Patent Application
20180313847
Microfluidic arrays using nanoliter (nL) volumes for molecular analysis were first put forth by Kricka (Nucleic Acids Research, 1996, Vol. 24). Today, molecular methods and assays often use compartments to hold nanoliter (nL) volumes for molecular analysis. Compartments are used for current digital droplet PCR methods. For compartment methods based on droplets see (WO 2010/018465 A2, U.S. Pat. No. 8,5358,89 B2). These methods need to minimize the time to read and amplify all droplets for each sample. For the compartment methods based on microwells (WO 2013/158982 A1), the time to read each sample is much quicker and as all compartments are read at the same time by use of a fixed 2D imaging field. However, twenty PCR cycles or more are still needed and therefore add to the time to get the results. Typically only 8 unknown determinations can be made in a 8 hour work shift.
These approaches suffer from a fundamental issue in that they must use a Poisson distribution to adjust for the chances of multiple molecules in a given compartment. This means the number of empty compartments is significant in these approaches (>90%). These approaches are also limited in the number of compartments that can be read, often to 105 or less, due to the time it takes to read, separate, amplify and measure the compartment content. Current approaches only read 10,000 to 20,000 compartment for one gene in a 4 to 8 h time frame and most compartments are empty.
Since these approaches cannot read more than 105 full compartments in a timely manner, they are limited from analysis of multiplex large panels of different molecular assays (multiplex molecular analysis). Therefore, current technology is insufficient for screening large full libraries of genes and proteins in individual compartments (106) that is so needed for many important biotechnology applications. Additionally, these approaches are insensitive to low abundancy rare molecules (0.1%) due to the number of empty compartments that must exist.
Methods for multiplexed molecular analysis of single cells after sorting by flow cytometry are well known in the literature (Gama LPLoS ONE 20138(9):e73849). It is also well known that single cells can be added to compartments, arrayed and cultured (US2005/007005, WO2005/010169). Encapsulation of cells in droplets was proposed by Thomas Chang in 1964 who introduced the term “artificial cells”. Since then many biomaterials are added to the encapsulated cells, to affect biocompatibility, permeability, mechanical strength and durability. The cells can be lysed and contents maintained inside the droplet (Chiu DT, Anal. Chem., 2005, 77 (6), 1539-154). Encapsulated cells have been used in many therapeutic and non-therapeutic applications. However multiple gene analysis (multiplexing) is still needed for working with nL compartments.
It is well known that individual nucleic acids can be bound to separate particles through a matching capture oligo (U.S. Pat. No. 5,591,580) and that particles can be isolated into separate compartments for individual assay result (WO2005/010169). Recently others have combined the cell encapsulation approach and oligo capture particles, with lysis of cell contents in the droplet and reverse transcriptase of messenger RNA to a cDNA including a unique nucleic acid sequence that can be used to identify that a certain gene was captured (US2011/0244455A1, Cell 161, 1202-1214, May 21, 2015). This approach is commonly used for genetic analysis and is called “bar coding”. Each droplet ends up with one gene being bar coded. Since each amplified product is bar coded, instead of reading each compartment, all compartments are broken, combined, and measured by sequencing. However, the problem of long times to result are not decreased as the genes still need to be prepared to be read by the sequencing methods which can take days. Also, droplet generation is still limited to <20,000 droplets and cannot avoid contamination or generation of empty droplets without cells that can lead to particles capturing non-cellular genes.
The use of microfluidics to spatially place 2 D arrays of droplets typically rely on flowing droplets through sealed capillary area and capturing droplets in an area (Pompano Annu. Rev. Anal. Chem. 2011. 4:59-81). A key issue with this method is that the individual droplets are not easily accessed for analysis, often the materials are lost when the capillaries are unsealed or complex routing capillaries are needed to extract material.
Spatial placement of droplet compartments or cells onto a surface in a 2 D array for multiplex analysis is well known since 1996 (U.S. Pat. No. 5,518,176 and U.S. Pat. No. 5,776,748). Piezo electric generation of small droplets allows printing onto a surface. The key issue with these approaches is that evaporation of droplets occurs during surface movements needed across surfaces (U.S. Pat. No. 5,518,176). Cell adhesion to a surface is also used to place cells onto surface patterns (U.S. Pat. No. 5,776,748). The key issue with these approaches is that binding is required. Additionally, sealed capillaries are also used to flow liquid droplets or cells into capture areas (Pompano, Annu Rev Anal Chem 2011. 4:59-81). The key issue with this approach is that the individual compartments or cells are not easily accessed for analysis, materials are often lost damaged by contact with capillaries or complex routing capillaries are needed, and extraction of materials requires opening accesses to capture areas. Alternatively, printing or depositing the cells onto the plane (WO1997/045730) is used. The key issue with this approach is that cells must be manipulated singly and placed with a moving arm or surface into defined places. This can be damaging or time consuming process which still requires to know the cell types to be placed.
Size exclusion filtration onto a porous matrix has been used to place cells in a 2D plane for many years (Seal S H, Cancer 1964 17, 637-42, WO2005/047529). The pore diameters of the porous matrix size are kept small enough (eg. 8 μm) to retain larger sized cells (eg. 20 μm). Nanoparticles can be retained on a membrane by size exclusion. This result was first shown Brechold with nitrocellulose (Z. Physik Chem 1907, 257). The average pore size of the membranes is 1 to 100 nm, or in the ultrafiltration range (P.K. Tewari Nanocomposite Membrane Technology: Fundamentals and Applications). Membrane filtration has the benefit of washing away unbound material. While these method are a convenient and fast approach for placement onto a plane, these methods randomly organize the cells or particles on the surface and therefore cells and particles cannot be assayed or removed from their fixed position.
Others have shown that the cells can be spatially organized into well as grids (Zheng S, J Chromatogr 2007; A1162:154-161 and U.S. Pat. No. 8,815,092). Here the slot pores on a top membrane are large enough to allow cells to enter a gap between the top and bottom membrane, where the pores on a bottom membrane are small enough to retain cells. This maintains the added benefit of washing away unbound material. However, the cells are not placed into a individual compartment and liquid can exchange between cells.
The use of micron size wells with solid bottoms as compartment to separate cells is also well known (U.S. Pat. No. 5,776,748) but are not able to wash cells. The use of micron size wells which lack a bottom are known but unable to perform size exclusion of different particles size (US 2012/0107925, US2013/0122539). The use of a porous matrix with smaller pores placed in the bottom of a well is the well known “transmembrane” cell culture device (U.S. Pat. No. 540,743). Other approaches have used this approach and retain the cells by occlusion of any pores and stop the flow into or out of the microwell (Terstappen Lab on a chip 2015 and US2015/0160135). After filtration, a needle can be used to punch the cells out of the clogged well. However, the approach is unable to perform size exclusion of different particle size or release material from the well pore.
Since current approaches do not produce results in a high percentage of 50% or more of the 105 compartments, they are limited from analysis by multiplex large panels of different molecular assays. Therefore, current technology is insufficient for screening large full libraries of genes and proteins in individual compartments (103 to 107) that is so needed for many important biotechnology applications. There remains a long felt need for methods for multiplexed molecular analysis of nanoliter (nL) volumes, which allow rapid analyte analysis and isolation.
The instant invention has the advantages of high speed to sorting high density arrays for highest affinity binding and analyte identity and allow removal of analyte through the filter for additional use.
The key features of this invention include the following steps. Binding an analyte with affinity nanoparticle with releasable mass label and non-releasable fluorescent label. Collection of analyte with affinity nanoparticle by size exclusion filtration into a fixed compartment area. Identification of the position of the compartment area by the fluorescence of the bound nanoparticle affinity. Measurement of analyte at position by release of mass label from the fixed compartment area.
This invention works with analyte which can be retained by using exclusion filtration. For example: (1) analyte contained on or inside cells, (2) analyte contained on or inside droplets, (3) analyte that are macromolecules larger than affinity nanoparticle or, (4) which can be captured on to a particle which are affinity nanoparticles. The invention allows electrospray release of analyte from the fixed compartment area for collection and mass spectroscopic analysis. The measure of analyte by mass label can serve as a bar code to identify the presence of unique analytes or as a signal to quantitate the amount of analyte.
The drawings provided herein are not to scale and are provided for the purpose of facilitating the understanding of certain examples in accordance with the invention described herein and are provided by way of illustration and not limitation on the scope of the appended claims.
Methods, apparatus and kits in accordance with the invention described herein have application in any situation where detection or isolation of rare molecules and cells is needed. Examples of such applications include, by way of illustration and not limitation, diagnostics, biological reactions, chemical reactions, high through-put screening, cloning, clone generation, artifical cells, regenerative cells, compound libraries, cell library screening, cell culturing, protein engineering and other applications.
Some examples in accordance with the invention described herein are directed to methods of molecular analysis. Other examples in accordance with the invention described herein are directed to methods of isolation, characterization and detection of cells, particles, macromolecules, genes, proteins, biochemicals, organic molecules or other compounds. While other examples use droplet sorting for detection of rare cells and cell free molecules. Other examples in accordance with the invention described herein are directed to methods of selective detection of genes, proteins, cells and biomarkers.
Other examples in accordance with the invention described herein are directed to methods of binding and separation of cells and cellular biological content whereby cells are isolated on a porous matrix and bound materials retained for analysis. In some case the cells are artifical cells, modified cells, natural cells, of any and all types.
Some examples in accordance with the invention described herein are directed to methods of binding and separation of nucleic acid, proteins or other biological molecules on to where particles are isolated on a porous matrix or by magnetic particle and bound materials retained for analysis.
Some examples in accordance with the invention described herein are directed to methods of detecting one or more different populations of nucleic acid, proteins or other biological molecules, rare molecules in a sample suspected of containing the one or more different populations of rare molecules and non-rare molecules. These nucleic acid, proteins or other biological molecules can be used as ligand binding measures of cells, enzymes, proteases, receptors, proteins, nucleic acid, peptidase, proteins, inhibitors and the like by acting on formation or binding of said molecules. These molecules can be formed as metabolites, natural or man-made origin, such as biological, therapeutics, or others.
Examples in accordance with the invention described herein are directed to methods and kits for molecular, protein or biological molecule analysis. Other examples in accordance with the invention described herein are directed to apparatus for analysis.
Common terminology used to describe this invention are “droplet”, “compounds” “in excess”, “rapid”, “emulsion”, “size exclusion filtration”, “ compound library”, and are further defined below.
A “ droplet” is a micro-bubble defined as a compartment to hold nanoliter (nL) volumes of biological fluidics and compounds. The droplet can contain compounds and be considered “full”. The droplet can lack compounds and be considered “empty”. The “compounds” can be cells, particles, macromolecules, genes, proteins, biochemicals, organic molecules, or others. The droplet size can be varied reduce the space allowed for a compound, for example the droplet can be nm to μm in diameter. An “excess” of empty droples to full droplets means a ratio of no greater than 10 full droplets:100 empty droplets such that the ratio of empty to full droplet allows of dilution of sample interference. “Rapid” droplet generation and sorting means at least >102/sec.
A “micro well” is a compartment for nanoliter (nL) volumes of biological fluidics and compounds where a “liquid holding well” is a compartment to microliter (μL) volumes of biological fluidics and compounds.
An “emulsion” is created when the droplet separate two immiscible liquids, namely a generally “aquous phase” held inside the droplet and a generally “oil phase” outside the droplet. Emulsifiers, surfactants, polar, apolar solvents, solutes and the droplets are considered components of an “emulsion”. The stabilization or destabilization of an “emulsion” can lead to continuation of the “emulsion” or separation of aqueous and oil into separate phases without “droplet”.
“Size exclusion filtration” is the use of a porous matrix to separate droplets and the contents from the rest of the emulsion. The contents of the droplets are retained on the porous matrix and are called “retained contents”. “Retained contents” can be cells or particles and associated molecules. Pore diameters of the porous matrix are kept small enough to retain larger sized droplets and their contents. “Size exclusion filtration” allows washing away unbound material or material not in full droplets or associated with retained contents.
A “library of compounds” is a sets of “elements” of a common type including organic molecules, biochemical, genes, particulates, cells, or macromolecules. A “library of compounds” contain any number of unique group members. Generally, the library is a group of compounds of similar size and nature and contains some molecule differences between group members. A library of compounds can be a group “variations of peptides and proteins” or variations of nucleic acids such as sequence differences. The “library of compounds” can be captured onto “capture particles”, macromolecules or cells. The “library of compounds” can be captured through an “affinity agent”. Encapsulation of a compound library in a droplet is typically at least 102 different group members.
The term “variations of peptides and proteins” is a part, piece, fragment or modification of a “polypeptide,” “peptide” and “protein of biological or non-biological origin.
The term “labeled particle” refers to a particle bound to a mass label agent. This particle can additionally be bound to affinity agent or affinity tags.
The term “capture particle” refers to a particle attached to an affinity agent.
The term “affinity agent” refers to a molecule capable of selectively binding to a specific molecule. The affinity agent can direct bind the rare molecule of interest, the mass label or an affinity tag. Affinity agent can be attached to a capture particle or labeled particles or can bind a particle through the affinity for the mass label, rare molecule or affinity tag on labeled particle. The “affinity agent” can be a binding ligand, antigen or substrate for a specific rare molecule.
An example of a method for detection of rare molecules in accordance with the invention described herein is depicted in
In some examples, library of compounds are reacted with with affinity agent, collecting individual elements in a well by size exclusion filtration, identifying of the position of the element by the fluorescence and measurement of element at position by release of mass label from the well. The affinity agent can be a nanoparticle with one or more releasable mass label and non-releasable fluorescent label. The well is micron sized and passes liquid through a porous matrix placed on bottom of well. Additionally the elements can be released from a well. In some examples the compounds are droplets, cell, particles, molecules or clusters of cells whereby droplets contain cell, particles and molecules.
In some examples the individual elements of a compound library are collected into individual microwells and retained on a porous matrix in micro wells. The retained contents in a microwell can be elements such as droplets, cell, particles, molecules or clusters of cells. In some examples, the well size and shape is varied to improve isolation of one droplet, cell, particle or molecule into a well. In other examples, droplets, cell, particles and molecules can be varied from 0.1 to 200 μm to improve separation.
In some examples, mass labels or elements that are released from a well are subjected to mass spectroscopic analysis for measurement. The measurement of mass labels or elements can be used to quantitate the amount of element, to measure actions of element, binding to element, or measurement of the activity of an element. In some examples mass labels are subjected to mass spectroscopic analysis for identification of elements. In other examples, fluorescent labels are not released from the microwell but are subjected to microscopic analysis for identification of positions with an affinity agent.
In still other examples elements are subjected to reaction of their contents. For example, amplification of isolated material, growth of cells, growth of cell cluster, enzymatic reaction, protein synthesis, metabolism and other biochemical reactions. This can increase the copy number of proteins or molecules from artificial cells so they can be directed for detection, characterization and identification. In some examples, reaction products or the elements are released from the well for storage, analysis and other uses.
