Ncc2705-the genome of a bifodobacterium

Abstract

The present invention pertains to a novel micro-organism of the genus Bifidobacterium longum, in particular to its genomic and plasmid sequence and to a method of producing polypeptides of said Bifidobacterium, respectively. The invention also relates to methods of detecting these nucleic acids or polypeptides, respectively. A data carrier is provided comprising nucleotide sequences and/or polypeptide sequences of NCC2705. In addition, the present invention pertains to the Bifidobacterium longum strain NCC2705 and also to food and pharmaceutical compositions containing said Bifidobacterium or active components thereof for the prevention and/or treatment of diarrhoea brought about by rotaviruses and pathogenic bacteria.

Description

[0001] The present invention pertains to a novel micro-organism of the genus Bifidobacterium longum, in particular to its genomic and plasmid sequence and to a method of producing polypeptides of said Bifidobacterium, respectively. The invention also relates to methods of detecting these nucleic acids or polypeptides, respectively. A data carrier is provided comprising nucleotide sequences and/or polypeptide sequences of NCC2705. In addition, the present invention pertains to the Bifidobacterium longum strain NCC2705 and also to food and pharmaceutical compositions containing said Bifidobacterium or active components thereof for the prevention and/or treatment of diarrhoea brought about by rotaviruses and pathogenic bacteria.

[0002] Organisms that produce lactic acid as a major metabolic component have been known since decades.

[0003] These bacteria are normally found in milk or in milk processing factories, respectively, living or decaying plants but also in the intestine of man and animals. These microorganisms, summarized under the term “lactic acid bacteria”, represent a rather inhomogeneous group and comprise the genera Lactococcus, Lactobacillus, Streptococcus, Bifidobacterium, Pediococcus etc.

[0004] Lactic acid bacteria have been utilized by mankind as fermenting agents for the preservation of food taking benefit of a low pH and the action of products generated during the fermentative activity thereof to inhibit the growth of spoilage bacteria. In addition, lactic acid bacteria have also been used for preparing a variety of different foodstuff such as cheese, yogurt and other fermented dairy products from milk.

[0005] Quite recently lactic acid bacteria have attracted a great deal of attention in that some strains have been found to exhibit valuable properties to man and animals upon ingestion. In particular, specific strains of the genus Lactobacillus or Bifidobacterium have been found to pass the gastrointestinal tract in a viable and live form without getting destroyed in the upper part thereof, especially by the impact of the low pH prevailing in the stomach and be able to colonize the intestinal mucosa, with their temporary or sustained maintenance in the gut being presumed to bring about numerous positive effects on the health of the living beings. These strains are generically termed probiotics.

[0006] EP 0 768 375 discloses such a specific strain of the genus Bifidobacterium, that is capable to become implanted in the intestinal flora and may adhere to intestinal cells. This Bifidobacterium is reported to assist in immuno-modulation, being capable to competitively exclude adhesion of pathogenic bacteria to intestinal cells, thus supporting the maintenance of the individual's health.

[0007] In view of the valuable properties particular strains of lactic acid bacteria may provide, there is a desire in the art for additional lactic acid bacterial strains that are beneficial to the well being of man and/or animal. In addition, a more detailed information is desired relating to the biology of these strains, in particular as regards the interaction with the hosts, the phenomena of passing different environmental conditions in the gut as well as having the capability to adhere to the intestine's mucosa and eventually the involvement in the enhancement of the immune system and defense against pathogens, which information will allow a better understanding of these mechanisms.

[0008] Consequently, a problem of the present invention is to provide substantial data about bacterial strains that exhibit properties beneficial for man and/or animals.

[0009] In view of said problem, a subject of the present invention resides in the nucleotide sequence having the sequence SEQ. ID. NO. 1 of the lactic acid bacterium Bifidobacterium longum NCC2705 genome and/or the nucleotide sequence SEQ ID. No 1099 of the plasmid contained tehrein. The invention is, however, not limited to the sequences indicated in SEQ. ID. NO. 1 and SEQ ID. NO. 2, respectively, but encompasses genomes and nucleotides encoding polypeptides of strain variants, polymorphisms, allelic variants, and mutants thereof.

[0010] In the figures,

[0011] FIG. 1 shows a graph, indicating the capability of Bifidobacterium longum NCC 2705 to adhere to human intestinal cells in culture; as a comparison another Bifidobacterium strain BL28 Cal was used;

[0012] FIG. 2 shows the pathogen sensitivity of pathogenic bacteria towards Bifidobacterium longum NCC2705;

[0013] FIG. 3 shows the activity of the cell lines NCC2705 and B1 28 against S. typhimurium SL1344 infecting Caco-2 cells;

[0014] FIG. 4 shows the rate of survival of mice infected with Salmonella typhimurium SL 1344 and treated with the Bifidobacterium NCC2705.

