washing, the cells were blocked in 10% normal goat serum for 1 h at room temperature, and immunocytochemistry studies were performed on nonpermeabilized cells with an Alexa488-conjugated goat anti-human Ig(G+M) (Jackson ImmunoResearch, 2.5 μg/ml, 30-min incubation at room temperature), a rabbit antibody against the S-protein tag (Abcam, 0.4 μg/ml, 1-h incubation at room temperature), an Alexa568-conjugated donkey anti-rabbit IgG (ThermoFisher Scientific, 2.5 μg/ml, 30-min incubation at room temperature), mAb RF4 (5 μg/ml, 1-h incubation at room temperature), and an Alexa647-conjugated donkey anti-mouse IgG (ThermoFisher Scientific, 2.5 μg/ml, 30-min incubation at room temperature). Coverslips were then mounted on slides with Prolong antifade plus DAPI (ThermoFisher Scientific).
All images were recorded with an Axiovert 200M microscope and processed with the Zen 2010 software (Zeiss).
12. Immnunocytochemistry Studies to Test the Ability of the Autoantibodies to Block LPL Binding to GPIHBP1
Expression vectors for S-protein-tagged human wild-type (wt) GPIHBP1 or GPIHBP1-W109S were transfected into CHO pgsA-745 cells. After 24 h, the cells were washed three times in PBS. The transfected cells were then incubated for 1 h at 4° C. with the human plasma samples (20 AU of GPIHBP1 autoantibodies/ml in PBS). Cells were washed three times in PBS and incubated for 1 h at 4° C. with V5-tagged human LPL (200 ng/well). Cells were then washed six times in PBS and fixed in chilled 100% methanol. The immunocytochemistry studies were performed on nonpermeabilized cells with an Alexa488-conjugated goat anti-human Ig(G+M) (50 ng/ml, 30-min incubation at room temperature), a rabbit antibody against the S-protein tag (0.2 μg/ml, 1-h incubation at room temperature), an Alexa647-conjugated donkey anti-rabbit IgG (ThermoFisher Scientific, 2.5 μg/ml, 30-min incubation at room temperature), and an Alexa555-conjugated mouse anti-V5 antibody (1:50, overnight at 4° C.). Coverslips were then mounted on Prolong antifade plus DAPI. Images were recorded with an Axiovert 200M microscope and processed with the Zen 2010 software (Zeiss). Within each experiment, the exposure conditions for each construct and each plasma sample were identical. 13. Recombinant Human GPIHBP1
A secreted version of recombinant wild-type human GPIHBP1 (rhGPIHBP1) with an amino-terminal uPAR tag (detectable by mAb R24) and a carboxyl-terminal 11A12 epitope tag was expressed in Drosophila S2 cells. The culture medium was filter-concentrated 20-fold with Amicon Ultra 10 k MWCO filters (Millipore). The amount of
GPIHBP1 in the conditioned medium was determined by western blotting with mAb 11A12 and a purified GPIHBP1 standard. In some cases, rhGPIHBP1 was purified on a mAb R24 immunoaffinity column. Recombinant human Ly6 proteins (C4.4A, CD177 and CD59) with a uPAR tag were expressed in Drosophila S2 cells as previously described. The Drosophila cell line expressing uPAR-tagged CD177 was provided by Dr. H. Gardsvoll (Finsen Laboratory, Denmark).
14. Detecting GPIHBP1 Autoantibodies with Western Blots
The medium from rhGPIHBP1-expressing Drosophila S2 cells was size-fractioned on 12% Bis-Tris SDS-polyacrylamide gels and then transferred to a nitrocellulose membrane. After blocking in Odyssey blocking buffer (LI-COR), membranes were incubated with plasma samples (diluted to 20 AU of GPIHBP1 autoantibody/ml in blocking buffer), and the binding of autoantibodies to GPIHBP1 was detected with an IRdye680-goat anti-human IgG (1:200). rhGPIHBP1 was also detected with an IRdye800-RF4 (1:500).