A droplet is a micro-bubble defined as a compartment to hold nanoliter (nL)) to microliter (μL) volume of biological fluidics and compounds. The compounds can be organic molecules, biochemical, particles, cells, or other macromolecules. The biological fluidics are aqueous or polar solutions that can contain solutes, polymers, surfactants, emulsifiers, macromolecules, other solvents, and particles in addition to the compounds. The droplet can contain compounds and be considered full. The droplet can lack compounds and be considered empty. The droplet size can be varied to reduce the space allowed for a compound, for example the droplet can be varied from 1 to 400 μm diameter that hold nL to μL volumes.
The number of empty droplets compared to the number of full droplets can be large (>97%) with small only (<3%) of droplets created in full. In some examples, the the ratio of full to empty droplets is about 1 to 100, or about 1 to 1000, or about 1 to 10000.
The droplets are made when an emulsion is created causing the separation of two immiscible liquids, aqueous phase” held inside the droplet and a generally an “oil phase” outside the droplet. Aqueous phases can include hydrophilic chemical and biochemicals, water, polar protic solvents, polar aprotic solvent and mixtures thereof. Oil phase can include organic solvents, oils such as vegetable, synthetics, animal products, lipids and other lipophilic chemicals and biochemical. The emulsion can be oil-in-water, water in oil, water in oil in water, and oil in water in oil. Emulsifiers, emulgents, surfactants can be considered components of the emulsion to change the surface energy of the droplet or the hydrophilic/hydrophobic (lipophilic) balance and include anionic, cationic, nonionic and amphoteric surfactants, as well as naturally occurring materials. Emulsion instability can be caused by sedimentation, aggregation, coalescence and phase inversion. The emulsion stability can be impacted by oil polarity, temperature, nature of solids in the droplet, droplet size and pH. These properties can be use to stabilize or destabilize the droplets and contents.
The droplets can be made as a feed stock of compound libraries of cells such as rare cells or cell clusters, libraries of particles such as rare molecules on capture particles and labeled particles or libraries of molecules such as genes, proteins, organics and biologics that are isolated as elemented into liquid droplets (1 μm to 500 μm diameter). The diameter of liquid droplets can be adjusted for size of compound libraries, for example the particle size, cell size, cluster size, cDNA size and the likes. Each additionally contains affinity agent and can include labeled nanoparticles either bound to the rare molecules and/or cells. Additionally, copies of specific cDNA can be reacted with a specific affinity agent and labeled particle and optionally a capture particle and be contained in the droplet. These labeled particles can serve as indentification markers for genes.
Droplets and microwells can serve as compartments for reactions. For example, amplification of isolated material, growth of cells, growth of cell cluster, enzymatic reaction, protein synthesis, metabolism and other biochemical reactions. This can increase the copy number of proteins or molecules from artificial cells so they can be directed for detection, characterization and identification. Additionally, the reactions can replicate genetic material for additional copies or forms, for example reverse transcriptase (RT) reactions to convert RNA to DNA, polymerase chain reactions (PCR), and polymerase (Pol) amplification to make more genetic copies for analysis and convert DNA to cDNA. This can increase the copy number of genetic copies detection, sequencing and archival storage. For example a PCR amplification can be done by adding template to a microwell and allow making 106 product from each copy by heat at 95 C for 5 min, at 94 C for 1 min, at 60 C for 1 min, at 72 C for 1 min for 20 cycles. In another example, cell free RNA and DNA can be converted to stable cDNA by RT amplification for cell RNA to cDNA and Pol amplification for cfDNA to cDNA. Other example includes cDNA amplicon library preparation for sequencing
In accordance with the invention, “variations of peptides and proteins” can be derived from a peptide or protein from biological or non-biological origin. The variations of peptides and proteins can be used to measure diseases. The variations of peptides and proteins can be as the result of disease or intentional reactions. The variations of peptides and proteins can result in proteins and peptides of man-made or natural origin and include bioactive and non-bioactive peptide or protein such as those used in medical devices, therapeutic use, for diagnostic use, used for measurement of processes, and those used as food, in agriculture, in production, as pro or pre biotics, in microorganism or cellular production, as chemicals for processes, for growth, measurement or control of cells, used for food safety and environmental assessment, used in veterinary products, and used in cosmetics. The fragments can be used to measure enzymes and peptidase of interest based on formation of variations of peptides and proteins. The variations of peptides and proteins can be used to measure natural or synthetic inhibition of enzymes and peptidase inhibitors of interest based on lack of formation of fragments.
The variations of peptides and proteins can be as the result of translation, or posttranslational modification by enzymatic or non-enzymatic modifications. Post-translational modification refers to the covalent modification of proteins during or after protein biosynthesis. Post-translational modification can be through enzymatic or non-enzymatic chemical reaction. Phosphorylation is a very common mechanism for regulating the activity of enzymes and is the most common post-translational modification. Enzymes can be oxidoreductases, hydrolases, lyases, isomerases, ligases or transferases as known commonly in enzyme taxomony databases, such as http://enzyme.expasy.org/ or http://www.enzyme-database.org/ which have more than 6000 entries.
Common modification of variations of peptides and proteins include the addition of hydrophobic groups for membrane localization, addition of cofactors for enhanced enzymatic activity, diphthalamide formation, hypusine formation, ethanolamine phosphoglycerol attachment, acylation, alkylation amide bond formation, amide bond formation such as amino acid addition or amidation, butyrylation gamma-carboxylation dependent on Vitamin K[15], glycosylation, the addition of a glycosyl group to either arginine, asparagine, cysteine, hydroxylysine, serine, threonine, tyrosine, or tryptophan resulting in a glycoprotein, malonylationhydroxylation, iodination, nucleotide addition such as ADP-ribosylation, phosphate ester (O-linked) or phosphoramidate (N-linked) formation such as phosphorylation or adenylylation, propionylation, pyroglutamate formation, S-glutathionylation, S-nitrosylation S-sulfenylation (aka S-sulphenylation, succinylation or sulfation). Nonenzymatic modification include the attachment of sugars, carbamylation, carbonylation or intentional recombinate or synthetic conjugation such as biotinylation or addition affinity tags, like His oxidation,formation of disulfide bonds between Cys residues or pegylation.
Common reagents for intentional fragmentation to variations of peptides and proteins include peptidases or reagents known to react with peptides and proteins. Intentional fragmentation can generate specific fragments that use predicted cleavage sites for proteases (also termed peptidases or proteinases) and chemicals known to react with peptide and protein sequence. Common peptidases and chemicals for intentional fragmentation include Arg-C, Asp-N, BNPS oNCS/urea, caspase, chymotrypsin (low specificity), Clostripain, CNBr, enterokinase, factor Xa, formic acid, Glu-C, granzyme B, HRV3C protease, hydroxylamine, iodosobenzoic acid, Lys-C, Lys-N, Mild acid hydrolysis, NBS, NTCB, elastase, pepsin A, prolyl endopeptidase, proteinase K, TEV protease, thermolysin, thrombin, and trypsin. Common reagents for intentional inhibition of fragmentation include peptidase and chemical inhibitors for peptidases and chemicals listed above.
An affinity agent is a molecule capable of binding selectively to a rare molecule or mass labels. Selective binding involves the specific recognition of one of two different molecules from the other compared to substantially less recognition of other molecules. The terms “binding” or “bound” refers to the manner in which two moieties are associated to one another. An affinity agent can be an immunoglobulin, protein, peptide, metal, carbohydrate, metal chelator, nucleic acid or other molecule capable of binding selectively to a particular rare molecule or a mass label type. Selective binding involves the specific recognition of one of two different molecules for the other compared to substantially less recognition of other molecules.
Examples of nucleic acids including but not limited to includes natural or made-made oligomeric nucleic acids. The oligomeric nucleic acid may be any polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. The following are non-limiting examples of polynucleotides: coding or non-coding regions of a gene or gene fragment, loci (locus) defined from linkage analysis, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, silencing (siRNA), xeno nucleic acids (XNA), recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. A polynucleotide may comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure may be imparted before or after assembly of the polymer.
The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may be further modified, such as by conjugation with a labeling component. The terms “isolated nucleic acid” and “isolated polynucleotide” are used interchangeably; a nucleic acid or polynucleotide is considered “isolated” if it: (1) is not associated with all or a portion of a polynucleotide in which the “isolated polynucleotide” is found in nature, (2) is linked to a polynucleotide to which it is not linked in nature, or (3) does not occur in nature as part of a larger sequence.
The affinity agents which are immunoglobulins may include complete antibodies or fragment thereof, which immunoglobulins include the various classes and isotypes, such as IgA, IgD, IgE, IgG1, IgG2a, IgG2b and IgG3, IgM, etc. Fragments thereof may include Fab, Fv and F(ab′)2, and Fab′, for example. In addition, aggregates, polymers, and conjugates of immunoglobulins or their fragments can be used where appropriate so long as binding affinity for a particular molecule is maintained. Antibodies can be monoclonal or polyclonal. Such antibodies can be prepared by techniques that are well known in the art such as immunization of a host and collection of sera (polyclonal) or by preparing continuous hybrid cell lines and collecting the secreted protein (monoclonal) or by cloning and expressing nucleotide sequences or mutagenized versions thereof coding at least for the amino acid sequences required for specific binding of natural antibodies.
Polyclonal antibodies and monoclonal antibodies may be prepared by techniques that are well known in the art. For example, in one approach monoclonal antibodies are obtained by somatic cell hybridization techniques. Monoclonal antibodies may be produced according to the standard techniques of Köhler and Milstein, Nature 265:495-497, 1975. Reviews of monoclonal antibody techniques are found in Lymphocyte Hybridomas, ed. Melchers, et al. Springer-Verlag (New York 1978), Nature 266: 495 (1977), Science 208: 692 (1980), and Methods of Enzymology 73 (Part B): 3-46 (1981). In general, monoclonal antibodies can be purified by known techniques such as, but not limited to, chromatography, e.g., DEAE chromatography, ABx chromatography, and HPLC chromatography; and filtration, for example.
An affinity agent can additionally be a “cell affinity agent” capable of binding selectively to a rare molecule which is used for typing a rare cell or measuring a biological intracellular process of a cell. These rare cell markers can be immunoglobulins that specifically recognizes and binds to an antigen associated with a particular cell type and whereby antigen are components of the cell. The cell affinity agent is capable of being absorbed into or onto the cell. The term “cell affinity agent” refers to a rare cell typing markers capable of binding selectively to rare cell. Selective cell binding typically involves “binding between molecules that is relatively dependent of specific structures of binding pair. Selective binding does not rely on non-specific recognition.
Affinity agent can be attached to mass labels and/or particles for purpose of detection or isolation of rare molecules. This attachment can occur through “labeled particles” which are in turn attached to mass labels. Affinity agents can also be attached to “capture particles” which allow separation of bound and unbound mass labels or rare molecule. This attachment to capture and label can be prepared by directly attaching the affinity agent in a “linking group”. The terms “attached” or “attachment” refers to the manner in which two moieties are connected accomplished by a direct bond between the two moieties or a linking group between the two moieties. This allows the method to be multiplexed for more than one result at a time. Alternatively, affinity agent can be attached to mass labels and/or particles mass label using additional “binding partners”. The phrase “binding partner” refers to a molecule that is a member of a specific binding pair of affinity agent and “affinity tags” that bind each other and not the mass labels or rare molecules. In some cases, the affinity agent may be members of an immunological pair such as antigen to antibody or hapten to antibody, biotin to avidin, IgG to protein A, secondary antibody to primary antibody, antibodies to fluorescent labels and other examples of binding pairs.
The “labeled particle” is a particulate material which can be attached to the affinity agent through a direct linker arm or a binding pair. Also the “label particle”, is capable of forming X-Y cleavable linkage between labeled particle and mass label. The size of the label particle is large enough to accommodate one or more mass label and affinity agent. The ratio of affinity agents or mass label to a single label particle may be 107 to 1, 106 to 1, or 105 to 1, or 104 to 1, or 103 to 1, or 102 to 1, or 10 to 1, for example. The number of affinity agents and mass labels associated with the label particle is dependent on one or more of the nature and size of the affinity agent, the nature and size of the labeled particle, the nature of the linker arm, the number and type of functional groups on the labeled particle, and the number and type of functional groups on the mass label, for example.
The composition of the label or capture particle entity may be organic or inorganic, magnetic or non-magnetic as a nanoparticle or a micro particle. Organic polymers include, by way of illustration and not limitation, nitrocellulose, cellulose acetate, poly(vinyl chloride), polyacrylamide, polyacrylate, polyethylene, polypropylene, poly(4-methylbutene), polystyrene, poly(methyl methacrylate), poly(hydroxyethyl methacrylate), poly(styrene/divinylbenzene), poly(styrene/acrylate), poly(ethylene terephthalate), dendrimer, melamine resin, nylon, poly(vinyl butyrate), for example, either used by themselves or in conjunction with other materials and including latex, microparticle and nanoparticle forms thereof. The particles may also comprise carbon (e.g., carbon nanotubes), metal (e.g., gold, silver, and iron, including metal oxides thereof), colloids, dendrimers, dendrons, and liposomes, for example. In some examples, the label particle may be a silica nanoparticle. In other some examples, labeled particles can be magnetic that have free carboxylic acid, amine or tosyl groups. In other some examples, label particles can be mesoporous and include mass labels inside the labeled particles.
The diameter of the label or capture particle is dependent on one or more of the nature of the rare molecule, the nature of the sample, the permeability of the cell, the size of the cell, the size of the nucleic acid, the size of the affinity agent, the magnetic forces applied for separation, the nature and the pore size of a filtration matrix, the adhesion of the particle to a matrix, the surface of the particle, the surface of the matrix, the liquid ionic strength, liquid surface tension and components in the liquid, and the number, size, shape and molecular structure of associated label particles, for example.
The term “permeability” means the ability of particles and molecules to enter a cell through the cell wall. In the case of detection of a rare molecule inside the cell, the diameter of the labeled particles must be small enough to allow the affinity agents to enter the cell. The labeled particle maybe coated with materials to increase “permeability” like collagenase, peptides, proteins, lipid, surfactants, and other chemicals known to increase particle inclusion into the cell.
When a porous matrix is employed in a filtration separation step, the diameter of the labeled particles must be small enough to be pass through the pores of a porous matrix if it did bind the rare molecule, and the diameter of the labeled particles must be large enough to not pass through the pores of a porous matrix to retain the bound rare molecule on the matrix. In some examples in accordance with the invention described herein, the average diameter of the labeled particles should be at least about 0.01 microns (10 nm) and not more than about 10 microns In some examples, the particles have an average diameter from about about 0.02 microns to about 0.06 microns, or about 0.03 microns to about 0.1 microns, or about 0.06 microns to about 0.2 microns, or about 0.2 microns to about 1 micron, or about 1 micron to about 3 microns, or about 3 micron to about 10 microns. In some examples, the adhesion of the particles to the surface is so strong that the particle diameter can be smaller than the pore size of the matrix.