[0015] FIG. 5 shows a scheme illustrating the cell culture screening for assessing rotaviral protective properties of the bacterial strain NCC 2705.

[0016] The present invention is based on whole-genome sequencing of the genome of the Bifidobacterium longum strain NCC 2705, that has been deposited with the Institute Pasteur according to the Budapest Treaty on Jan. 29th, 2001 receiving the deposit no. CNCM I-1-2618.

[0017] In a first aspect the present invention relates to nucleotide sequences selected from the group comprising (a) the nucleotide sequence of SEQ. ID. NO. 1; (b) a nucleotide sequence exhibiting at least 90% identity with the sequence of SEQ. ID. NO. 1; or (c) a nucleotide sequence that is homologous or hybridizes to SEQ ID. No. 1 under stringent conditions, or parts thereof.

[0018] In another aspect the invention relates to nucleotide sequences selected from the group comprising (a) the nucleotide sequence of SEQ. ID. NO. 2; (b) a nucleotide sequence exhibiting at least 90% identity with the sequence of SEQ. ID. NO. 2; or (c) a nucleotide sequence that is homologous or hybridizes to SEQ ID. NO. 2 under stringent conditions or parts thereof.

[0019] The terms genome or genomic sequence shall be understood to mean the sequence of the chromosome of Bifidobacterium longum. The term plasmid shall be understood to designate any extrachromosomal piece of DNA contained in the Bifidobacterium of the present invention. Nucleotide sequence, polynucleotide or nucleic acid are understood to desigante a double-stranded DNA, a single-stranded DNA or transcriptional products of the said DNAs at various length including oligonuclotides of about 10 to 100 nucleotides in length.

[0020] A homologous nucleotide sequence according to the present invention is understood to mean a nucleotide sequence having a percentage identity with the bases of the nucleotide sequence SEQ. ID. NO. 1 or SEQ. ID. NO. 2 of at least 90% and more preferably 95%, 96%, 97%, 98% or 99%. The said homologous may comprise, e.g., the sequences corresponding to the genomic sequence or to the sequences of its representative fragments of a bacterium belonging to the Bifidobacterium species, preferably the Bifidobacterium longum species, as well as the sequences corresponding to the genomic sequence or to the sequences of its representative fragments of a bacterium belonging to the variants of the species Bifidobacterium. In the present invention, the terms species and genus are mutually interchangeable.

[0021] These homologous sequences may thus correspond to variations linked to mutations within the same species or between species and may correspond in particular to truncations, substitutions, deletions and/or additions of at least one nucleotide. The said homologous sequences may also correspond to variations linked to the degeneracy of the genetic code or to a bias in the genetic code which is specific to the family, to the species or to the variant and which are likely to be present in Bifidobacterium.

[0022] Protein and/or nucleic acid sequence homologies may be evaluated using any of the variety of sequence comparison algorithms and programs known in the art. Such algorithms and programs include, but are by no means limited to, TBLASTN, BLASTP, FASTA, TFASTA, and CLUSTALW (see e.g. Pearson and Lipman, 1988, Proc. Natl. Acad. Sci. USA 85 (8): 2444-2448; Altschul et al., 1990, J. Mol. Biol. 215 (3): 403-410; Thompson et al., 1994, Nucleic Acids Res. 22 (2): 4673-4680; Higgins et al., 1996, Methods Enzymol. 266: 383-402; Altschul et al., 1990, J. Mol. Biol. 215 (3): 403-410; Altschul et al., 1993, Nature Genetics 3: 266-272).

[0023] In a particularly preferred embodiment, protein and nucleic acid sequence homologies are evaluated using the Basic Local Alignment Search Tool (“BLAST”) which is well known in the art (supra). In particular, four specific BLAST programs have been used to perform the following task:

[0024] (1) BLASTP: Compares an amino acid query sequence against a protein sequence database

[0025] (2) BLASTN: Compares a nucleotide query sequence against a nucleotide sequence database

[0026] (3) BLASTX: Compares a nucleotide query sequence translated in all reading frames against a protein sequence database

[0027] (4) TBLASTN: Compares a protein query sequence against a nucleotide sequence database dynamically translated in all reading frames

[0028] Among these representative fragments, those capable of hybridizing under stringent conditions with a nucleotide sequence according to the invention are preferred. Hybridization under stringent conditions means that the temperature and ionic strength conditions are chosen such that they allow hybridization to be maintained between two complementary DNA fragments. Such conditions of high stringency may e.g. be achieved by carrying out the hybridisation at a preferred temperature of 65° C. in the presence of SSC buffer, e.g. 1×SSC corresponding to 0.15 M NaCl and 0.05 M Na-citrate. The washing steps may be, for example, the following: 2×SSC, 0.1% SDS at room temperature followed by three washes with 1×SSC, 0.1% SDS; 0.5×SSC, 0.1% SDS; 0.1×SSC, 0.1% SDS at 68 C for 15 minutes.