15. Releasing GPIHBP1 from Cells with Phosphatidylinositol-Specific Phospholipase C (PIPLC)
Expression vectors for S-protein-tagged wild-type (wt) GPIHBP1, GPIHBP1-G175R, and GPIHBP1-W109S were transfected into both CHO pgsA-745 cells and HUVECs. The next day, cells were washed three times in PBS and then incubated for 15 min with PIPLC (10 U/ml) at 37° C. The culture medium and cell lysates were collected, and proteins were separated by SDS-PAGE under reducing or nonreducing conditions. Western blots were performed on culture medium and cell lysates with a goat anti-S-protein antibody (5 μg/ml) followed by an IRdye800-donkey anti-goat IgG (1:800). Actin was used as a loading control.
D. Results
1. ELISA Interference and GPIHBP1 Autoantibodies
Using the sandwich ELISA, GPIHBP1 levels in normal control plasma samples were 239-1110 pg/ml, while they were quite low in two patients with a homozygous C89X GPIHBP1 mutation (patients 11 and 15; 3 and 6 pg/ml, respectively) and in a patient with a homozygous GPIHBP1 deletion (patient 3; 36 pg/ml) (Table 1).
Shown in table 1 are plasma triglyceride levels, GPIHBP1 autoantibody levels, plasma GPIHBP1 levels, and pre-heparin LPL levels in plasma samples containing GPIHBP1 autoantibodies (38, 101, 102, 103, 111, 157, and 164). GPIHBP1- and LPL-deficient patients were included for reference. The pre-heparin LPL plasma levels in normal control subjects and GPIHBP1-deficient subjects were 80.5±20.5 ng/ml (n=9) and 11.5±3.7 (n=10), respectively. The pre-heparin LPL plasma levels in patients with GPIHBP1 autoantibodies ranged from 5.8 to 32.1 ng/ml. The plasma GPIHBP1 levels in normal control subjects ranged from 239 to 1110 pg/ml (n=9). In subjects who were homozygous for GPIHBP1 mutations, the GPIHBP1 levels ranged from 3 to 36 pg/ml (n=11).
To validate the ELISA, the inventors spiked recombinant GPIHBP1 into 40 plasma samples. In 38 samples, the recovery of spiked GPIHBP1 was 98.8±3.8%. However, in samples from two patients with chylomicronemia and low plasma GPIHBP1 levels (patients 38 and 101; GPIHBP1 levels of 85 and 29 pg/ml, respectively), the recovery of spiked GPIHBP1 was extremely low (6.8 and 4.4%, respectively) (
The inventors suspected that the ELISA interference in samples 38 and 101 was caused by GPIHBP1 autoantibodies. Indeed, GPIHBP1 autoantibodies were detectable by western blotting (
2. Additional Plasma Samples with GPIHBP1 Autoantibodies
The inventors used an ELISA to screen for GPIHBP1 autoantibodies in 130 plasma samples from patients with unexplained hypertriglyceridemia, several of whom had SLE or Sjögren's syndrome (
All of the patients who were positive for GPIHBP1 antibodies had severe hypertriglyceridemia complicated by pancreatitis; clinical and laboratory details are provided in Tables 1 and 2. The hyperlipidemia in patient 157, a 26-year-old female with SLE, resolved with immunosuppressive drugs. When patient 164, a 9-year-old female with Sjögren's syndrome, was treated with immunosuppressive drugs, the plasma triglyceride levels normalized and GPIHBP1 autoantibodies were no longer detectable in the plasma. Patient 102, a 38-year-old female with SLE, delivered a baby girl; blood samples from the baby (patient 103) on the first day of life had maternal GPIHBP1 autoantibodies and triglyceride levels of 9,090 mg/dl. By one year of age, the plasma triglyceride levels normalized (72 mg/dl).