The affinity agent can be prepared by directly attaching the affinity agent to a carrier or capture particles by linking groups. The linking group between the labeled particle and the affinity agent, may be an aliphatic or aromatic bond. The linking groups may comprise a cleavable or non-cleavable linking moiety. Cleavage of the cleavable moiety can be achieved by electrochemical reduction used for the mass label but also may be achieved by chemical or physical methods, involving further oxidation, reduction, solvolysis, e.g., hydrolysis, photolysis, thermolysis, electrolysis, sonication, and chemical substitution, for example. Photocleavable bonds that are cleavable with light having an appropriate wavelength such as, e.g., UV light at 300 nm or greater; for example. The nature of the cleavage agent is dependent on the nature of the cleavable moiety. When heteroatoms are present, oxygen will normally be present as oxy or oxo, bonded to carbon, sulfur, nitrogen or phosphorous; sulfur will be present as thioether or thiono; nitrogen will normally be present as nitro, nitroso or amino, normally bonded to carbon, oxygen, sulfur or phosphorous; phosphorous will be bonded to carbon, sulfur, oxygen or nitrogen, usually as phosphonate and phosphate mono- or diester. Functionalities present in the linking group may include esters, thioesters, amides, thioamides, ethers, ureas, thioureas, guanidines, azo groups, thioethers, carboxylate and so forth. The linking group may also be a macro-molecule such as polysaccharides, peptides, proteins, nucleotides, and dendrimers.
The linking group between the particle and the affinity agent may be a chain of from 1 to about 60 or more atoms, or from 1 to about 50 atoms, or from 1 to about 40 atoms, or from 1 to 30 atoms, or from about 1 to about 20 atoms, or from about 1 to about 10 atoms, each independently selected from the group normally consisting of carbon, oxygen, sulfur, nitrogen, and phosphorous, usually carbon and oxygen. The number of heteroatoms in the linking group may range from about 0 to about 8, from about 1 to about 6, or about 2 to about 4. The atoms of the linking group may be substituted with atoms other than hydrogen such as, for example, one or more of carbon, oxygen and nitrogen in the form of, e.g., alkyl, aryl, aralkyl, hydroxyl, alkoxy, aryloxy, or aralkoxy groups. As a general rule, the length of a particular linking group can be selected arbitrarily to provide for convenience of synthesis with the proviso that there is minimal interference caused by the linking group with the ability of the linked molecules to perform their function related to the methods disclosed herein.
Obtaining reproducibility in amounts of particle captured after separation and isolation is important for rare molecular analysis. Additionally, known amounts of particles captured that enter a rare cell is important to maximize the amount of specific binding. Knowing the amount of particles remaining after washing are important to minimize the amount of non-selective binding. In order to make these determination, it is helpful it the particles can contain fluorescent, optical or chemiluminescence labels. Therefore, labeled particles, can be measured by fluorescent or chemiluminescence by virtue of the presence of a fluorescent or chemiluminescence molecule. The fluorescent and optical molecule can then be measured by microscopic analysis and compared to expected results for sample containing and lacking analyte. Fluorescent molecule include but not limited to dylight™, FITC, rhodamine compounds, phycoerythrin, phycocyanin, allophycocyanin, o-phthalaldehyde, fluorescent rare earth chelates, amino-coumarins, umbelliferones, oxazines, Texas red, acridones, perylenes, indacines such as, e.g., 4,4-difluoro-4-bora-3a,4a-diaza-s-indacene and variants thereof, 9,10-bis-phenylethynylanthracene, squarine dyes and fluorescamine, for example. A fluorescent microscope or fluorescent spectrometer may then be used to determine the location and amount of the label particles. Chemiluminescence labels examples include luminol, acridinium esters and acridinium sulfonamides to name a few. Optical label examples include color particles, gold particles, enzymatic colorimetric reactions to name a few.
Porous matrices are used in “size exclusion filtration” to allow washing away unbound material or material not in full droplets or associated with retained contents. The contents of the droplets are retained on the porous matrix and are called “retained contents”. “Retained contents” can be cells or particles and molecules associated therewith. Full droplets also can be retained with contents on the porous matrix. Pore diameters of the porous matrix are kept small enough to retain larger sized droplets and their contents. “Size exlcusion filtration” allow washing away unbound material or material not in full droplets or associated with retained contents.
Porous matrices can be at the bottom of micowells to hold the droplets and retained contents on cells and particles. Well diameters must be greater than droplets, cell or particles used to reatin the content in a well while still not obstructing washing and allowing washing away undesired materials. Droplet diameter can vary from 1 to 400 μm. Particle size diameter can vary from 15 nm to 10 μm and serve as capture or detection particles. Particles can be associated with other particle or cells. Detection particle and cells or capture particle isolation can be used for the detection of rare molecule. Porous matrices are used where the detection particles are sufficiently smaller than the pore size of the matrix such that physically the particles can fall through the pores if not captured. In other examples, the capture particles are sufficiently larger than the pore size of the matrix such that physically the particles cannot fall through the pores. Cells size diameters can vary from 1μm to 50 μm. Cells can also be in clusters or spheroids of multiple cells of up to an average diameter of 200 μM. The ratio of well diameter is at least 2 times greater than the diameter of the droplet, cells, cell clusters or spheroids. This allows individual droplet, cells, cell clusters or spheroids in a well. The ratio of droplet or cells is less than 10 to improve separation of one droplet or cells per well.
In some methods in accordance with the invention described herein, the sample is incubated with an affinity agent comprised of a mass label and labeled particle, for each different population of rare molecules. The affinity agent that comprises a specific binding partner that is specific for and binds to a rare molecule of one of the populations of the rare molecules. The rare molecules can be cell bound or cell free. The affinity agent with mass label and label particle are retained on the surface of a membrane of a filtration.
The separation can occur is some examples when porous matrices employed in filtration separation step is such that the pore diameter is smaller than the diameter of the cell with the rare molecule but larger that the unbound labeled particles to allow the affinity agents to achieve the benefits of rare molecule capture in accordance with the invention described herein but small enough to pass through the pores of a porous matrix if it did not capture rare molecule. In other methods, the porous matrix employed in the filtration separation step is such that the pore diameter is smaller than the diameter of the affinity agents on label particle capable of binding rare molecule but larger that the unbound molecule pass through allow the affinity agents to achieve the benefits of rare molecule capture. In still other methods, the affinity agents on label particle can be additionally bound through “binding partners” or sandwich assays to other capture particles, like magnetic particles, or to a surface, like a membrane. In the later case, the capture particles are retained on the surface of the porous membranes.
In all examples, the concentration of one or more different populations of rare molecules is enhanced over that of the non-rare molecules to form a concentrated sample. In some examples, the sample is subjected to a filtration procedure using a porous matrix that retains the rare molecules while allowing the non-rare molecules to pass through the porous matrix thereby enhancing the concentration of the rare molecules. In the event that one or more rare molecules are non-cellular, i.e., not associated with a cell or other biological particle, the sample is combined with one or more capture particle entities wherein each capture particle entity comprises a binding partner for the non-cellular rare molecule of each of the populations of non-cellular rare molecules to render the non-cellular rare molecules in particulate form, i.e., to form particle-bound non-cellular rare molecules. The combination of the sample and the capture particle entities is held for a period of time and at a temperature to permit the binding of non-cellular rare molecules with corresponding binding partners of the capture particle entities. Vacuum is then applied to the sample on the porous matrix to facilitate passage of non-rare cells and other particles through the matrix. The level of vacuum applied is dependent on one or more of the nature and size of the different populations of rare cells and/or particle reagents, the nature of the porous matrix, and the size of the pores of the porous matrix, for example.
Contact of the sample with the porous matrix is continued for a period of time sufficient to achieve retention of cellular rare molecules and/or particle-bound non-cellular rare molecules on a surface of the porous matrix to obtain a surface of the porous matrix having different populations of rare cells and/or particle-bound rare molecules as discussed above. The period of time is dependent on one or more of the nature and size of the different populations of rare cells and/or particle-bound rare molecules, the nature of the porous matrix, the size of the pores of the porous matrix, the level of vacuum applied to the blood sample on the porous matrix, the volume to be filtered, and the surface area of the porous matrix, for example. In some examples, the period of contact is about 1 minute to about 1 hour, about 5 minutes to about 1 hour, or about 5 minutes to about 45 minutes, or about 5 minutes to about 30 minutes, or about 5 minutes to about 20 minutes, or about 5 minutes to about 10 minutes, or about 10 minutes to about 1 hour, or about 10 minutes to about 45 minutes, or about 10 minutes to about 30 minutes, or about 10 minutes to about 20 minutes, for example.
An amount of each different affinity agent that is employed in the methods in accordance with the invention described herein is dependent on one or more of the nature and potential amount of each different population of rare molecules, the nature of the mass label, the natured of attachment, the nature of the affinity agent, the nature of a cell if present, the nature of a particle if employed, and the amount and nature of a blocking agent if employed, for example. In some examples, the amount of each different modified affinity agent employed is about 0.001 μg/μL to about 100 μg/μL, or about 0.001 μg/μL to about 80 μg/μL, or about 0.001 μg/μL to about 60 μg/μL, or about 0.001 μg/μL to about 40 μg/μL, or about 0.001 μg/μL to about 20 μg/μL, or about 0.001 μg/μL to about 10 μg/μL, or about 0.5 μg/μL to about 100 μg/μL, or about 0.5 μg/μL to about 80 μg/μL, or about 0.5 μg/μL to about 60 μg/μL, or about 0.5 μg/μL to about 40 μg/μL, or about 0.5 μg/μL to about 20 μg/μL, or about 0.5 μg/μL to about 10 μg/μL, for example.
The porous matrix is a solid, material, is impermeable to liquid (except through one or more pores of the matrix) in accordance with the invention described herein. The porous matrix is associated with a porous matrix holder and a liquid holding well. The association between porous matrix and holder can be done with an adhesive. The association between porous matrix in the holder and the liquid holding well can be through direct contact or with a flexible gasket surface.
The porous matrix is a solid or semi-solid material and may be comprised of an organic or inorganic, water insoluble material. The porous matrix is non-bibulous, which means that the membrane is incapable of absorbing liquid. In some examples, the amount of liquid absorbed by the porous matrix is less than about 2% (by volume), or less than about 1%, or less than about 0.5%, or less than about 0.1%, or less than about 0.01%, or 0%. The porous matrix is non-fibrous, which means that the membrane is at least 95% free of fibers, or at least 99% free of fibers, or at least 99.5%, or at least 99.9% free of fibers, or 100% free of fibers.
The porous matrix can have any of a number of shapes such as, for example, track-etched, or planar or flat surface (e.g., strip, disk, film, matrix, and plate). The matrix may be fabricated from a wide variety of materials, which may be naturally occurring or synthetic, polymeric or non-polymeric. The shape of the porous matrix is dependent on one or more of the nature or shape of holder for the membrane, of the microfluidic surface, of the liquid holding well, of cover surface, for example. In some examples the shape of the porous matrix is circular, oval, rectangular, square, track-etched, planar or flat surface (e.g., strip, disk, film, membrane, and plate), for example.
The porous matrix and holder may be fabricated from a wide variety of materials, which may be naturally occurring or synthetic, polymeric or non-polymeric. Examples, by way of illustration and not limitation, of such materials for fabricating a porous matrix include plastics such as, for example, polycarbonate, poly (vinyl chloride), polyacrylamide, polyacrylate, polyethylene, polypropylene, poly(4-methylbutene), polystyrene, polymethacrylate, poly(ethylene terephthalate), nylon, poly(vinyl butyrate), poly(chlorotrifluoroethylene), poly(vinyl butyrate), polyimide, polyurethane, and parylene; silanes; silicon; silicon nitride; graphite; ceramic material (such, e.g., as alumina, zirconia, PZT, silicon carbide, aluminum nitride); metallic material (such as, e.g., gold, tantalum, tungsten, platinum, and aluminum); glass (such as, e.g., borosilicate, soda lime glass, and PYREX®); and bioresorbable polymers (such as, e.g., polylactic acid, polycaprolactone and polyglycolic acid); for example, either used by themselves or in conjunction with one another and/or with other materials. The material for fabrication of the porous matrix and holder are non-bibulous does not include fibrous materials such as cellulose (including paper), nitrocellulose, cellulose acetate, rayon, diacetate, lignins, mineral fibers, fibrous proteins, collagens, synthetic fibers (such as nylons, dacron, olefin, acrylic, polyester fibers, for example) or, other fibrous materials (glass fiber, metallic fibers), which are bibulous and/or permeable and, thus, are not in accordance with the invention described herein. The material for fabrication of the porous matrix and holder may be the same or different materials.
The porous matrix for each liquid holding well comprises at least one pore and no more than about 2,000,000 pores per square centimeter (cm2). In some examples the number of pores of the porous matrix per cm2 is 1 to about 2,000,000, or 1 to about 1,000,000, or 1 to about 500,000, or 1 to about 200,000, or 1 to about 100,000, or 1 to about 50,000, or 1 to about 25,000, or 1 to about 10,000, or 1 to about 5,000, or 1 to about 1,000, or 1 to about 500, or 1 to about 200, or 1 to about 100, or 1 to about 50, or 1 to about 20, or 1 to about 10, or 2 to about 500,000, or 2 to about 200,000, or 2 to about 100,000, or 2 to about 50,000, or 2 to about 25,000, or 2 to about 10,000, or 2 to about 5,000, or 2 to about 1,000, or 2 to about 500, or 2 to about 200, or 2 to about 100, or 2 to about 50, or 2 to about 20, or 2 to about 10, or 5 to about 200,000, or 5 to about 100,000, or 5 to about 50,000, or 5 to about 25,000, or 5 to about 10,000, or 5 to about 5,000, or 5 to about 1,000, or 5 to about 500, or 5 to about 200, or 5 to about 100, or 5 to about 50, or 5 to about 20, or 5 to about 10, for example. The density of pores in the porous matrix is about 1% to about 20%, or about 1% to about 10%, or about 1% to about 5%, or about 5% to about 20%, or about 5% to about 10%, for example, of the surface area of the porous matrix. In some examples, the size of the pores of a porous matrix is that which is sufficient to preferentially retain liquid while allowing the passage of liquid droplets formed in accordance with the invention described herein. The size of the pores of the porous matrix is dependent on the nature of the liquid, the size of the cell, the size of the capture particle, the size of mass label, the size of an analyte, the size of label particles, the size of non-rare molecules, and the size of non-rare cells, for example. In some examples the average size of the pores of the porous matrices is about 0.1 to about 20 microns, or about 0.1 to about 5 microns, or about 0.1 to about 1 micron, or about 1 to about 20 microns, or about 1 to about 5 microns, or about 1 to about 2 microns, or about 5 to about 20 microns, or about 5 to about 10 microns, for example.
Pores within the matrix may be fabricated in accordance with the invention described herein by for example, microelectromechanical (MEMS) technology, metal oxide semiconductor (CMOS) technology, micro-manufacturing processes for producing microsieves, laser technology, irradiation, molding, and micromachining, for example, or a combination thereof.