[0029] The nucleotide sequences SEQ. ID. NO. 1 and SEQ. ID. NO. 2, respectively, have been obtained by sequencing the genome of and the plasmid contained in Bifidobacterium longum NCC2705 by the method of directed sequencing after fluorescent automated sequencing of the inserts of clones and assembling of these sequences of nucleotide fragments (inserts) by means of softwares. To this end, fragments of the genome were created, ligated into suitable vectors for amplification and propagation and the corresponding fragments were sequenced. Overlaps and the final arrangement of the fragments, the nucleotide sequence thereof, were assessed by the aid of appropiate softwares.

[0030] The present invention may be utilized for producing polypeptides by using the knowledge of the open reading frames (ORFs) as derived from SEQ. ID. NO. 1. Therefore, according to another aspect the present invention provides a method of producing a polypeptide by choosing an open reading frame (ORF) of the Bifidobacterium longum genome and expressing the polypeptide desired according to well known techniques.

[0031] Nucleic acid molecules derived from the genomic sequence as identified by SEQ. ID. NO. 1 may be obtained, by e.g. specific amplification of the corresponding sequence using the polymerase chain reaction. Due to the sequence information provided herein the skilled person may design and synthesize any suitable primer nucleotide and amplify a fragment of interest using the polymerase chain reaction. Therefore, the present invention also comprises nucleotide sequences selected from sequence SEQ. ID. NO. 1 which can be used as a primer for the amplification of nucleic acid sequences. Other techniques for amplifying the target nucleic acid may of course be also be used, such as e.g. the TAS (Transcription-based Amplification System) technique, the 3SR (Self-Sustained Sequence Replication) technique, the NASBA (Nucleic Acid Sequence Based Amplification) technique, the SDA (Strand Displacement Amplification) technique or the TMA (Transcription Mediated Amplification) technique etc.

[0032] The (poly)nucleotides may also be used as probes and techniques for amplifying or modifying a nucleic acid serving as a probe, such as e.g. the LCR (Ligase Chain Reaction) technique, the RCR (Repair Chain Reaction) technique, the CPR (Cycling Probe Reaction) technique or the Q-beta-replicase amplification technique may well be applied.

[0033] The present invention, therefore, envisages both hybridization (detection) probes and primers for detecting a nucleoide sequence (target nucleotide) of the present invention. In the case of the target being a RNA molecule, e.g. a mRNA, said mRNA may be directly detected or transformed to a cDNA prior to detection.

[0034] Alternatively, in order to obtain fragments of the nucleic acid represented by SEQ. ID. NO.1 the Bifidobacterium longum genomic DNA may be subjected to digestion with selected restriction enzymes, with the fargments being separated by e.g. electrophoresis or another suitable separation technique. Such techniques are well known in the art and are inter alia disclosed in Sambrook et al. A Laboratory Manual, Cold Spring Harbor, 1992. Such fragments may easily be obtained by isolating the genomic DNA of Bifidobacterium longum NCC2705 (CNCM I-2618) and performing the necessary steps.

[0035] In an alternative form the nucleic acids may also be obtained by chemical synthesis when they are not too large in size according to methods well known to a person skilled in the art.

[0036] Modified nucleotide sequences shall be understood to mean any nucleotide sequence obtained by mutagenesis according to techniques well known to a skilled person and exhibiting modifications in relation to the normal sequences, for example mutations in the regulatory and/or promoter sequences for the expression of a polypeptide, in particular leading to a modification of the level of expression of the said polypeptide or to a modulation of the replicative cycle. Modified nucleotide sequence will also be understood to mean any nucleotide sequence encoding a modified polypeptide as defined below.

[0037] During the study of the Bifidobacterium longum genome the following annotation could be performed as identified by sequences having an open reading frame as identified by NO. 1 to NO. 1147, shown in the table I below.