Western blots revealed GPIHBP1 autoantibodies in plasma samples 102, 111, 157, and 164 (
3. GPIHBP1 Autoantibodies and Binding of LPL to GPIHBP1
For GPIHBP1 autoantibodies to cause hypertriglyceridemia, they would need to block LPL binding to GPIHBP1. To explore that possibility, the inventors tested the ability of one GPIHBP1 autoantibody plasma (38) and a control plasma (3) to block the binding of V5-tagged human LPL to GPIHBP1-expressing CHO cells. Only plasma 38 blocked LPL binding, as judged by western blots of cell extracts (
The inventors used ELISAs to assess the ability of GPIHBP1 autoantibodies to block LPL binding to GPIHBP1 and simultaneously determined autoantibody titers (
4. Levels of LPL in Plasma Samples with GPIHBP1 Autoantibodies
The levels of LPL in the pre-heparin plasma of normal individuals are 50-77 ng/ml. The inventors measured pre-heparin LPL plasma levels in patients homozygous for missense or nonsense mutations in GPIHBP1 and found them to be low in most cases (ranging from 7.3 to 70.6 ng/ml) (Table 1). These findings are similar to those in earlier studies and are consistent with impaired transport of LPL to the capillary lumen. One would predict that plasma LPL levels in GPIHBP1 autoantibody patients would also be low if the GPIHBP1 autoantibodies truly caused the chylomicronemia (i.e., if the autoantibodies blocked LPL binding and transport). Indeed, the LPL levels in autoantibody plasma samples were low (ranging from 4.6 to 32.1 ng/ml) (Table 1), consistent with impaired delivery of LPL to the capillary lumen.
E. Supplementary Results
This section includes additional descriptions of patients with GPIHBP1 autoantibodies.
Patient 38, now deceased, was described previously. Briefly, this 26-year-old French male of Algerian origin with a history of abdominal pain since age 16, was referred for severe hypertriglyceridemia (2,301 mg/dl) and acute pancreatitis. Hypertriglyceridemia (885-5,752 mg/dl) and recurrent pancreatitis persisted despite a low-fat diet, fibrate therapy, and n−3 fatty acid supplements. The post-heparin LPL activity levels in plasma were extremely low. He had no disease-causing mutations in LPL, APOC2, APOA5, or LMF1. Ultimately, he developed insulin-dependent diabetes and exocrine pancreatic insufficiency with fat malabsorption. He died in Algeria at age 39 after multiple episodes of ketoacidosis and malnutrition in the context of psychiatric disorders. Patient 38 was homozygous for a G175R missense mutation in GPIHBP1. The G175R substitution was unique when it was reported but since has been observed many times in exome sequencing studies (rs145844329). This substitution introduces a positively charged amino acid into GPIHBP1's carboxyl-terminal hydrophobic domain. Initially, this substitution was assumed to prevent normal GPIHBP1 production by interfering with the addition of the GPI anchor. However, this is not the case, as illustrated by
The mother and daughter of subject 38 were heterozygous for the G175R substitution and were normolipidemic. Both parents were born in the same region of Algeria but there was no history of consanguinity. The mother was diabetic and was taking steroids for rheumatoid arthritis. Patient 38 was never diagnosed with any autoimmune disease and tested negative for antinuclear antibodies.
Patient 101, a 53-year-old female from Japan with an unremarkable family history, had uneventful pregnancies at ages 29 and 31, but at age 34 she was diagnosed with hypertriglyceridemia, early rheumatoid arthritis (positive for anti-CCP antibody, 6 IU/ml; positive for RF, 63 IU/ml), and Sjögren's syndrome (strongly positive for anti-SS-A and anti-SS-B antibodies). At age 40, she had pancreatitis and was diagnosed with Hashimoto disease (anti-TPO antibody, >600 IU/ml, anti-thyroglobulin antibody, >4000 IU/ml; TSH, 10 mIU/L) and SLE (positive for anti-DNA and anti-cardiolipin antibodies). In the last 5 years, her plasma triglyceride levels have ranged from 723 to 4980 mg/dl. Screening for >30 LPL mutations was negative. She currently is treated with levothyroxine (50 m/day), prednisolone (10 mg/day), and salazosulfapyridine (1000 mg/day).