The porous matrix is permanently attached to a holder which can be associated to the bottom of the liquid holding well and to the top of the vacuum manifold where the porous matrix is positioned such that liquid can flow from liquid holding well to vacuum manifold. In some examples, the porous matrix in the holder can be associated with a microfluidic surface, top or bottom cover surface. The holder may be constructed of any suitable material that is compatible with the material of the porous matrix. Examples of such materials include, by way of example and not limitation, any of the materials listed above for the porous matrix. The material for the housing and for the porous matrix may be the same or may be different. The holder may also be constructed of non-porous glass or plastic film.
Examples of plastic film materials include polystyrene, polyalkylenes, polyolefins, epoxies, Teflon®, PET, chloro-fluoroethylenes, polyvinylidene fluoride, PE-TFE, PE-CTFE, liquid crystal polymers, Mylar®, polyester, polymethylpentene, polyphenylene sulfide, and PVC plastic films. The plastic film can be metallized such as with aluminum. The plastic films can have relative low moisture transmission rate, e.g. 0.001 mg per m2-day. The porous matrix may be permanently attached to a holder by adhesion using thermal bonding, mechanical fastening or through use of permanently adhesives such as drying adhesive like polyvinyl acetate, pressure-sensitive adhesives like acrylate-based polymers, contact adhesives like natural rubber and polychloroprene, hot melt adhesives like ethylene-vinyl acetates, and reactive adhesives like polyester, polyol, acrylic, epoxies, polyimides, silicones rubber-based and modified acrylate and polyurethane compositions, natural adhesive like dextrin, casein, lignin. The plastic film or the adhesive can be electrically conductive materials and the conductive material coatings or materials can be patterned across specific regions of the hold surface.
The porous matrix in the holder is generally part of a filtration module where the porous matrix is part of an assembly for convenient use during filtration. The holder does not contain pores and has a surface which facilitates contact with associated surfaces but is not permanently attached to these surfaces and can be removed. A top gasket maybe applied to the removable holder between the liquid holding wells. A bottom gasket maybe applied to the removable holder between the manifold for vacuum. A gasket is a flexible material that facilitates complete contact upon compression. The holder maybe constructed of gasket material. Examples of gasket shapes include a flat, embossed, patterned, or molded sheets, rings, circles, ovals, with cut out areas to allow sample to flow from porous matrix to vacuum maniford. Examples of gasket materials include paper, rubber, silicone, metal, cork, felt, neoprene, nitrile rubber, fiberglass, polytetrafluoroethylene like PTFE or Teflon or a plastic polymer like polychlorotrifluoroethylene.
Liquid holding wells can include a group of microwells. Liquid holding wells can be cylinders, cones, cubes, or other volume holding geometries. Liquid holding wells can be typical of a 96, 384 or 1536 well ELISA plates. In some examples the liquid holding wells are cylinders with a diameters of about 1 cm to 5 cm, or about 1 to 20 mm, or about 6 to 7, or about 3 to 6 mm, or about 1 to 2 mm. In some examples the liquid holding wells are cylinders with a height of about 1 cm to 5 cm, or about 1 to 20 mm, or about 4 to 5 mm, or about 11 to 14 mm. In some examples, the liquid holding wells hold 1 μL to 1000 μL of liquid, or about 5 to 15 μL, or about 15 to 100 μL, or about 100 to 150 μL, or 150 to 500 μL, or about 500 μL to 10 mL.
Liquid holding wells can hold 1 to 10000 individual microwells, 1 to 1000 microwells, or about 5 to 15 microwells, or about 15 to 100 microwells, or about 100 to 150 microwells, or 150 to 500 microwells, or about 500 to 10000 microwells. For example a liquid holding wells of 6.5 mm diameter can hold 200 microwells of 200 μm diameter and being 400 μm center to center to center and 360 μm deep. Microwells can be cylinders, cones, cubes, or other volume holding geometries. In some examples the microwells are cylinders with a diameters of about 1 μm to 5000 μm, or about 1 to 10 μm, or about 10 to 50 μm, or about 50 to 100 μm, or about 100 to 300 μm, or about 300 to 500 μm, or about 1 to 2 μm. In some examples the microwells are cylinders with a heights of about of about 1 μm to 5000 μm, or about 1 to 10 μm, or about 10 to 50 μm, or about 50 to 100 μm, or about 100 to 300 μm, or about 300 to 500 μm, or about 1 to 2 μm. In some examples, the microwells hold 1 pL to 1000 nL of liquid, or about 5 to 15 pL, or about 15 to 100 pL, or about 100 to 500 pL, or 0.5 to 10 nL, or about 10 nL to 100 nL.
Liquid holding wells with micron wells can be arranged in sets such as a those typical of 96, 384 or 1536 well ELISA plates For example a liquid holding wells of 6.5 mm diameter can be arranged as a set of 96 liquid holding wells each holding 200 microwells of 200 μm diameter and being 400 μm center to center to center and 360 μm deep. See
In some examples, vacuum is applied to the concentrated and treated sample on the porous matrix to facilitate passage of non-rare cells through the matrix. The level of vacuum applied is dependent on one or more of the nature and size of the different populations of biological particles, the nature of the porous matrix, and the size of the pores of the porous matrix, for example. In some examples, the level of vacuum applied is about 1 millibar to about 100 millibar, or about 1 millibar to about 80 millibar, or about 1 millibar to about 50 millibar, or about 1 millibar to about 40 millibar, or about 1 millibar to about 30 millibar, or about 1 millibar to about 25 millibar, or about 1 millibar to about 20 millibar, or about 1 millibar to about 15 millibar, or about 1 millibar to about 10 millibar, or about 5 millibar to about 80 millibar, or about 5 millibar to about 50 millibar, or about 5 millibar to about 30 millibar, or about 5 millibar to about 25 millibar, or about 5 millibar to about 20 millibar, or about 5 millibar to about 15 millibar, or about 5 millibar to about 10 millibar, for example. In some examples the vacuum is an oscillating vacuum, which means that the vacuum is applied intermittently at regular of irregular intervals, which may be, for example, about 1 second to about 600 seconds, or about 1 second to about 500 seconds, or about 1 second to about 250 seconds, or about 1 second to about 100 seconds, or about 1 second to about 50 seconds, or about 10 seconds to about 600 seconds, or about 10 seconds to about 500 seconds, or about 10 seconds to about 250 seconds, or about 10 seconds to about 100 seconds, or about 10 seconds to about 50 seconds, or about 100 seconds to about 600 seconds, or about 100 seconds to about 500 seconds, or about 100 seconds to about 250 seconds, for example. In this approach, vacuum is oscillated at about 0 millibar to about 10 millibar, or about 1 millibar to about 10 millibar, or about 1 millibar to about 7.5 millibar, or about 1 millibar to about 5.0 millibar, or about 1 millibar to about 2.5 millibar, for example, during some or all of the application of vacuum to the sample. Oscillating vacuum is achieved using an on-off switch, for example, and may be conducted automatically or manually.
Contact of the treated sample with the porous matrix is continued for a period of time sufficient to achieve retention of the rare cells or the particle-bound rare molecules on a surface of the porous matrix to obtain a surface of the porous matrix having different populations of rare cells or the particle-bound rare molecules as discussed above. The period of time is dependent on one or more of the nature and size of the different populations of rare cells or particle-bound rare molecules, the nature of the porous matrix, the size of the pores of the porous matrix, the level of vacuum applied to the sample on the porous matrix, the volume to be filtered, and the surface area of the porous matrix, for example. In some examples, the period of contact is about 1 minute to about 1 hour, about 5 minutes to about 1 hour, or about 5 minutes to about 45 minutes, or about 5 minutes to about 30 minutes, or about 5 minutes to about 20 minutes, or about 5 minutes to about 10 minutes, or about 10 minutes to about 1 hour, or about 10 minutes to about 45 minutes, or about 10 minutes to about 30 minutes, or about 10 minutes to about 20 minutes, for example.
The phrase “rare molecules” refers to a molecule that may be detected in a sample where the rare molecules is indicative of a particular population of molecules. The phrase “population of molecules” refers to a group of rare molecules that share a common rare molecules that is specific for the group of rare molecules. The phrase “specific for” means that the common rare molecules distinguishes the group of rare molecules from other molecules.
The methods described herein involve trace analysis, i.e., minute amounts of material on the order of 1 to about 100,000 copies of rare cells or rare molecules. Since this process involves trace analysis at the detection limits of the nucleic acid analyzers, these minute amounts of material can only be detected when detection volumes are extremely low, for example, 10-15 liter, so that the concentrations are within the detection. Given associated errors is unlikely and that “all” of the rare molecules undergo amplification, i.e., converting the minute amounts of material to the order of about 105 to about 1010 copies of every rare molecule. The phrase “substantially all” means that at least about 70 to about 99% measured by the reproducibility of the amount of a rare molecule produced.
The phrase “cell free rare molecules” refers to rare molecules that are not bound to a cell and/or that freely circulate in a sample. Such non-cellular rare molecules include biomolecules useful in medical diagnosis and treatments of diseases. Medical diagnosis of diseases include, but are not limited to, biomarkers for detection of cancer, cardiac damage, cardiovascular disease, neurological disease, hemostasis/hemastasis, fetal maternal assessment, fertility, bone status, hormone levels, vitamins, allergies, autoimmune diseases, hypertension, kidney disease, metabolic disease, diabetes, liver diseases, infectious diseases and other biomolecules useful in medical diagnosis of diseases, for example.
The following are non-limiting examples of samples of rare molecules that can be measured in a sample. The sample to be analyzed is one that is suspected of containing rare molecules. The samples may be biological samples or non-biological samples. Biological samples may be from a plant, animal, protists or other living organism including animalia, fungi, plantae, chromista, or protozoa or other eukaryote species or bacteria, archaea, or other prokaryote species. Non-biological samples include aqueous solutions, environmental, products, chemical reaction production, waste streams, foods, feed stocks, fertilizers, fuels, and the like. Biological samples include biological fluids such as whole blood, serum, plasma, sputum, lymphatic fluid, semen, vaginal mucus, feces, urine, spinal fluid, saliva, stool, cerebral spinal fluid, tears, mucus, or tissues for example. Biological tissue includes, by way of illustration, hair, skin, sections or excised tissues from organs or other body parts, for example. Rare molecules may be from tissues, for example, lung, bronchus, colon, rectum, extra cellular matrix, dermal, vascular, stem, lead, root, seed, flower, pancreas, prostate, breast, liver, bile duct, bladder, ovary, brain, central nervous system, kidney, pelvis, uterine corpus, oral cavity or pharynx or cancers. In many instances, the sample is aqueous such as a urine, whole blood, plasma or serum sample, in other instances the sample must be made into a solution or suspension for testing.
The sample can be one that contains cells such as, for example, non-rare cells and rare cells where rare molecules are detected from the rare cells. The rare molecules from cells may be from any organism, but are not limited to, pathogens such as bacteria, virus, fungus, and protozoa; malignant cells such as malignant neoplasms or cancer cells; circulating endothelial cells; circulating tumor cells; circulating cancer stem cells; circulating cancer mesenchymal cells; circulating epithelial cells; fetal cells; immune cells (B cells, T cells, macrophages, NK cells, monocytes); and stem cells; for example. In other examples of methods in accordance with the invention described herein, the sample to be tested is a blood sample from an organism such as, but not limited to, a plant or animal subject, for example. In some examples of methods in accordance with the invention described herein, the sample to be tested is a sample from a organism such as, but not limited to, a mammal subject, for example. Cells with rare molecules may be from a tissue of mammal, for example, lung, bronchus, colon, rectum, pancreas, prostate, breast, liver, bile duct, bladder, ovary, brain, central nervous system, kidney, pelvis, uterine corpus, oral cavity or pharynx or cancers.
Rare molecule fragments can be used to measure peptidases of interest including those in the MEROPS on-line database for peptidases (also known as proteases) and a total of ˜902212 different sequences of aspartic, cysteine, glutamic, metallo, asparagine, serine, threonine and general peptidases catalytics types which are further categorized and include those listed for the following pathways: 2-Oxocarboxylic acid metabolism, ABC transporters, African trypanosomiasis, Alanine, aspartate and glutamate metabolism, Allograft rejection, Alzheimer's disease, Amino sugar and nucleotide sugar metabolism, Amoebiasis, AMPK signaling pathway, Amyotrophic lateral sclerosis (ALS), Antigen processing and presentation, Apoptosis, Arachidonic acid metabolism, Arginine and proline metabolism, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Asthma, Autoimmune thyroid disease, B cell receptor signaling pathway, Bacterial secretion system, Basal transcription factors, beta-Alanine metabolism, Bile secretion, Biosynthesis of amino acids, Biosynthesis of secondary metabolites, Biosynthesis of unsaturated fatty acids, Biotin metabolism, Bisphenol degradation, Bladder cancer, cAMP signaling pathway, Carbon metabolism, Cardiac muscle contraction, Cell adhesion molecules (CAMs), Cell cycle, Cell cycle—yeast, Chagas disease (American trypanosomiasis), Chemical carcinogenesis, Cholinergic synapse, Colorectal cancer, Complement and coagulation cascades, Cyanoamino acid metabolism, Cysteine and methionine metabolism, Cytokine-cytokine receptor interaction, Cytosolic DNA-sensing pathway, Degradation of aromatic compounds, Dilated cardiomyopathy, Dioxin degradation, DNA replication, Dorso-ventral axis formation, Drug metabolism—other enzymes, Endocrine and other factor-regulated calcium reabsorption, Endocytosis, Epithelial cell signaling in Helicobacter pylori infection, Epstein-Barr virus infection, Estrogen signaling pathway, Fanconi anemia pathway, Fatty acid elongation, Focal adhesion, Folate biosynthesis, FoxO signaling pathway, Glutathione metabolism, Glycerolipid metabolism, Glycerophospholipid metabolism, Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Glyoxylate and dicarboxylate metabolism, GnRH signaling pathway, Graft-versus-host disease, Hedgehog signaling pathway, Hematopoietic cell lineage, Hepatitis B, Herpes simplex infection, HIF-1 signaling pathway, Hippo signaling pathway, Histidine metabolism, Homologous recombination, HTLV-I infection, Huntington's disease, Hypertrophic cardiomyopathy (HCM), Influenza A, Insulin signaling pathway, Legionellosis, Leishmaniasis, Leukocyte transendothelial migration, Lysine biosynthesis, Lysosome, Malaria, MAPK signaling pathway, Meiosis—yeast, Melanoma, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Microbial metabolism in diverse environments, MicroRNAs in cancer, Mineral absorption, Mismatch repair, Natural killer cell mediated cytotoxicity, Neuroactive ligand-receptor interaction, NF-kappa B signaling pathway, Nitrogen metabolism, NOD-like receptor signaling pathway, Non-alcoholic fatty liver disease (NAFLD), Notch signaling pathway, Olfactory transduction, Oocyte meiosis, Osteoclast differentiation, Other glycan degradation, Ovarian steroidogenesis, Oxidative phosphorylation, p53 signaling pathway, Pancreatic secretion, Pantothenate and CoA biosynthesis, Parkinson's disease, Pathways in cancer, Penicillin and cephalosporin biosynthesis, Peptidoglycan biosynthesis, Peroxisome, Pertussis, Phagosome, Phenylalanine metabolism, Phenylalanine, tyrosine and tryptophan biosynthesis, Phenylpropanoid biosynthesis, PI3K-Akt signaling pathway, Plant-pathogen interaction, Platelet activation, PPAR signaling pathway, Prion diseases, Proteasome, Protein digestion and absorption, Protein export, Protein processing in endoplasmic reticulum, Proteoglycans in cancer, Purine metabolism, Pyrimidine metabolism, Pyruvate metabolism, Rapl signaling pathway, Ras signaling pathway, Regulation of actin cytoskeleton, Regulation of autophagy, Renal cell carcinoma, Renin-angiotensin system, Retrograde endocannabinoid signaling, Rheumatoid arthritis, RIG-I-like receptor signalling pathway, RNA degradation, RNA transport, Salivary secretion, Salmonella infection, Serotonergic synapse, Small cell lung cancer, Spliceosome, Staphylococcus aureus infection, Systemic lupus erythematosus, T cell receptor signaling pathway, Taurine and hypotaurine metabolism, Terpenoid backbone biosynthesis, TGF-beta signaling pathway, TNF signaling pathway, Toll-like receptor signaling pathway, Toxoplasmosis, Transcriptional misregulation in cancer, Tryptophan metabolism, Tuberculosis, Two-component system, Type I diabetes mellitus, Ubiquinone and other terpenoid-quinone biosynthesis, Ubiquitin mediated proteolysis, Vancomycin resistance, Viral carcinogenesis, Viral myocarditis, Vitamin digestion and absorption Wnt signaling pathway.