TABLE I
	Gene						BEST
	Name	START	STOP	STRAND	FUNCTION	BEST HIT	SCORE
NO. 1	BL0002	833	2458	+	chaperone (groEL)	trembl|M17705|MBBCG_1	0
NO. 2	BL0005	3719	4450	+	response regulator of two-	trembl|Z80226|MTCY369_2	1.00E−72
					component system
NO. 3	BL0006	4622	6472	+	histidine kinase sensor of two-	trembl|280226|MTCY369_3	1.00E−54
					component system
NO. 4	BL0007	6542	6931	+	cold shock protein(cspA)	trembl|AL022004|MTV043_63	1.00E−25
	BL0008	6940	8127	+	narrowly conserved hypothetical	swiss|Q10539|Y877_MYCTU	2.00E−37
					protein with
NO. 6	BL0010	9354	11963	+	protease (clpC)	trembl|AL049628|SCE94_24	0
NO. 7	BL0011	12143	13462	Complement	cytosine deaminase (EC 3.5.4.1)	pironly|D83590|D83590	5.00E−102
					(cytosine
NO. 8	BL0013	15297	16673	+	proline/betaine transporter (proP)	trembl|AL158057|SC10G8_20	2.00E−85
NO. 9	BL0014	16759	17517	+	creatinine amidohydrolase;	trembl|AB007122|AB007122_5	2.00E−60
					creatininase (EC
NO. 10	BL0015	17689	19482	+	5′-nucleotidase family protein	trembl|AE001909|AE001909_7	4.00E−24
NO. 11	BL0016	19688	21148	complement	narrowly conserved hypothetical	trembl|Z98209|MTCY154_10	1.00E−49
					protein with
NO. 12	BL0017	21248	22648	+	histidyl-trna synthetase (EC	pironly|A82586|A82586	4.00E−68
					6.1.1.21)
NO. 13	BL0018	22684	24483	+	aspartyl-trna synthetase (EC	swiss|Q50649|SYD_MYCTU	0
					6.1.1.12)
NO. 14	BL0021	26476	27291	+	atp-binding protein of abc	trembl|AL020958|SC4H8_16	5.00E−102
					transporter for
NO. 15	BL0022	27362	28162	+	glutamate-binding protein of abc	trembl|AL020958|SC4H8_15	5.00E−72
					transporter
NO. 16	BL0023	28162	28839	+	permease protein of abc	trembl|AL020958|SC4H8_14	3.00E−52
					transporter for
NO. 17	BL0024	28845	29945	+	permease protein of abc	trembl|AL020958|SC4H8_13	3.00E−44
					transporter for
NO. 18	BL0025	30034	31575	+	hypothetical secreted protein with	trembl|AL023496|SC1A6_17	3.00E−50
					probable acid
NO. 19	BL0027	32653	33579	+	narrowly conserved hypothetical	trembl|AE001875|AE001875_9	3.00E−47
					protein with
NO. 20	BL0028	33713	36280	+	probable dead box-like helicase	tremblnew|U42580|PB42580_239	3.00E−46
NO. 21	BL0029	36363	37742	+	widely conserved hypothetical	swiss|Q50739|YP59_MYCTU	5.00E−118
					protein with
NO. 22	BL0030	37800	38522	+	response regulator of two-	trembl|U01971|MT01971_1	5.00E−60
					component system
NO. 23	BL0031	38519	40216	+	histidine kinase sensor of two-	trembl|Z95121|MTY20B11_20	2.00E−72
					component system
NO. 24	BL0033	42259	43242	+	probable solute binding protein of	tremblnew|AE005655|AE005655_4	5.00E−33
					abc
NO. 25	BL0034	43383	44924	+	atp binding protein of abc	tremblnew|AE005655|AE005655_5	5.00E−125
					transporter
NO. 26	BL0035	44926	45996	+	probable abc transport system	swiss|P39328|YTFT_ECOLI	6.00E−52
					permease protein
NO. 27	BL0036	45993	47015	+	probable abc transporter permease	tremblnew|AE005655|AE005655_7	3.00E−44
					protein for
NO. 28	BL0037	47238	48695	complement	probable efflux-type transporter	tremblnew|AX066097|AX066097_1	4.00E−52
NO. 29	BL0038	49084	49980	+	conserved protein with	pironly|B82343|B82343	3.00E−30
					hydroxyacid dehydrogenase
NO. 30	BL0043	52518	54950	complement	possible fused atp binding protein	trembl|AE000829|AE000829_9	3.00E−56
					and permease
NO. 31	BL0047	58071	58838	+	similar to mycobacterium	trembl|AE001936|AE001936_11	7.00E−61
					tuberculosis
NO. 32	BL0048	59063	60322	+	probable aminotransferase (EC	trembl|AL031514|SC2H4_4	5.00E−22
					2.6.1.—)
NO. 33	BL0049	60331	61155	+	atp binding protein of abc	trembl|AE002076|AE002076_5	3.00E−23
					transporter