Patient 111, a 20-year-old female from France, presented at age 5 with pancreatitis and unexplained hypertriglyceridemia (6,062 mg/dl). She had 4 episodes of acute pancreatitis between the ages of 5 and 15. Her post-heparin LPL activity level was 3.9 mol/L/min (approximately 10% of normal values). She had no mutations in GPIHBP1, LPL, APOC2, APOA5, or LMF1. She was negative for antinuclear antibodies (ANA), anti-thyroid peroxidase antibodies (TPO), anti-neutrophil cytoplasmic antibodies (ANCA), anti-Sjögren's-syndrome-related antigen A (SSA) antibodies, and anti-Sjögren's syndrome type B (SSB) antibodies. Her hypertriglyceridemia (1500-6500 mg/dl) has been resistant to conventional drug therapies for hypertriglyceridemia (fenofibrate, high doses of n−3 fatty acids) and also resistant to dietary interventions. A trial of mycophenolate mofetil failed to lower the plasma triglyceride levels (Table 2).
aA follow-up plasma sample from patient 101 revealed persistence of both hypertriglyceridemia and GPIHBP1 antibodies. The plasma triglyceride level in the initial sample was 1,696 mg/dl, and the GPIHBP1 autoantibody titer was 70 AU/ml.
bFollow-up plasma samples from patient 111 during mycophenolate mofetil therapy were requested but not received.
cPatient 102 and her baby (patient 103) moved to Southeast Asia. The plasma triglyceride level in patient 103 at 1 year of age was 72 mg/dl.
Table 2 shows autoimmune disease diagnosis, antinuclear antibody (ANA) status, immunosuppressive drug treatment, follow-up plasma triglyceride levels after treatment, and GPIHBP1 autoantibody levels after treatment.
Her mother and sister are normotriglyceridemic. Her father, 46-years-old, was born in Vietnam and has Kimura disease, a chronic inflammatory disorder of unknown etiology associated with lymphadenopathy and subcutaneous masses in the head and neck region. He has had moderate-severe hypertriglyceridemia (200-1000 mg/dl) since age 25. Genetic testing (LPL, APOA5, APOC2, GPIHBP1) was negative.
Patient 157, a 26-year-old female from South Africa has been described previously. She was referred at age 26 (September 2002) for new-onset hypertriglyceridemia and recurrent bouts of pancreatitis. She had a history of SLE. At the time of referral, she was positive for anti-dsDNA antibodies (75.4 μg/ml), and her fasting plasma triglyceride level was 2,407 mg/dl. The lipoprotein electrophoresis pattern suggested chylomicronemia, and there was virtually no LPL activity in the post-heparin plasma. A mixing experiment suggested the possibility of LPL autoantibodies. She was treated with 6 plasma exchanges and subsequently with cyclophosphamide and high-dose steroids, and the triglyceride levels normalized. One year later, she presented with recurrent hypertriglyceridemia and pancreatitis but did not respond to intensified immunosuppression and plasma exchanges. In March 2004, the patient was given rituximab (four weekly doses of 375 mg/m2) along with cyclophosphamide and prednisone. The plasma triglycerides normalized, but the patient developed chronic abdominal pain (presumably related to chronic pancreatitis) and ultimately succumbed to an unrelated illness (Huntington's disease). As shown in