Rare molecule fragments can be used to measure peptidase inhibitor of interest included those in the MEROPS on-line database for peptidase inhibitors and include and total of ˜133535 different sequences of where a family is a set of homologous peptidase inhibitors with a homology. The homology is shown by a significant similarity in amino acid sequence either to the type inhibitor of the family, or to another protein that has already been shown to be homologous to the type inhibitor, and thus a member of The reference organism for the family is shown such as ovomucoid inhibitor unit 3 (Meleagris gallopavo), aprotinin (Bos taurus), soybean Kunitz trypsin inhibitor (Glycine max), proteinase inhibitor B (Sagittaria sagittifolia), alpha-1-peptidase inhibitor (Homo sapiens), ascidian trypsin inhibitor (Halocynthia roretzi), ragi seed trypsin/alpha-amylase inhibitor (Eleusine coracana), trypsin inhibitor MCTI-1 (Momordica charantia), Bombyx subtilisin inhibitor (Bombyx mori), peptidase B inhibitor (Saccharomyces cerevisiae), marinostatin (Alteromonas sp.), ecotin (Escherichia coli), Bowman-Birk inhibitor unit 1 (Glycine max), eglin c (Hirudo medicinalis), hirudin (Hirudo medicinalis), antistasin inhibitor unit 1 (Haementeria officinalis), streptomyces subtili sin inhibitor (Streptomyces albogriseolus), secretory leukocyte peptidase inhibitor domain 2 (Homo sapiens), mustard trypsin inhibitor-2 (Sinapis alba), peptidase inhibitor LMPI inhibitor unit 1 (Locusta migratoria), potato peptidase inhibitor II inhibitor unit 1 (Solanum tuberosum), secretogranin V (Homo sapiens), BsuPI peptidase inhibitor (Bacillus subtilis), pinA Lon peptidase inhibitor (Enterobacteria phage T4), cystatin A (Homo sapiens), ovocystatin (Gallus gallus), metallopeptidase inhibitor (Bothrops jararaca), calpastatin inhibitor unit 1 (Homo sapiens), cytotoxic T-lymphocyte antigen-2 alpha (Mus musculus), equistatin inhibitor unit 1 (Actinia equina), survivin (Homo sapiens), aspin (Ascaris suum), saccharopepsin inhibitor (Saccharomyces cerevisiae), timp-1 (Homo sapiens), Streptomyces metallopeptidase inhibitor (Streptomyces nigrescens), potato metallocarboxypeptidase inhibitor (Solanum tuberosum), metallopeptidase inhibitor (Dickeya chrysanthemi), alpha-2-macroglobulin (Homo sapiens), chagasin (Leishmania major), oprin (Didelphis marsupialis), metallocarboxypeptidase A inhibitor (Ascaris suum), leech metallocarboxypeptidase inhibitor (Hirudo medicinalis), latexin (Homo sapiens), clitocypin (Lepista nebularis), proSAAS (Homo sapiens), baculovirus P35 caspase inhibitor (Spodoptera litura nucleopolyhedrovirus), p35 homologue (Amsacta moorei entomopoxvirus), serine carboxypeptidase Y inhibitor (Saccharomyces cerevisiae), tick anticoagulant peptide (Ornithodoros moubata), madanin 1 (Haemaphysalis longicornis), squash aspartic peptidase inhibitor (Cucumis sativus), staphostatin B (Staphylococcus aureus), staphostatin A (Staphylococcus aureus), triabin (Triatoma pallidipennis), pro-eosinophil major basic protein (Homo sapiens), thrombostasin (Haematobia irritans), Lentinus peptidase inhibitor (Lentinula edodes), bromein (Ananas comosus), tick carboxypeptidase inhibitor (Rhipicephalus bursa), streptopain inhibitor (Streptococcus pyogenes), falstatin (Plasmodium falciparum), chimadanin (Haemaphysalis longicornis), (Veronica) trypsin inhibitor (Veronica hederifolia), variegin (Amblyomma variegatum), bacteriophage lambda CIII protein (bacteriophage lambda), thrombin inhibitor (Glossina morsitans), anophelin (Anopheles albimanus), Aspergillus elastase inhibitor (Aspergillus fumigatus), AVR2 protein (Passalora fulva), IseA protein (Bacillus subtilis), toxostatin-1 (Toxoplasma gondii), AmFPI-1 (Antheraea mylitta), cvSI-2 (Crassostrea virginica), macrocypin 1 (Macrolepiota procera), HflC (Escherichia coli), oryctin (Oryctes rhinoceros), trypsin inhibitor (Mirabilis jalapa), F1L protein (Vaccinia virus), NvCI carboxypeptidase inhibitor (Nerita versicolor), Sizzled protein (Xenopus laevis), EAPH2 protein (Staphylococcus aureus), and Bowman-Birk-like trypsin inhibitor (Odorrana versabilis). Rare molecule fragments can be used to measure synthetic inhibition of peptidase inhibitor. The afore-mentioned data base also includes examples of thousands of different small molecule inhibitors that can mimic the inhibitory properties for any member or the above listed family.
Rare molecules of metabolic interest include but are not limited to those that impact the concentration of ACC Acetyl Coenzyme A Carboxylase, Adpn Adiponectin, AdipoR Adipo-nectin Receptor, AG Anhydroglucitol, AGE Advance glycation end products, Akt Protein kinase B, AMBK pre-alpha-1-microglobulin/bikunin, AMPK 5′-AMP activated protein kinase, ASP Acylation stimulating protein, Bik Bikunin, BNP B-type natriuretic peptide, CCL Chemokine (C-C motif) ligand, CINC Cytokine-induced neutrophil chemoattractant, CTF C-Terminal Fragment of Adiponectin Receptor, CRP C-reactive protein, DGAT Acyl CoA diacylglycerol transferase, DPP-IV Dipeptidyl peptidase-IV, EGF Epidermal growth factor, eNOS Endothelial NOS, EPO Erythropoietin, ET Endothelin, Erk Extracellular signal-regulated kinase, FABP Fatty acid-binding protein, FGF Fibroblast growth factor, FFA Free fatty acids, FXR Farnesoid X receptor a, GDF Growth differentiation factor, GH Growth hormone, GIP Glucose-dependent insulinotropic polypeptide, GLP Glucagon-like peptide-1, GSH Glutathione, GHSR Growth hormone secretagogue receptor, GULT Glucose transporters, GCD59 glycated CD59 (aka glyCD59), HbA1c Hemogloblin A1c, HDL High-density lipoprotein, HGF Hepatocyte growth factor, HIF Hypoxia-inducible factor, HMG 3-Hydroxy-3-methylglutaryl CoA reductase, I-α-I Inter-α-inhibitor, Ig-CTF Immunoglobulin attached C-Terminal Fragment of AdipoR, insulin,
IDE Insulin-degrading enzyme, IGF Insulin-like growth factor, IGFBP IGF binding proteins, IL Interleukin cytokines, ICAM Intercellular adhesion molecule, JAK STAT Janus kinase/signal transducer and activator of transcription, JNK c-Jun N-terminal kinases, KIM Kidney injury molecule, LCN-2 Lipocalin, LDL Low-density lipoprotein, L-FABP Liver type fatty acid binding protein, LPS Lipopolysaccharide, Lp-PLA2 Lipoprotein-associated phospholipase A2, LXR Liver X receptors, LYVE Endothelial hyaluronan receptor, MAPK Mitogen-activated protein kinase, MCP Monocyte chemotactic protein, MDA Malondialdehyde, MIC Macrophage inhibitory cytokine, MIP Macrophage infammatory protein, MMP Matrix metalloproteinase, MPO Myeloperoxidase, mTOR Mammalian of rapamycin, NADH Nicotinamide adenine dinucleotide, NGF Nerve growth factor, NFκB Nuclear factor kappa-light-chain-enhancer of activated B cells, NGAL Neutrophil gelatinase lipocalin, NOS Nitric oxide synthase NOX NADPH oxidase NPY Neuropeptide Yglucose, insulin, proinsulin, c peptide OHdG Hydroxydeoxyguanosine, oxLDL Oxidized low density lipoprotein, P-α-I pre-interleukin-α-inhibitor, PAI-1 Plasminogen activator inhibitor, PAR Protease-activated receptors, PDF Placental growth factor, PDGF Platelet-derived growth factor, PKA Protein kinase A, PKC Protein kinase C, PI3K Phosphatidylinositol 3-kinase, PLA2 Phosphatidylinositol 3-kinase, PLC Phospholipase C, PPAR Peroxisome proliferator-activated receptor, PPG Postprandial glucose, PS Phosphatidylserine, PR Proteinase, PYY Neuropeptide like peptide Y, RAGE Receptors for AGE, ROS Reactive oxygen species, S100 Calgranulin, sCr Serum creatinine, SGLT2 Sodium-glucose transporter 2, SFRP4 secreted frizzled-related protein 4 precursor, SREBP Sterol regulatory element binding proteins, SMAD Sterile alpha motif domain-containing protein, SOD Superoxide dismutase, sTNFR Soluble TNF α receptor, TACE TNFα alpha cleavage protease, TFPI Tissue factor pathway inhibitor, TG Triglycerides, TGF β Transforming growth factor β, TIMP Tissue inhibitor of metalloproteinases, TNF α Tumor necrosis factors α, TNFR TNF α receptor, THP Tamm-Horsfall protein, TLR Toll-like receptors, TnI Troponin I, tPA Tissue plasminogen activator, TSP Thrombospondin, Uri Uristatin, uTi Urinary trypsin inhibitor, uPA Urokinase-type plasminogen activator, uPAR uPA receptor, VCAM Vascular cell adhesion molecule, VEGF Vascular endothelial growth factor, and YKL-40 Chitinase-3-like protein.
Rare molecules of interest that are highly expressed by pancreas include but are not limited to INS insulin, GLU glucogen, NKX6-1 transcription factor, PNLIPRP1 pancreatic lipase-related protein 1, SYCN syncollin, PRSS1 protease, serine, 1 (trypsin 1) Intracellular, CTRB2 chymotrypsinogen B2 Intracellular, CELA2A chymotrypsin-like elastase family, member 2A, CTRB1 chymotrypsinogen B1 Intracellular, CELA3A chymotrypsin-like elastase family, member 3A Intracellular, CELA3B chymotrypsin-like elastase family, member 3B Intracellular, CTRC chymotrypsin C (caldecrin), CPA1 carboxypeptidase A1 (pancreatic) Intracellular, PNLIP pancreatic lipase, and CPB1 carboxypeptidase B1 (tissue), AMY2A amylase, alpha 2A (pancreatic), and CTFR cystic fibrosis transmembrane conductance regulator.
Rare molecule fragments include those of insulin generated by the following peptidases known to naturally act on insulin such as archaelysin, duodenase, calpain-1, ammodytase subfamily M12B peptidases, ALE1 peptidase, CDF peptidase, cathepsin E, meprin alpha subunit, jerdohagin (Trimeresurus jerdonii), carboxypeptidase E, dibasic processing endopeptidase, yapsin-1, yapsin A, PCSK1 peptidase, aminopeptidase B, PCSK1 peptidase, PCSK2 peptidase, insulysin, matrix metallopeptidase-9 and others. These fragments include but are not limited to the following sequences: SEQ ID NO:1 MALWMRLLPLLALLALWGP, SEQ ID NO:2 MALWMRLLPL, SEQ ID NO:3 ALLALWGPD, SEQ ID NO:4 AAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTR, SEQ ID NO:5 PAAAFVNQHLCGSHLVEALYLVC, SEQ ID NO:6 PAAAFVNQHLCGS, SEQ ID NO:7 CGSHLVEALYLV, SEQ ID NO:8 VEALYLVC,
SEQ ID NO:9 LVCGERGF, SEQ ID NO:10 FFYTPK, SEQ ID NO:11 REAEDLQVGQVELGGGPGAGSLQPLALEGSL SEQ ID NO:12 REAEDLQVGQVE SEQ ID NO:13 LGGGPGAG SEQ ID NO:14 SLQPLALEGSL SEQ ID NO:15 GIVEQCCTSICSLYQLENYCN SEQ ID NO:16 GIVEQCCTSICSLY SEQ ID NO:17 QLENYCN, AND SEQ ID NO:18 CSLYQLE and variations within 75% of exact homology. Variations include natural and modified amino acids.
The rare molecule fragments of insulin can be used to measure the peptidases acting on insulin based on formation of fragments. This includes the list of natural known peptidase and others added to the biological system. Additionally, rare molecule fragments of insulin can be used to measure inhibitor for peptidases acting on insulin peptidases based on the lack formation of fragments. These inhibitor include the c-Terminal fragment of the Adiponectin Receptor, Bikunin, Uristatin and other known natural and synthetic inhibitors of archaelysin, duodenase, calpain-1, ammodytase subfamily M12B peptidases, ALE1 peptidase, CDF peptidase, cathepsin E, meprin alpha subunit, jerdohagin (Trimeresurus jerdonii), carboxypeptidase E, dibasic processing endopeptidase, yapsin-1, yapsin A, PCSK1 peptidase, aminopeptidase B, PCSK1 peptidase, PCSK2 peptidase, insulysin, and matrix metallopeptidase-9 listed in the inhibitor databases.