NO. 34	BL0052	67189	69951	+	dna ligase (EC 6.5.1.2)	swiss|Q9Z585|DNLJ_STRCO	5.00E−141
					(polydeoxyribonucleotide
NO. 35	BL0053	70127	71242	+	hypothetical protein with duf059	swiss|O33225|MRP_MYCTU	4.00E−85
					and 4fe-4s iron
NO. 36	BL0055	72964	73779	+	sugar permease of abc	trembl|AL138851|SCE59_3	1.00E−45
					transporter system
NO. 37	BL0058	77028	77987	+	possible butyryl-coa	trembl|AE000948|AE000948_16	3.00E−46
					dehydrogenase
NO. 38	BL0059	78166	79275	+	narrowly conserved hypothetical	trembl|AL117387|SCF41_25	3.00E−43
					protein with
NO. 39	BL0062	80643	81185	+	protein similar to ycbi of b.	trembl|D50453|BSD453_38	1.00E−24
					subtilis
NO. 40	BL0063	81212	82012	complement	hypothetical transmembrane	swiss|P74369|YG47_SYNY3	2.00E−34
					protein with unknown
NO. 41	BL0064	82009	82797	complement	atp binding protein of abc	pironly|F82198|F82198	6.00E−20
					transporter
NO. 42	BL0065	82902	83468	+	elongation factor p (ef-p) (efp)	swiss|P95019|EFP_MYCTU	5.00E−67
NO. 43	BL0066	83523	84095	+	nusb antitermination protein	swissnew|P95020|NUSB_MYCTU	7.00E−21
					(nusB)
NO. 44	BL0067	84286	85509	+	carbamoyl-phosphate synthase	swissnew|P71811|CARA—	5.00E−120
					small chain (EC	MYCTU
NO. 45	BL0068	85511	88894	+	carbamoyl-phosphate synthase	trembl|AE001016|AE001016_6	0
					large chain (EC
NO. 46	BL0069	88894	89814	+	orotidine 5′-phosphate	swiss|P77898|DCOP_MYCTU	6.00E−40
					decarboxylase (EC
NO. 47	BL0070	89994	90584	+	guanylate kinase (EC 2.7.4.8)	swiss|P71659|KGUA_MYCTU	6.00E−44
					(gmp kinase)
NO. 48	BL0071	90586	91293	complement	possible exonuclease (dnaQ)	swiss|Q9ZHF6|DPO3_THEMA	4.00E−22
NO. 49	BL0072	91440	93695	+	tetracycline resistance protein tetq	trembl|Y08615|BFTETAQ3_2	2.00E−63
					(teta(q)1)
NO. 50	BL0074	94496	95242	+	permease protein of abc	trembl|AE001537|AE001537_3	5.00E−53
					transporter system
NO. 51	BL0075	95229	95903	+	permease of abc transporter	trembl|AL139075|CJ11168X2—	1.00E−54
					system for amino	122
NO. 52	BL0076	95896	96687	+	atp binding protein of abc	trembl|AE001537|AE001537_5	8.00E−64
					transporter for
NO. 53	BL0077	96753	97655	+	probable solute-binding protein	trembl|AL139076|CJ11168X3—	1.00E−71
					for	289
NO. 54	BL0078	97891	99129	+	cystathionine beta-lyase (beta-	trembl|AF131880|AF131880_1	5.00E−98
					cystathionase ec
NO. 55	BL0080	99771	101042	complement	is30-type transposase	trembl|AL021646|MTV014_36	1.00E−78
NO. 56	BL0084	102563	103462	+	narrowly conserved hypothetical	tremblnew|AC008261|	7.00E−47
					protein with	AC008261_3
NO. 57	BL0086	104503	105297	complement	glutamate racemase (EC 5.1.1.3)	pironly|G83062|G83062	2.00E−40
					(nntrI)
NO. 58	BL0087	105456	106298	+	diaminopimelate epimerase (EC	swiss|O69969|DAPF_STRCO	7.00E−30
					5.1.1.7) (dap
NO. 59	BL0089	107179	108072	+	conserved hypothetical protein	tremblnew|AP001515|AP001515_17	4.00E−32
					with
NO. 60	BL0092	110307	111881	+	probable dna helicase ii (uvrD)	swiss|O53344|UVRD_MYCTU	1.00E−84
NO. 61	BL0093	111951	113696	complement	narrowly conserved hypothetical	trembl|U00016|ML016_32	1.00E−38
					protein with
NO. 62	BL0094	113917	114798	+	hypothetical protein with unknown	trembl|AL096852|SCE19A_34	1.00E−42
					function
NO. 63	BL0097	117499	118689	+	1-deoxy-d-xylulose 5-phosphate	trembl|Z74024|MTCY274_1	4.00E−98
					reductoisomerase
NO. 64	BL0098	118698	119909	+	protein with similarity to gcpe of	swissnew|Q9X7W2|GCPE—	5.00E−142
					p. stuarti	STRCO
NO. 65	BL0100	121792	122511	+	conserved hypothetical protein	trembl|AL137166|SCC121_13	8.00E−55
					with unknown