Patient 164, a 9-year-old African-American girl, was previously described. She was initially referred for severe hypertriglyceridemia (4,784 mg/dl) and acute pancreatitis. She had been healthy until 6 weeks earlier, when she experienced abdominal pain and vomiting. She was treated with omega-3 acid ethyl esters, fenofibrate, and a low-fat diet. This regimen had little effect on the hypertriglyceridemia, but her serum triglyceride levels fell below 500 mg/dl on a very low fat diet. There was no family history of hypertriglyceridemia, pancreatitis, or consanguinity, and genetic testing excluded mutations in LPL, GPIHBP1, APOA5, APOC2, or LMF1. The authors of the initial report reported, on the basis of a western blot, that the subject had LPL autoantibodies. Her mother had SLE, and her maternal grandmother had multiple sclerosis. Patient 164 had two episodes of joint swelling (ankle, knee, and wrist) and tested positive for antinuclear and anti-cardiolipin antibodies. She tested weakly positive for Sjögren's syndrome antigen B (SS-B) and rheumatoid factor. She was negative for anti-dsDNA, anti-Smith, anti-ribonucleoprotein, and SS-A antibodies. Patient 164 was diagnosed with Sjögren's syndrome after a salivary gland biopsy revealed infiltration with lymphocytes and immunoblasts. She was placed on immunosuppressive therapy with prednisone (20 mg/day) and mycophenolate mofetil (500 mg twice daily). After increasing the dose of mycophenolate mofetil (750 mg in the morning and 500 mg in the evening) and gradually replacing prednisone with hydroxychloroquine (100 mg/day), the plasma triglyceride levels normalized (Table 2). As shown in
Patient 102, a 38-year-old female native of the Philippines, was referred for severe hypertriglyceridemia. Post-heparin LPL activity levels in the plasma were less than 10% of normal, and a mixing experiment to test for LPL autoantibodies was negative. She had no mutations in LPL or GPIHBP1. She was diagnosed with SLE in 2013. We confirmed a high titer of antinuclear antibodies (ANA) in her plasma (Table 2). In 2015, the patient developed pancreatitis at week 33 of pregnancy and had plasma triglyceride levels of 6,500 mg/dl. She received plasmaphereses and was treated with hydrocortisone, prednisone, and vitamins. The delivery of a baby girl, patient 103, needed to be induced but was otherwise normal. Patient 102 was seen 1 month postpartum and was treated with a low-fat diet, fish oil, and 5 mg/day of prednisone.
Patient 103, the daughter of patient 102, was born with Agpar scores of 9/9 and weighed 1550 g. At birth the blood was lipemic; the plasma triglyceride levels on days 1 and 2 were 9,090 and 5,360 mg/dl, respectively. The blood sample from day 1 was positive for GPIHBP1 autoantibodies and antinuclear antibodies. She was placed on a medium chain triglyceride-rich formula (Enfaport) and was treated with ampicillin and gentamycin for possible sepsis. Her plasma triglyceride levels fell to 401 mg/dl after 10 days and to 114 mg/dl two weeks later. She was discharged on day 24 and weighed 1890 g. At 1 year of age, the plasma triglyceride levels were 72 mg/dl (Table 2).
F. Discussion
The inventors describe the discovery of autoantibodies against GPIHBP1, the protein that shuttles LPL to the capillary lumen, in the plasma of six patients with severe hypertriglyceridemia. This data provide strong support for the conclusion that the GPIHBP1 autoantibodies were the cause of the observed hypertriglyceridemia. First, the autoantibodies blocked the binding of GPIHBP1 to LPL. Second, the plasma levels of LPL were very low in the GPIHBP1 autoantibody patients, consistent with impaired transport of LPL to the capillary lumen. Third, immunosuppressive drug therapy normalized triglyceride levels in patients 157 and 164. Fourth, patient 102 delivered a baby (patient 103) who was born with GPIHBP1 autoantibodies. That infant had plasma triglyceride levels of 9,090 mg/dl on the first day of life, but the hyperlipidemia steadily waned, consistent with a gradual disappearance of maternal IgGs.