Rare molecule fragments examples of bioactive proteins and peptides which can be used to measure the presence or absence thereof as an indication of therapeutic effectiveness, stability, usage, metabolism, action on biological pathways (such as actions with proteases, peptidase, enzymes, receptors or other biomolecules), action of inhibition of pathways and other interactions with biological systems. Examples include but are not limited to those listed in databases of approved therapeutic peptides and proteins, such as http://crdd.osdd.net/ as well as other databases of peptides and proteins for dietary supplements, probiotics, food safety, veterinary products, and cosmetics usage. The list of the 467 approved peptide and protein therapies include examples of bioactive proteins and peptides for use in cancer, metabolic disorders, hematological disorders, immunological disorders, genetic disorders, hormonal disorders, bone disorders, cardiac disorders, infectious disease, respiratory disorders, neurological disorders, adjunct therapy, eye disorders, and malabsorption disorder. Bioactive proteins and peptides include those used as anti-thrombins, fibrinolytic, enzymes, antineoplastic agents, hormones, fertility agents, immunosupressive agents, bone related agents, antidiabetic agents, and antibodies
Some specific examples of therapeutic proteins and peptides include glucagon, ghrelin, leptin, growth hormone, prolactin, human placental, lactogen, luteinizing hormone, follicle stimulating hormone, chorionic gonadotropin, thyroid stimulating hormone, adrenocorticotropic hormone, vasopressin, oxytocin, angiotensin, parathyroid hormone, gastrin, buserelin, antihemophilic factor, pancrelipase, insulin, insulin aspart, porcine insulin, insulin lispro, insulin isophane, insulin glulisine, insulin detemir, insulin glargine, immunglobulins, interferon, leuprolide, denileukin, asparaginase, thyrotropin, alpha-1-proteinase inhibitor, exenatide, albumin, coagulation factors, alglucosidase alfa, salmon calcitonin, vasopressin, epidermal growth factor (EGF), cholecystokinin (CCK-8), vacines, human growth hormone and others. Some new examples of therapeutic proteins and peptides include GLP-1-GCG, GLP-1-GIP, GLP-1, GLP-1- GLP-2, and GLP-1-CCKB.
Rare molecules of interest that are highly expressed by adipose tissue include but are not limited to ADIPOQ Adiponectin, C1Q and collagen domain containing, TUSCS Tumor suppressor candidate 5, LEP Leptin, CIDEA Cell death-inducing DFFA-like effector a, CIDEC Cell death-inducing DFFA-like effector C, FABP4 Fatty acid binding protein 4, adipocyte, LIPE, GYG2, PLIN1 Perilipin 1, PLIN4 Perilipin 4, CSN1S1, PNPLA2, RP11-407P15.2 Protein LOC100509620, L GALS12 Lectin, galactoside-binding, soluble 12, GPAM Glycerol-3-phosphate acyltransferase, mitochondrial, PR325317.1 predicted protein, ACACB Acetyl-CoA carboxylase beta, ACVR1C Activin A receptor, type IC, AQP7 Aquaporin 7, CFD Complement factor D (adipsin)m CSN1S1Casein alpha s1, FASN Fatty acid synthase GYG2 Glycogenin 2 KIF25Kinesin family member 25 LIPELipase, hormone-sensitive PNPLA2, Patatin-like phospholipase domain containing 2, SLC29A4 Solute label family 29 (equilibrative nucleoside transporter), member 4 SLC7A10 Solute label family 7 (neutral amino acid transporter light chain, asc system), member 10, SPX Spexin hormone and TIMP4 TIMP metallopeptidase inhibitor 4.
Rare molecules of interest that are highly expressed by adrenal gland and thyroid include but are not limited to CYP11B2 Cytochrome P450, family 11, subfamily B, polypeptide 2, CYP11B1 Cytochrome P450, family 11, subfamily B, polypeptide 1, CYP17A1 Cytochrome P450, family 17, subfamily A, polypeptide 1, MC2R Melanocortin 2 receptor (adreno-corticotropic hormone), CYP21A2 Cytochrome P450, family 21, subfamily A, polypeptide 2, HSD3B2 Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2, TH Tyrosine hydroxylase, AS3MT Arsenite methyltransferase, CYP11A1 Cytochrome P450, family 11, subfamily A, polypeptide 1, DBH Dopamine beta-hydroxylase (dopamine beta-monooxygenase), HSD3B2 Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2, TH Tyrosine hydroxylase, AS3MT Arsenite methyltransferase, CYP11A1 Cytochrome P450, family 11, subfamily A, polypeptide 1, DBH Dopamine beta-hydroxylase (dopamine beta-monooxygenase), AKR1B1 Aldo-keto reductase family 1, member B1 (aldose reductase), NOV Nephroblastoma overexpressed, FDX1 Ferredoxin 1, DGKK Diacylglycerol kinase, kappa, MGARP Mitochondria-localized glutamic acid-rich protein, VWA5B2 Von Willebrand factor A domain containing 5B2, C18orf42 Chromosome 18 open reading frame 42, KIAA1024, MAP3K15 Mitogen-activated protein kinase kinase kinase 15, STAR Steroidogenic acute regulatory protein Potassium channel, subfamily K, member 2, NOV nephroblastoma overexpressed, PNMT phenylethanolamine N-methyltransferase, CHGB chromogranin B (secretogranin 1), and PHOX2A paired-like homeobox 2a.
Rare molecules of interest that are highly expressed by bone marrow include but are not limited to DEFA4 defensin alpha 4 corticostatin, PRTN3 proteinase 3, AZU1 azurocidin 1, DEFA1 defensin alpha 1, ELANE elastase, neutrophil expressed, DEFA1B defensin alpha 1B, DEFA3 defensin alpha 3 neutrophil-specific, MS4A3 membrane-spanning 4-domains, subfamily A, member 3 (hematopoietic cell-specific), RNASE3 ribonuclease RNase A family 3, MPO myeloperoxidase, HBD hemoglobin, delta, and PRSS57 protease, serine 57.
Rare molecules of interest that are highly expressed by the brain include but are not limited to GFAP glial fibrillary acidic protein, OPALIN oligodendrocytic myelin paranodal and inner loop protein, OLIG2 oligodendrocyte lineage transcription factor 2, GRIN1glutamate receptor ionotropic, N-methyl D-aspartate 1, OMG oligodendrocyte myelin glycoprotein, SLC17A7 solute label family 17 (vesicular glutamate transporter), member 7, Clorf61 chromosome 1 open reading frame 61, CREG2 cellular repressor of E1A-stimulated genes 2, NEUROD6 neuronal differentiation 6, ZDHHC22 zinc finger DHHC-type containing 22, VSTM2B V-set and transmembrane domain containing 2B, and PMP2 peripheral myelin protein 2.
Rare molecules of interest that are highly expressed by the endometrium, ovary, or placenta include but are not limited to MMP26 matrix metallopeptidase 26, MMP10 matrix metallopeptidase 10 (stromelysin 2), RP4-559A3.7 uncharacterized protein and TRH thyrotropin-releasing hormone.
Rare molecules of of interest that are highly expressed by gastrointestinal tract, salivary gland, esophagus, stomach, duodenum, small intestine, or colon include but are not limited to GKN1 Gastrokine 1, GIF Gastric intrinsic factor (vitamin B synthesis), PGAS Pepsinogen 5 group I (pepsinogen A), PGA3 Pepsinogen 3, group I (pepsinogen A, PGA4 Pepsinogen 4 group I (pepsinogen A), LCT Lactase, DEFAS Defensin, alpha 5 Paneth cell-specific, CCL25 Chemokine (C-C motif) ligand 25, DEFA6 Defensin alpha 6 Paneth cell-specific, GAST Gastrin, MS4A10 Membrane-spanning 4-domains subfamily A member 10, ATP4A and ATPase, H+/K+ exchanging alpha polypeptide.
Rare molecules of of interest that are highly expressed by heart or skeletal muscle include but are not limited to NPPB natriuretic peptide B, TNNI3 troponin I type 3 (cardiac), NPPA natriuretic peptide A, MYL7 myosin light chain 7 regulatory, MYBPC3 myosin binding protein C (cardiac), TNNT2 troponin T type 2 (cardiac) LRRC10 leucine rich repeat containing 10, ANKRD1 ankyrin repeat domain 1 (cardiac muscle), RD3L retinal degeneration 3-like, BMP10 bone morphogenetic protein 10, CHRNE cholinergic receptor nicotinic epsilon (muscle), and SBK2 SH3 domain binding kinase family member 2.
Rare molecules of of interest that are highly expressed by kidney include but are not limited to UMOD uromodulin, TMEM174 transmembrane protein 174, SLC22A8 solute label family 22 (organic anion transporter) member 8, SLC12A1 solute label family 12 (sodium/potassium/chloride transporter) member 1, SLC34A1 solute label family 34 (type II sodium/phosphate transporter) member 1, SLC22A12 solute label family 22 (organic anion/urate transporter) member 12, SLC22A2 solute label family 22 (organic cation transporter) member 2, MCCD1 mitochondrial coiled-coil domain 1, AQP2 aquaporin 2 (collecting duct), SLC7A13 solute label family 7 (anionic amino acid transporter) member 13, KCNJ1 potassium inwardly-rectifying channel, subfamily J member 1 and SLC22A6 solute label family 22 (organic anion transporter) member 6.
Rare molecules of interest that are highly expressed by lung include but are not limited to SFTPC surfactant protein C, SFTPA1 surfactant protein Al, SFTPB surfactant protein B, SFTPA2 surfactant protein A2, AGER advanced glycosylation end product-specific receptor, SCGB3A2 secretoglobin family 3A member 2, SFTPD surfactant protein D, ROS1 proto-oncogene 1 receptor tyrosine kinase, MS4A15 membrane-spanning 4-domains subfamily A member 15, RTKN2 rhotekin 2, NAPSA napsin A aspartic peptidase, and LRRN4 leucine rich repeat neuronal 4.
Rare molecules of of interest that are highly expressed by liver or gallbladder include but are not limited to APOA2 apolipoprotein A-II, A1BG alpha-1-B glycoprotein, AHSG alpha-2-HS-glycoprotein, F2coagulation factor II (thrombin), CFHR2 complement factor H-related 2, HPX hemopexin, F9 coagulation factor IX, CFHR2 complement factor H-related 2, SPP2 secreted phosphoprotein 2 (24kDa), C9 complement component 9, MBL2 mannose-binding lectin (protein C) 2 soluble and CYP2A6 cytochrome P450 family 2 subfamily A polypeptide 6.
Rare molecules of of interest that are highly expressed by testis or prostate include but are not limited to PRM2 protamine 2, PRM1 protamine 1, TNP1 transition protein 1 (during histone to protamine replacement), TUBA3C tubulin, alpha 3c LELP1late cornified envelope-like proline-rich 1, BOD1L2 biorientation of chromosomes in cell division 1-like 2, ANKRD7 ankyrin repeat domain 7, PGK2 phosphoglycerate kinase 2, AKAP4 A kinase (PRKA) anchor protein 4, TPD52L3 tumor protein D52-like 3, UBQLN3 ubiquilin 3 and ACTL7A actin-like 7A.
Rare cells are those cells that are present in a sample in relatively small quantities when compared to the amount of non-rare cells in a sample. In some examples, the rare cells are present in an amount of about 10−8% to about 10−2% by weight of a total cell population in a sample suspected of containing the rare cells. The phrase “cell rare molecules” refers to rare molecules that are bound in a cell and may or may not freely circulate in a sample. Such cellular rare molecule include biomolecules useful in medical diagnosis of diseases as above and also include all rare molecules and uses previously described in for cell free rare molecules and those for biomolecules used for measurement of rare cells. The rare cells (cell markers) may be, but are not limited to, and malignant cells such as malignant neoplasms or cancer cells; circulating cells, endothelial cells (CD146); epithelial cells (CD326/EpCAM); mesenchymal cells (VIM), bacterial cells, virus, skin cells, sex cells, fetal cells; immune cells (leukocytes such as basophil, granulocytes (CD66b) and eosinophil, lymphocytes such as B cells (CD19,CD20), T cells (CD3,CD4 CD8), plasma cells, and NK cells (CD56), macrophages/monocytes (CD14, CD33), dendritic cells (CD11c, CD123), Treg cells and others), stem cells/precursor (CD34), other blood cells such as progenitor, blast, erythrocytes, thrombocytes, platelets (CD41, CD61, CD62) and immature cells; other cells from tissues such as liver, brain, pancreas, muscle, fat, lung, prostate, kidney, urinary tract, adipose, bone marrow, endometrium, gastrointestinal tract, heart, testis or other for example.
The phrase “population of cells” refers to a group of cells having an antigen or nucleic acid on their surface or inside the cell where the antigen is common to all of the cells of the group and where the antigen is specific for the group of cells. Non-rare cells are those cells that are present in relatively large amounts when compared to the amount of rare cells in a sample. In some examples, the non-rare cells are at least about 10 times, or at least about 102 times, or at least about 103 times, or at least about 104 times, or at least about 105 times, or at least about 106 times, or at least about 107 times, or at least about 108 times greater than the amount of the rare cells in the total cell population in a sample suspected of containing non-rare cells and rare cells. The non-rare cells may be, but are not limited to, white blood cells, platelets, and red blood cells, for example.
The term “Rare cells markers” include, but are not limited to, cancer cell type biomarkers, cancer bio markers, chemo resistance biomarkers, metastatic potential biomarkers, and cell typing markers, cluster of differentiation (cluster of designation or classification determinant) (often abbreviated as CD) which is a protocol used for the identification and investigation of cell surface molecules providing targets for immunophenotyping of cells, for example. Cancer cell type biomarkers include, by way of illustration and not limitation, cytokeratins (CK) (CK1, CK2, CK3, CK4, CKS, CK6, CK7, CK8 and CK9, CK10, CK12, CK 13, CK14, CK16, CK17, CK18, CK19 and CK2), epithelial cell adhesion molecule (EpCAM), N-cadherin, E-cadherin and vimentin, for example. Oncoproteins and oncogenes with likely therapeutic relevance due to mutations include, but are not limited to, WAF, BAX-1, PDGF, JAGGED 1, NOTCH, VEGF, VEGHR, CA1X, MIB1, MDM, PR, ER, SELS, SEMI, PI3K, AKT2, TWIST1, EML-4, DRAFF, C-MET, ABL1, EGFR, GNAS, MLH1, RET, MEK1, AKT1, ERBB2, HER2, HNF1A, MPL, SMAD4, ALK, ERBB4, HRAS, NOTCH1, SMARCB1, APC, FBXW7, IDH1, NPM1, SMO, ATM, FGFR1, JAK2, NRAS, SRC, BRAF, FGFR2, JAK3, RA, STK11, CDH1, FGFR3, KDR, PIK3CA, TP53, CDKN2A, FLT3, KIT, PTEN, VHL, CSF1R, GNA11, KRAS, PTPN11, DDR2, CTNNB1, GNAQ, MET, RB1, AKT1, BRAF, DDR2, MEK1, NRAS, FGFR1, and ROS1, for example.