NO. 66	BL0101	122508	123302	+	undecaprenyl pyrophosphate	swiss|O05837|UPPS_MYCTU	4.00E−82
					synthetase (EC
NO. 67	BL0102	123458	124660	complement	inosine-uridine preferring	trembl|AE001900|AE001900_5	5.00E−23
					nucleoside hydrolase
NO. 68	BL0103	124784	125854	complement	possible solute binding protein of	trembl|AE001726|AE001726_3	6.00E−29
					abc
NO. 69	BL0104	126113	126895	complement	possible permease protein of abc	trembl|AE001726|AE001726_4	2.00E−28
					transporter
NO. 70	BL0105	127091	128647	complement	sucrose-6-phosphate hydrolase	swiss|P40714|CSCA_ECOLI	2.00E−92
					(EC 3.2.1.26)
NO. 71	BL0106	128658	130160	complement	sucrose transport protein (sucrose	tremblnew|AE005467|	9.00E−93
					permease)	AE005467_5
NO. 72	BL0107	130210	131250	complement	probable laci-type transcriptional	trembl|AE001777|AE001777_1	3.00E−31
					regulator
NO. 73	BL0108	131294	132691	complement	hypothetical protein with	swissnew|O35684|NEUS_MOUSE	5.00E−30
					similarity to serine
NO. 74	BL0111	133788	135167	complement	hypothetical metabolite transport	swiss|P38055|YDJE_ECOLI	2.00E−59
					protein
NO. 75	BL0113	136120	137121	complement	phosphomethylpyrimidine kinase	swiss|Q9ZBR6|THID_STRCO	6.00E−54
					(EC 2.7.4.7)
NO. 76	BL0114	137436	140189	complement	thiamine biosynthesis protein	swiss|P45740|THIC_BACSU	0
					(thiE/thiC)
NO. 77	BL0115	140272	141216	complement	hydroxyethylthiazole kinase (EC	tremblnew|AP001297|	2.00E−27
					2.7.1.50)	AP001297_22
NO. 78	BL0116	141652	143124	+	glycyl-trna synthetase (EC	swiss|O65932|SYG_MYCTU	0
					6.1.1.14)
NO. 79	BL0117	143269	144513	+	possible nifr3-like protein	trembl|AL133471|SCC82_3	5.00E−100
NO. 80	BL0118	144625	145836	+	cell division protein ftsz. (ftsZ)	trembl|AF073487|AF073487_1	5.00E−106
NO. 81	BL0119	145849	146328	+	conserved hypothetical protein	tremblnew|AL445403|SC2I34_2	6.00E−22
					with unknown
NO. 82	BL0122	148326	148841	+	possible lipoprotein signal	swiss|Q10764|LSPA_MYCTU	5.00E−20
					peptidase (EC
NO. 83	BL0123	148841	149803	+	widely conserved hypothetical	trembl|AL109663|SC4A10_6	6.00E−81
					protein in the rlu
NO. 84	BL0127	152161	155730	+	dna polymerase iii alpha subunit	trembl|AF108191|AF108191_1	0
					(dnaE)
NO. 85	BL0128	155819	156253	+	narrowly conserved hypothetical	swiss|P76148|YNEG_ECOLI	7.00E−27
					protein with
NO. 86	BL0129	156459	158336	+	narrowly conserved hypothetical	trembl|U09352|SP09352_2	5.00E−176
					protein with
NO. 87	BL0136	172074	173576	complement	is21-type transposase	tremblnew|AP001520|	4.00E−52
						AP001520_222
NO. 88	BL0137	174295	176634	complement	hypothetical protein with	swiss|P49022|PIP_LACLA	5.00E−37
					similarity to pip
NO. 89	BL0138	176631	179369	complement	hypothetical protein with	pironly|A48653|A48653	8.00E−41
					similarity to pip
NO. 90	BL0139	179875	180429	complement	possible nadph-flavin	tremblnew|AL446003|SC5E9_29	2.00E−23
					oxidoreductase (EC
NO. 91	BL0140	181147	181794	+	hypothetical protein in pgam	trembl|AL132997|SC9G1_8	3.00E−24
					phosphoglycerate
NO. 92	BL0141	182202	183530	+	possible solute binding protein of	trembl|M57692|CTPULSA_3	3.00E−36
					abc
NO. 93	BL0142	183788	184804	complement	laci-type transcriptional regulator	trembl|AL136502|SCF43_17	2.00E−30
NO. 94	BL0143	185085	186041	+	permease of abc transporter	swiss|P37730|AMYD_THETU	2.00E−61
					possibly for
NO. 95	BL0144	186041	186883	+	permease of abc transporter	swiss|P37729|AMYC_THETU	4.00E−50
					possibly for
NO. 96	BL0146	187886	190762	+	possible arabinosidase	trembl|U55187|BF55187_1	1.00E−47
NO. 97	BL0148	191209	192390	complement	possible transposase	trembl|M86608|ISAFATPS_1	2.00E−54