GPIHBP1 binds LPL in the interstitial spaces and transports it to the capillary lumen (
Previous studies have reported that chylomicronemia can be caused by autoantibodies against LPL. GPIHBP1 autoantibody patient 157 was suspected to have LPL autoantibodies, but none were found. The initial suspicion of LPL autoantibodies was based on spiking the patient's plasma into the post-heparin plasma of a normal participant and finding reduced amounts of triglyceride hydrolysis. This assay is problematic because of the inherent instability of LPL and competition from plasma lipoproteins. Also, patient 164 was reported to have LPL autoantibodies by western blot, but none were found, and in hindsight the initial western blot was not definitive.
Four of the six GPIHBP1 autoantibody patients with chylomicronemia carried diagnoses of autoimmune diseases (SLE or Sjögren's syndrome). These patients can develop autoantibodies against many proteins, and the data indicates that GPIHBP1 is one of these. Because of transfer of maternal autoantibodies, some infants born to mothers with SLE develop neonatal lupus (characterized by cutaneous lesions and cardiac conduction abnormalities). Based on this data, chylomicronemia is a potential finding in infants born to mothers with SLE. Importantly, two of the six GPIHBP1 autoantibody patients had no evidence of rheumatologic disease. Thus, it is believed that GPIHBP1 autoantibodies should be considered in patients with acquired chylomicronemia whether or not there are findings of autoimmune disease.
GPIHBP1 is one of −25 Ly6 proteins, each characterized by one or more three-fingered Ly6 domain(s) containing 8 or 10 cysteines—all disulfide-bonded. The autoantibodies in the patients bound to properly folded GPIHBP1 monomers with intact disulfide bonds, and the autoantibodies did not cross-react with other Ly6 proteins, including CD59. It is intriguing that other autoantibodies associated with human disease bind to cysteine-rich domains in proteins. For example, autoantibodies against the cysteine-rich region of ADAMTS13 cause thrombotic thrombocytopenic purpura; autoantibodies against a cysteine-rich domain of the TSH receptor have been identified in Graves' disease; and autoantibodies against a cysteine-rich domain of the phospholipase A2 receptor (PLA2R) have been identified in membranous nephropathy.
In these studies, immunoassay interference was the clue that led to the identification of GPIHBP1 autoantibodies. Immunoassay interference from autoantibodies is well known to clinical chemists. For example, autoantibodies against troponin can interfere with troponin assays used to diagnose myocardial infarction, and autoantibodies against TSH, thyroxine, and triiodothyronine can interfere with immunoassays used to diagnose thyroid diseases.
In summary, the inventors identified autoantibodies against GPIHBP1 that block the ability of this protein to bind LPL and transport it from the interstitial space to the capillary lumen. These autoantibodies, identified in six patients, interfered with LPL-mediated processing of triglyceride-rich lipoproteins and caused severe hypertriglyceridemia.
All of the methods disclosed and claimed herein can be made and executed without undue experimentation in light of the present disclosure. While the compositions and methods of this invention have been described in terms of preferred embodiments, it will be apparent to those of skill in the art that variations may be applied to the methods and in the steps or in the sequence of steps of the method described herein without departing from the concept, spirit and scope of the invention. More specifically, it will be apparent that certain agents which are both chemically and physiologically related may be substituted for the agents described herein while the same or similar results would be achieved. All such similar substitutes and modifications apparent to those skilled in the art are deemed to be within the spirit, scope and concept of the invention as defined by the appended claims. All references, scientific publications, and patent publications are specifically incorporated by reference for all purposes.
This application claims benefit to U.S. Provisional Patent Application No. 62/367,881, filed Jul. 28, 2016. The entire contents of the referenced application is incorporated herein by reference.
This invention was made with government support under Grant Nos. R01HL087228 and P01HL090553 awarded by the National Heart, Lung, and Blood Institute (NHLBI), National Institutes of Health (NIH). The government has certain rights in the invention.
Filing Document | Filing Date | Country | Kind |
---|---|---|---|
PCT/IB17/54618 | 7/28/2017 | WO | 00 |
Number | Date | Country | |
---|---|---|---|
62367881 | Jul 2016 | US |