In certain embodiments, the rare cells may be endothelial cells which are detected using markers, by way of illustration and not limitation, CD136, CD105/Endoglin, CD144/VE-cadherin, CD145, CD34, Cd41 CD136, CD34, CD90, CD31/PECAM-1, ESAM, VEGFR2/Fik-1, Tie-2, CD202b/TEK, CD56/NCAM, CD73/VAP-2, claudin 5, Z0-1, and vimentin. Metastatic potential biomarkers include, but are limited to, urokinase plasminogen activator (uPA), tissue plasminogen activator (tPA), C terminal fragment of adiponectin receptor (Adiponectin Receptor C Terminal Fragment or Adiponectin CTF), kinases (AKT-PIK3, MAPK), vascular adhesion molecules (e.g., ICAM, VCAM, E-selectin), cytokine signaling (TNF-α, IL-1, IL-6), reactive oxidative species (ROS), protease-activated receptors (PARs), metalloproteinases (TIMP), transforming growth factor (TGF), vascular endothelial growth factor (VEGF), endothelial hyaluronan receptor 1 (LYVE-1), hypoxia-inducible factor (HIF), growth hormone (GH), insulin-like growth factors (IGF), epidermal growth factor (EGF), placental growth factor (PDF), hepatocyte growth factor (HGF), nerve growth factor (NGF), platelet-derived growth factor (PDGF), growth differentiation factors (GDF), VEGF receptor (soluble Flt-1), microRNA (MiR-141), Cadherins (VE, N, E), S100 Ig-CTF nuclear receptors (e.g., PPARα), plasminogen activator inhibitor (PAI-1), CD95, serine proteases (e.g., plasmin and ADAM, for example); serine protease inhibitors (e.g., Bikunin); matrix metalloproteinases (e.g., MMP9); matrix metalloproteinase inhibitors (e.g., TIMP-1); and oxidative damage of DNA.
Chemoresistance biomarkers include, by way of illustration and not limitation, PL2L piwi like, 5T4, ADLH, β-integrin, α-6-integrin, c-kit, c-met, LIF-R, chemokines (e.g., CXCR7,CCR7, CXCR4), ESA, CD 20, CD44, CD133, CKS, TRAF2 and ABC transporters, cancer cells that lack CD45 or CD31 but contain CD34 are indicative of a cancer stem cell; and cancer cells that contain CD44 but lack CD24.
The rare molecules from cells may be from any organism, but are not limited to, pathogens such as bacteria, virus, fungus, and protozoa; malignant cells such as malignant neoplasms or cancer cells; circulating endothelial cells; circulating tumor cells; circulating cancer stem cells; circulating cancer mesenchymal cells; circulating epithelial cells; fetal cells; immune cells (B cells, T cells, macrophages, NK cells, monocytes); and stem cells; for example. In some examples of methods in accordance with the invention described herein, the sample to be tested is a blood sample from a mammal such as, but not limited to, a human subject, for example.
Rare cells of interest may be immune cells and include but are not limited to markers for white blood cells (WBC), Tregs (regulatory T cells), B cell, T cells, macrophages, monocytes, antigen presenting cells (APC), dendritic cells, eosinophils, and granulocytes. For example, markers such as, but not limited to, CD3, CD4, CD8, CD11 c, CD14, CD15, CD16, CD19, CD20, CD31, CD33, CD45, CD52, CD56, CD 61, CD66b, CD123, CTLA-4, immunoglobulin, protein receptors and cytokine receptors and other CD marker that are present on white blood cells can be used to indicate that a cell is not a rare cell of interest.
In a particular non-limiting examples white blood cell markers include CD45 antigen (also known as protein tyrosine phosphatase receptor type C or PTPRC) and originally called leukocyte common antigen is useful in detecting all white blood cells. Additionally, CD45 can be used to differentiate different types of white blood cells that might be considered rare cells. For example, granulocytes are indicated by CD45+, CD15+, or CD16+, or CD66b+; monocytes are indicated by CD45+, CD14+; T lymphocytes are indicated by CD45+, CD3+; T helper cells are indicated by CD45+,CD3+, CD4+; cytotoxic T cells are indicated by CD45+, CD3+, CDS+; B-lymphocytes are indicated by CD45+, CD19+or CD45+, CD20+; thrombocytes are indicated by CD45+, CD61+; and natural killer cells are indicated by CD16+, CD56+, and CD3−. Furthermore, two commonly used CD molecules, namely, CD4 and CD8, are, in general, used as markers for helper and cytotoxic T cells, respectively. These molecules are defined in combination with CD3+, as some other leukocytes also express these CD molecules (some macrophages express low levels of CD4; dendritic cells express high levels of CD11c, and CD123. These examples are not inclusive of all marker and are for example only.
In some cases, the rare molecule fragment of lymphocytes include proteins and peptides produced as part of lymphocytes such as immunoglobulin chains, major histocompatibility complex (MHC) molecules, T cell receptors, antigenic peptides, cytokines, chemokines and their receptors (e.g, Interleukins, C-X-C chemokine receptors, etc), programmed death-ligand and receptors (Fas, PDL1, and others) and other proteins and peptides that are either parts of the lymphocytes or bind to the lymphocytes.
In other cases the rare cell maybe a stem cell and include but are not limited to the rare molecule fragment of stem markers cells including, PL2L piwi like, 5T4, ADLH, β-integrin, a6 integrin, c-kit, c-met, LIF-R, CXCR4, ESA, CD 20, CD44, CD133, CKS, TRAF2 and ABC transporters, cancer cells that lack CD45 or CD31 but contain CD34 are indicative of a cancer stem cell; and cancer cells that contain CD44 but lack CD24. Stem cell markers include common pluripotency markers like FoxD3, E-Ras, Sa114, Stat3, SUZ12, TCF3, TRA-1-60, CDX2, DDX4, Miwi, Mill GCNF, Oct4, Klf4, Sox2,c-Myc, TIF 1□Piwi1, nestin, integrin, notch, AML, GATA, Esrrb, Nr5a2, C/EBPα, Lin28, Nanog, insulin, neuroD, adiponectin, apdiponectin receptor, FABP4, PPAR, and KLF4 and the like.
In other cases the rare cell maybe a pathogen, bacteria, or virus or group thereof which includes, but is not limited to, gram-positive bacteria (e.g., Enterococcus sp. Group B streptococcus, Coagulase-negative staphylococcus sp. Streptococcus viridans, Staphylococcus aureus and saprophyicus, Lactobacillus and resistant strains thereof, for example); yeasts including, but not limited to, Candida albicans, for example; gram-negative bacteria such as, but not limited to, Escherichia coli, Klebsiella pneumoniae, Citrobacter koseri, Citrobacter freundii, Klebsiella oxytoca, Morganella morganii, Pseudomonas aeruginosa, Proteus mirabilis, Serratia marcescens, Diphtheroids (gnb), Rosebura, Eubacterium hallii. Faecalibacterium prauznitzli, Lactobacillus gasseria, Streptococcus mutans, Bacteroides thetaiotaomicron, Prevotella Intermedia, Porphyromonas gingivalis Eubacterium rectale Lactobacillus amylovorus, Bacillus subtilis, Bifidobacterium longum Eubacterium rectale, E. eligens, E. dolichum, B. thetaiotaomicron, E. rectale, Actinobacteria, Proteobacteria, B. thetaiotaomicron, Bacteroides Eubacterium dolichum, Vulgatus, B. fragilis, bacterial phyla such as Firmicuties (Clostridia, Bacilli, Mollicutes), Fusobacteria, Actinobacteria, Cyanobacteria, Bacteroidetes, Archaea, Proteobacteria, and resistant strains thereof, for example; viruses such as, but not limited to, HIV, HPV, Flu, and MERSA, for example; and sexually transmitted diseases. In the case of detecting rare cell pathogens, a particle reagent is added that comprises a binding partner, which binds to the rare cell pathogen population. Additionally, for each population of cellular rare molecules on the pathogen, a reagent is added that comprises a binding partner for the cellular rare molecule, which binds to the cellular rare molecules in the population.
As mentioned above, some examples in accordance with the invention described herein are directed to methods of detecting a cell, which include natural and synthetic cells. The cells are usually from a biological sample that is suspected of containing target rare molecules, non-rare cells and rare cells. The samples may be biological samples or non-biological samples. Biological samples may be from a mammalian subject or a non-mammalian subject. Mammalian subjects may be, e.g., humans or other animal species.
The apparatus and reagents for conducting a method in accordance with the invention described herein may be present in a kit useful for conveniently performing the method. In one embodiment, a kit comprises in packaged combination modified affinity agent one for each different rare molecule to be isolated. The kit may also comprise one or more, cell affinity agent to for cell containing the rare molecules, the porous matrix, optional capture particles, solution for spraying, filtering and reacting the mass labels, droplet generators, capillaries nozzles for droplet formation, capillary channels for dilution, concentration or routing of solutions, droplets and molecules, solutions for forming droplets, solutions for breaking droplets The composition may contain labeled particles or capture particle entities, for example, as described above. Porous matrix, liquid holding wells, microwells, porous matrix and droplet generators can be in housing where the house can have vents, capillaries, chambers, liquid inlets and outlets. A solvent can be applied to droplet generators, wells and porous matrix. Porous matrix can be removable.
Depending on method for analysis of rare molecules selected, reagents discussed in more detail herein below, may or may not be used to treat the samples during, prior or after the extract molecules from the rare cells and cell free samples.
The relative amounts of the various reagents in the kits can be varied widely to provide for concentrations of the reagents that substantially optimize the reactions that need to occur during the present methods and further to optimize substantially the sensitivity of the methods. Under appropriate circumstances one or more of the reagents in the kit can be provided as a dry powder, usually lyophilized, including excipients, which on dissolution will provide for a reagent solution having the appropriate concentrations for performing a method in accordance with the invention described herein. The kit can further include a written description of a method utilizing reagents in accordance with the invention described herein.
The phrase “at least” as used herein means that the number of specified items may be equal to or greater than the number recited. The phrase “about” as used herein means that the number recited may differ by plus or minus 10%; for example, “about 5” means a range of 4.5 to 5.5.
The spray solvent can be any spray solvent employed in electrospray mass spectroscopy. In some examples, solvents for electrospray ionization include, but are not limited to, polar organic compounds such as, e.g., alcohols (e.g., methanol, ethanol and propanol), acetonitrile, dichloromethane, dichloroethane, tetrahydrofuran, dimethylformamide, dimethyl sulphoxide, and nitromethane; non-polar organic compounds such as, e.g., hexane, toluene, cyclohexane; and water, for example, or combinations of two or more thereof. Optionally, the solvents may contain one or more of an acid or a base as a modifier (such as, volatile salts and buffer, e.g., ammonium acetate, ammonium biocarbonate, volatile acids such as formic acid, acetic acids or trifluoroacetic acid, heptafluorobutyric acid, sodium dodecyl sulphate, ethylenediamine tetraacetic acid, and non-volatile salts or buffers such as, e.g., chlorides and phosphates of sodium and potassium, for example.
In many examples, the sample is contacted with an aqueous phase prior to forming an emulsion. The aqueous phase may be solely water or which may also contain organic solvents such as, for example, polar aprotic solvents, polar protic solvents such as, e.g., dimethylsulfoxide (DMSO), dimethylformamide (DMF), acetonitrile, an organic acid, or an alcohol, and non-polar solvents miscible with water such as, e.g., dioxane, in an amount of about 0.1% to about 50%, or about 1% to about 50%, or about 5% to about 50%, or about 1% to about 40%, or about 1% to about 30%, or about 1% to about 20%, or about 1% to about 10%, or about 5% to about 40%, or about 5% to about 30%, or about 5% to about 20%, or about 5% to about 10%, by volume. In some examples, the pH for the aqueous medium is usually a moderate pH. In some examples, the pH of the aqueous medium is about 5 to about 8, or about 6 to about 8, or about 7 to about 8, or about 5 to about 7, or about 6 to about 7, or physiological pH. Various buffers may be used to achieve the desired pH and maintain the pH during any incubation period. Illustrative buffers include, but are not limited to, borate, phosphate (e.g., phosphate buffered saline), carbonate, TRIS, barbital, PIPES, HEPES, MES, ACES, MOPS, and BICINE.
Cell and/or droplet lysis reagents are those that involve disruption of the integrity of the cellular membrane with a lytic agent, thereby releasing intracellular contents of the cells. Numerous lytic agents are known in the art. Lytic agents that may be employed may be physical and/or chemical agents. Physical lytic agents include, blending, grinding, and sonication, and combinations or two or more thereof, for example. Chemical lytic agents include, but are not limited to, non-ionic detergents, anionic detergents, amphoteric detergents, low ionic strength aqueous solutions (hypotonic solutions), bacterial agents, and antibodies that cause complement dependent lysis, and combinations of two or more thereof, for example, and combinations or two or more of the above. Non-ionic detergents that may be employed as the lytic agent include both synthetic detergents and natural detergents.
The nature and amount or concentration of lytic agent employed depends on the nature of the cells, the nature of the cellular contents, the nature of the analysis to be carried out, and the nature of the lytic agent, for example. The amount of the lytic agent is at least sufficient to cause lysis of cells to release contents of the cells. In some examples, the amount of the lytic agent is (percentages are by weight) about 0.0001% to about 0.5%, about 0.001% to about 0.4%, about 0.01% to about 0.3%, about 0.01% to about 0.2%, about 0.1% to about 0.3%, about 0.2% to about 0.5%, about 0.1% to about 0.2%, for example.
Removal of lipids, platelets, and non rare cells may be carried out using, by way of illustration and not limitation, detergents, surfactants, solvents, and binding agents, and combinations of two or more of the above, for example, and combinations of two or more thereof. The use of a surfactant or a detergent as a lytic agent as discussed above accomplishes both cell lysis and removal of lipids. The amount of the agent for removing lipids is at least sufficient to remove at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90%, or at least about 95% of lipids from the cellular membrane. In some examples the amount of the lytic agent is (percentages by weight) about 0.0001% to about 0.5%, about 0.001% to about 0.4%, about 0.01% to about 0.3%, about 0.01% to about 0.2%, about 0.1% to about 0.3%, about 0.2% to about 0.5%, about 0.1% to about 0.2%, for example.
In some examples, it may be desirable to remove or denature proteins from the cells, which may be accomplished using a proteolytic agent such as, but not limited to, proteases, heat, acids, phenols, and guanidinium salts, and combinations of two or more thereof, for example. The amount of the proteolytic agent is at least sufficient to degrade at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90%, or at least about 95% of proteins in the cells. In some examples the amount of the lytic agent is (percentages by weight) about 0.0001% to about 0.5%, about 0.001% to about 0.4%, about 0.01% to about 0.3%, about 0.01% to about 0.2%, about 0.1% to about 0.3%, about 0.2% to about 0.5%, about 0.1% to about 0.2%, for example.