NO. 98	BL0149	192651	194153	+	is21-type transposase (istA)	tremblnew|AP001520|	3.00E−53
						AP001520_222
NO. 99	BL0150	194234	194935	+	istb-like protein (istB)	tremblnew|AJ414141|	1.00E−32
						AJ414141_30
NO. 100	BL0151	195265	196677	+	narrowly conserved hypothetical	trembl|AP000004|AP000004_109	5.00E−76
					protein with
NO. 101	BL0152	196740	198215	complement	aromatic amino acid transport	tremblnew|AE005187|	5.00E−120
					protein arop	AE005187_9
NO. 102	BL0153	198437	199006	complement	probable tetr-like transcriptional	tremblnew|AP001509|	3.00E−23
					regulator	AP001509_157
NO. 103	BL0154	199150	199851	+	atp binding protein of abc	trembl|AE000977|AE000977_7	8.00E−61
					transporter
NO. 104	BL0156	203874	205400	+	amino acid permease (aapA)	swiss|O06005|AAPA_BACSU	6.00E−98
NO. 105	BL0157	205842	210560	+	narrowly conserved hypothetical	trembl|AL158061|SC6D11_2	2.00E−87
					protein with
NO. 106	BL0158	210772	214608	+	very narrowly conserved	trembl|AL132965|ATT16K5_23	3.00E−37
					hypothetical protein
NO. 107	BL0159	215104	215667	complement	dna-damage-inducible protein of	tremblnew|AE005591|	1.00E−26
					escherichia coli	AE005591_13
NO. 108	BL0162	216811	218682	+	probable permease protein of abc	trembl|AL137187|SC7A8_2	5.00E−112
					transporter
NO. 109	BL0163	218897	220726	+	probable permease protein of abc	trembl|AL137187|SC7A8_3	5.00E−142
					transporter
NO. 110	BL0166	223918	225015	+	conserved hypothetical protein	trembl|AL132674|SCE87_4	7.00E−64
					with tetrapyrole
NO. 111	BL0170	226374	228239	+	methionyl-trna synthetase (EC	swiss|O58721|SYM_PYRHO	5.00E−113
					6.1.1.10)
NO. 112	BL0173	230531	232057	complement	aminopeptidase c (EC 3.4.22.—)	swiss|Q56115|PEPC_STRTR	4.00E−87
					(pepC)
NO. 113	BL0174	232282	234510	+	narrowly conserved hypothetical	tremblnew|AE005584|	5.00E−163
					protein with	AE005584_8
NO. 114	BL0175	234514	235503	+	probable arac/xyls-type	tremblnew|AE005584|	5.00E−20
					transcriptional	AE005584_6
NO. 115	BL0176	235675	236832	complement	probable laci-type transcriptional	trembl|AE001777|AE001777_1	3.00E−31
					regulator
NO. 116	BL0177	237206	238615	+	possible alpha-galactosidase ec	tremblnew|AP001513|	1.00E−95
					3.2.1.22	AP001513_143
NO. 117	BL0179	239416	241278	+	probable permease protein of abc	tremblnew|AP001511|	5.00E−105
					transporter	AP001511_14
NO. 118	BL0180	241289	243097	+	probable permease protein of abc	trembl|U50951|TT50951_4	5.00E−151
					transporter
NO. 119	BL0181	243354	245825	+	alpha-1-arabinofuranosidase a (EC	trembl|AL031541|SCI35_5	5.00E−108
					3.2.1.55)
NO. 120	BL0182	246175	247920	complement	possible endo-1,5-alpha-1-	swiss|P42293|YXIA_BACSU	3.00E−44
					arabinosidase
NO. 121	BL0183	248077	249672	complement	possible endo-1,5-alpha-1-	swiss|P42293|YXIA_BACSU	6.00E−62
					arabinosidase
NO. 122	BL0185	252035	253093	+	laci-type transcriptional regulator	trembl|AE001777|AE001777_1	1.00E−39
NO. 123	BL0187	254391	255449	+	exo-alpha-1-arabinofuranosidase ii	tremblnew|AP001513|	5.00E−108
						AP001513_140
NO. 124	BL0189	257322	258275	+	sugar permease of abc transporter	trembl|D90905|SSD905_101	2.00E−50
					system
NO. 125	BL0190	258272	259198	+	sugar permease of abc	trembl|D90910|SSD910_40	2.00E−48
					transporter system
NO. 126	BL0193	261151	262110	+	widely conserved hypothetical	trembl|AL132674|SCE87_2	2.00E−57
					protein with
NO. 127	BL0194	262543	264753	+	kup system potassium uptake	pironly|F82623|F82623	2.00E−88
					protein (kup2)
NO. 128	BL0203	275203	276966	+	hypothetical protein involved in	trembl|AB010970|AB010970_8	2.00E−67