In some examples, samples are collected from the body of a subject into a suitable container such as, but not limited to, a cup, a bag, a bottle, capillary, or a needle, for example. Blood samples may be collected into VACUTAINER® containers, for example. The container may contain a collection medium into which the sample is delivered. The collection medium is usually a dry medium and may comprise an amount of platelet deactivation agent effective to achieve deactivation of platelets in the blood sample when mixed with the blood sample.
Platelet deactivation agents can be added to the sample such as, but are not limited to, chelating agents such as, for example, chelating agents that comprise a triacetic acid moiety or a salt thereof, a tetraacetic acid moiety or a salt thereof, a pentaacetic acid moiety or a salt thereof, or a hexaacetic acid moiety or a salt thereof. In some examples, the chelating agent is ethylene diamine tetraacetic acid (EDTA) and its salts or ethylene glycol tetraacetate (EGTA) and its salts. The effective amount of platelet deactivation agent is dependent on one or more of the nature of the platelet deactivation agent, the nature of the blood sample, level of platelet activation and ionic strength, for example. In some examples, for EDTA as the anti-platelet agent, the amount of dry EDTA in the container is that which will produce a concentration of about 1.0 to about 2.0 mg/mL of blood, or about 1.5 mg/mL of the blood. The amount of the platelet deactivation agent is that which is sufficient to achieve at least about 90%, or at least about 95%, or at least about 99% of platelet deactivation.
Moderate temperatures are normally employed, which may range from about 5° C. to about 70° C. or from about 15° C. to about 70° C. or from about 20° C. to about 45° C., for example. The time period for an incubation period is about 0.2 seconds to about 6 hours, or about 2 seconds to about 1 hour, or about 1 to about 5 minutes, for example. These temperature can be used to reverse fixations or other reactions.
In many examples, the above combination is provided in an aqueous medium, which may be solely water or which may also contain organic solvents such as, for example, polar aprotic solvents, polar protic solvents such as, e.g., dimethylsulfoxide (DMSO), dimethylformamide (DMF), acetonitrile, an organic acid, or an alcohol, and non-polar solvents miscible with water such as, e.g., dioxane, in an amount of about 0.1% to about 50%, or about 1% to about 50%, or about 5% to about 50%, or about 1% to about 40%, or about 1% to about 30%, or about 1% to about 20%, or about 1% to about 10%, or about 5% to about 40%, or about 5% to about 30%, or about 5% to about 20%, or about 5% to about 10%, by volume. In some examples, the pH for the aqueous medium is usually a moderate pH. In some examples the pH of the aqueous medium is about 5 to about 8, or about 6 to about 8, or about 7 to about 8, or about 5 to about 7, or about 6 to about 7, or physiological pH, for example. Various buffers may be used to achieve the desired pH and maintain the pH during any incubation period. Illustrative buffers include, but are not limited to, borate, phosphate (e.g., phosphate buffered saline), carbonate, TRIS, barbital, PIPES, HEPES, MES, ACES, MOPS, and BICINE, for example.
An amount of aqueous medium employed is dependent on a number of factors such as, but not limited to, the nature and amount of the sample, the nature and amount of the reagents, the stability of rare cells, and the stability of rare molecules, for example. In some examples in accordance with the invention described herein, the amount of aqueous medium per 10 mL of sample is about 5 mL to about 100 mL, or about 5 mL to about 80 mL, or about 5 mL to about 60 mL, or about 5 mL to about 50 mL, or about 5 mL to about 30 mL, or about 5 mL to about 20 mL, or about 5 mL to about 10 mL, or about 10 mL to about 100 mL, or about 10 mL to about 80 mL, or about 10 mL to about 60 mL, or about 10 mL to about 50 mL, or about 10 mL to about 30 mL, or about 10 mL to about 20 mL, or about 20 mL to about 100 mL, or about 20 mL to about 80 mL, or about 20 mL to about 60 mL, or about 20 mL to about 50 mL, or about 20 mL to about 30 mL, for example.
Where one or more of the rare nucleic acids are part of a cell, the aqueous medium may also comprise a lysing agent for lysing of cells. A lysing agent is a compound or mixture of compounds that disrupt the integrity of the matrix of cells thereby releasing intracellular contents of the cells. Examples of lysing agents include, but are not limited to, non-ionic detergents, anionic detergents, amphoteric detergents, low ionic strength aqueous solutions (hypotonic solutions), bacterial agents, aliphatic aldehydes, and antibodies that cause complement dependent lysis, for example. Various ancillary materials may be present in the dilution medium. All of the materials in the aqueous medium are present in a concentration or amount sufficient to achieve the desired effect or function.
In some examples, it may be desirable to fix the nucleic acids, proteins or cells of the sample. Fixation immobilizes the nucleic acids and preserves the nucleic acids structure and maintains the cells in a condition that closely resembles the cells in an in vivo-like condition and one in which the antigens of interest are able to be recognized by a specific affinity agent. The amount of fixative employed is that which preserves the nucleic acids or cells but does not lead to erroneous results in a subsequent assay. The amount of fixative depends on one or more of the nature of the fixative and the nature of the cells, for example. In some examples, the amount of fixative is about 0.05% to about 0.15% or about 0.05% to about 0.10%, or about 0.10% to about 0.15%, for example, by weight. Agents for carrying out fixation of the cells include, but are not limited to, cross-linking agents such as, for example, an aldehyde reagent (such as, e.g., formaldehyde, glutaraldehyde, and paraformaldehyde,); an alcohol (such as, e.g., C1-C5 alcohols such as methanol, ethanol and isopropanol); a ketone (such as a C3-C5 ketone such as acetone); for example. The designations C1-C5 or C3-C5 refer to the number of carbon atoms in the alcohol or ketone. One or more washing steps may be carried out on the fixed cells using a buffered aqueous medium.
In examples in which fixation is employed, extraction of nucleic acids can include a procedure for de-fixation prior to amplification. De-fixation may be accomplished employing, by way of illustration and not limitation, heat or chemicals capable of reversing cross-linking bonds, or a combination of both, for example.
In some examples utilizing the techniques, it may be necessary to subject the rare cells to permeabilization. Permeabilization provides access through the cell membrane to nucleic acids of interest. The amount of permeabilization agent employed is that which disrupts the cell membrane and permits access to the nucleic acids. The amount of permeabilization agent depends on one or more of the nature of the permeabilization agent and the nature and amount of the rare cells, for example. In some examples, the amount of permeabilization agent by weight is about 0.1% to about 0.5%, or about 0.1% to about 0.4%, or about 0.1% to about 0.3%, or about 0.1% to about 0.2%, or about 0.2% to about 0.5%, or about 0.2% to about 0.4%, or about 0.2% to about 0.3%, for example. Agents for carrying out permeabilization of the rare cells include, but are not limited to, an alcohol (such as, e.g., C1-C5 alcohols such as methanol and ethanol); a ketone (such as a C3-C5 ketone such as acetone); a detergent (such as, e.g., saponin, Triton® X-100, and Tween®-20); for example. One or more washing steps may be carried out on the permeabilized cells using a buffered aqueous medium.
The following examples further describe the specific embodiments of the invention by way of illustration and not limitation and are intended to describe and not to limit the scope of the invention. Parts and percentages disclosed herein are by volume unless otherwise indicated.
All chemicals may be purchased from the Sigma-Aldrich Company (St. Louis Mo.) unless otherwise noted. Abbreviations:
A group of cells of the same type but different genotype are isolated. In this example it was a group of 106 or more different antibody producing cells prepared by hybridoma techniques. In other examples, the group of cells were other rare cell types and the affinity agent was for a rare cell molecule. Preparation of cells with label particle with an antigen, in this case Bikunin protein (BBI Inc) and a fluorescent label, in this case Dylight 488. The compound library of 106 different antibody producing hybridoma cells are bound to the label particle using bikinin as an affinity agent for immunoglobulin IgG molecules of interest. In other cases a cell cluster of antibody producing hybridoma cells are bound to the molecules of interest. Alternative the cells can be labeled with fluorescent substrate for molecules of interest. Unbound affinity agent and/or fluorescent substrate, are washed away with and cells are mixed into an aqueous buffer with surfactant for droplet formation.
A group of different of 106 or more cDNA genes were isolated from the antibody producing cells (as above) for the variable kappa, gamma and lambda immunoglobulin domains. Additional unique B cell can be obtained by FACS sorting using antigen binding with fluorescent labels. Once isolated, the mRNA for variable kappa, gamma and lambda immuno-globulin domains are convereted to a cDNA library by reverse transcriptase. In other samples, cell free RNA or DNA isolated from human blood can be used to generate a group of cDNA genes by cDNA converetion by reverse transcrptase or DNA polymerase respectively. The cDNA library was captured onto capture particle with a nucleic acid affinity agent. This library was multiplex with different labeled nanoparticles (15 to 200 nm) with unique releasable MS and a fluorescent labels
A group of different protein variations of insulin were isolated from the human blood using an capture particle and unique antibodies for insulin fragments. Unbound proteins were washed away using a magnet. The antibodies used were biotinylated. The variations of insulin were prepared for detection by treatment of capture particle with label particle which was a labeled nanoparticles (15 to 200 nm) with a releasable MS, in this case a peptide attached by a sulfidryl, and non-releasable fluorescent label, in this case Dylight 488 attached to NeutrAvidin. The labeled particle biotins are bound to capture particle NeutrAvidin and unbound label particles are washed away. The compound library of 106 different capture and label particles which are bound are dissolved into an aqueous media.
A group of different droplets were generated from protein variations of insulin isolated from the human blood using a capture particle and unique antibodies for insulin fragments. Unbound proteins were washed away using a magnet. The antibodies used were biotinylated.
The variations of insulin were prepared for detection by treatment of capture particle with label particle which was a labeled nanoparticles (15 to 200 nm) with a releasable MS, in this case a peptide attached by a sulfidryl, and non-releasable fluorescent label, in this case Dylight 488 attached to NeutrAvidin. The label particle biotins are bound to capture particle NeutrAvidin and unbound label particles are washed away. The compound library of 106 different capture and labeled particles are bound are dissolved into an aqueous media. Droplets were generated such that only one capture particle was present for each droplet. Droplets were generated in the droplet generator (Bio-Rad QX100 system) containing the library of protien compounds.
A method of removing the empty droplets but retaining contents of full droplets by size exclusion filtration droplet were diluted in PBS, and filtered through as filtration process as previously described in (Using Automated Microfluidic Filtration and Multiplex Immunoassay Magbanua M J M, Pugia M, Lee J S, Jabon M, Wang V, et al. (2015) A Novel Strategy for Detection and Enumeration of Circulating Rare Cell Populations in Metastatic Cancer Patients Using Automated Microfluidic Filtration and Multiplex Immunoassay. PLoS ONE 10(10)). The only change to the process was to use a vacuum filtration unit (Biotek Inc) for a standard ELISA plate fitted with the standard.
The sample was filtered through liquid holding wells typical of 96 well ELISA plates with micron wells arranged in each liquid holding wells The liquid holding wells of 6.5 mm diameter each held 200 microwells of 200 um diameter and being 400 um center to center to center and 360 μm deep. Each 96 well full ELISA plate hold 96 sets of 200 micro wells allow a to complete an array of 19200 microwells. The bottom of each microwell has a porous matrix.
A porous matrix with 8.0 μm pores was used for the cell library and 1.0 μm pores for the protein library and 0.1 μm pores for the gene or 1.0 μm if captured on a particle or 8 μm for a droplet library. The cells in this library were ˜10 μm diameter (5 to 30 μm range), nucleic acids cDNA particle were ˜20 nm diameter (10 to 400 nm range), and protein capture with label particles were ˜1.5 μm diameter (1 to 2 μm range), droplets with protein capture with label particles were ˜10 μm diameter (5 to 20 μm range). Cell clusters were ˜75 μm average diameter (50 to 300 μm range). Each droplet library contained 104 to 106 unique molecules in full droplets and 106 to 109 empty droplet.
Cell, droplets, particles and genes were filtrated into a micro wells, sample on the porous matrix was subjected to a negative mBar, that is, a decrease greater than about −100 mBar from atmospheric pressure. The vacuum applied varied from −10 to −100 mBar during filtration. The droplets in a diluted sample was placed into the filtration station without mixing and the sample was filtered through the porous matrix. In all cases the porous matrix was at the bottom of a well. The microwells ˜50 μm diameter for cells, ˜100 nm diameter for cDNA, were ˜5 μm diameter for protein capture particles and were ˜20 μm diameter for droplets. After the liquid was removed by vacuum filtration, a surfactant, in this case 0.5% Triton X 100 in PBS was added to wash the unbound materials.
The contents of the microwells were measured by fluorescent microscopy and digitally imaged to locate the wells by move of membrane to imager and complete digital image of macro well. Analyze image for fixed position readout for 106 wells/frame for four channels. This identified the microwells which are full and with affinity agent.
The microwells are moved to the mass spectometer for analysis on to an XY stage, and stage moved to microwell positions for sampling. Spray solvent was added and mass label released and measured. The mass labels serve as a unique label to identify the binding event to the particle. Each particle represents a unique binding event. For example, in the case of nucleic acids the barcode corresponds to the genes in cDNA captured onto the particle. In the case of a cell the barcode corresponds. In the case of proteins, antibody binding was demonstrated.
The measure of affinity binding to protein was demonstrated for a well containing cells, particles or droplets. Release well contents of identified microwells to PCR plate was also demonstrated by aligning to microwell positions for sampling and amplification. The process of using a fluorescent microscopy for identification of position affinity agent was demonstrated as rapid and completed in <1 h for all wells. The process of using a mass spectroscopy for measurement of top 100 affinity binding events was rapid and completed in <1 h for all wells. The process for removal of gene from 100 well was rapid and completed in <1 h for all wells. Overall this demonstrated a method for analysis of multiplex large panels of different molecular assays by screening high density libraries of 10,000 elements in less than 3 h.
Commonly owned pending U.S. application Ser. No. 15/941,059 entitled Methods And Apparatus For Removal Of Small Volume From A Filtration Device filed Mar. 30, 2018 and Ser. No. 15/941,125 entitled Methods And Apparatus For Selective Nucleic Acid Analysis filed Mar. 30, 2018 are both incorporated by reference herein.
All patents, patent applications and publications cited in this application including all cited references in those patents, applications and publications, are hereby incorporated by reference in their entirety for all purposes to the same extent as if each individual patent, patent application or publication were so individually denoted.
While the many embodiments of the invention have been disclosed above and include presently preferred embodiments, many other embodiments and variations are possible within the scope of the present disclosure and in the appended claims that follow. Accordingly, the details of the preferred embodiments and examples provided are not to be construed as limiting. It is to be understood that the terms used herein are merely descriptive rather than limiting and that various changes, numerous equivalents may be made without departing from the spirit or scope of the claimed invention.
This application claims the priority benefit under 35 U.S.C. section 119 of U.S. Provisional Patent Application No. 62/490,082 entitled “Microwell Collection Of Particles” filed on Apr. 26, 2017; and which is in its entirety herein incorporated by reference.
| Number | Date | Country | |
|---|---|---|---|
| 62490082 | Apr 2017 | US |