					polysaccharide
NO. 129	BL0205	278236	279192	complement	possible glycosyltransferase	trembl|AF033015|AF033015_6	3.00E−88
NO. 130	BL0207	280941	282224	complement	protein possibly involved in atp-	trembl|AB010970|AB010970_5	5.00E−102
					driven
NO. 131	BL0208	282226	283050	complement	possible permease protein of abc	trembl|AB010970|AB010970_4	2.00E−56
					transporter
NO. 132	BL0210	284428	284820	+	probable glycerol-3-phosphate	swissnew|P27623|TAGD_BACSU	1.00E−44
NO. 133	BL0213	286135	288033	complement	narrowly conserved hypothetical	trembl|AL022076|MTV026_12	5.00E−21
					protein with
NO. 134	BL0215	288832	289788	+	possible glycosyltransferase	trembl|AF033015|AF033015_6	2.00E−88
NO. 135	BL0216	289799	291796	+	narrowly conserved hypothetical	tremb1|AL022076|MTV026_12	2.00E−95
					protein with
NO. 136	BL0217	291894	293834	complement	narrowly conserved hypothetical	trembl|AL022076|MTV026_12	4.00E−95
					protein with
NO. 137	BL0218	294189	294818	complement	fragment of a. mutans orf7	trembl|AB010970|AB010970_8	3.00E−22
NO. 138	BL0219	294976	295965	+	probable transposase	trembl|U66426|TFU66426_1	1.00E−56
NO. 139	BL0220	295985	296746	complement	istb-like protein (istB)	trembl|AB024946|AB024946_78	7.00E-37
NO. 140	BL0221	297207	298226	complement	defective is21-type transposase	tremblnew|AP001520|	6.00E−57
						AP001520_222
NO. 141	BL0222	298311	300041	complement	defective transposase	tremblnew|AP001520|	9.00E−30
						AP001520_222
NO. 142	BL0223	300095	300688	complement	possible transposase	trembl|AF029727|AF029727_1	2.00E−28
NO. 143	BL0224	300691	300966	complement	hypothetical protein with	tremblnew|AP001508|	4.00E−20
					similarity to orfe of	AP001508_57
NO. 144	BL0227	303180	304085	complement	glucose-1-phosphate	trembl|AB030032|AB030032_7	5.00E−108
					thymidylyltransferase (EC
NO. 145	BL0228	304176	305618	complement	possible fused dtdp-4-keto-I-	trembl|D78182|MD182_5	9.00E−58
					rhamnose reductase
NO. 146	BL0229	305632	306675	complement	dtdp-glucose 4,6-dehydratase (EC	trembl|AF105113|AF105113_5	5.00E−140
					4.2.1.46)
NO. 147	BL0230	306818	308257	complement	hypothetical transmembrane	trembl|A76918|A76918_12	7.00E−62
					protein possibly
NO. 148	BL0231	308379	310124	complement	possible decarboxlyase with tpp	swiss|P23970|MEND_BACSU	5.00E−24
					domain + d236
NO. 149	BL0232	310151	310891	complement	probable 3-oxoacyl-[acyl-carrier	swiss|O67610|FABG_AQUAE	8.00E−30
					protein]
NO. 150	BL0235	313510	314451	complement	probable glycosyltransferase	trembl|AF026471|AF026471_9	5.00E−105
					(cps2F or dexB)
NO. 151	BL0236	314467	315660	complement	possible rhamnosyltransferase	tremblnew|Y17900|SSA17900_7	5.00E−139
					(cpsF)
NO. 152	BL0237	315718	317262	complement	galactosyl transferase cpsd (EC	trembl|AL121855|SCF62_7	2.00E−49
					2.7.8.—)
NO. 153	BL0239	317776	318978	+	probable integrase/recombinase	swissnew|P55639|Y4RF_RHISN	3.00E−20
					(sss or xerC)
NO. 154	BL0242	321079	321879	complement	possible transposase	trembl|AL021246|MTV008_34	3.00E−28
NO. 155	BL0247	325735	326226	complement	possible transposase or integrase	trembl|U50076|SL50076_2	8.00E−24
NO. 156	BL0249	327639	329360	+	undecaprenyl-phosphate sugar	trembl|AL121855|SCF62_7	4.00E−59
					phosphotransferase
NO. 157	BL0251	331665	333182	+	widely conserved hypothetical	tremblnew|AF188518|AF188518_1	3.00E−76
					transport protein
NO. 158	BL0252	333282	334649	complement	h(+)-stimulated manganese uptake	swissnew|O05916|MNTH_MYCTU	5.00E−109
					system protein
NO. 159	BL0254	336313	336996	complement	narrowly conserved hypothetical	trembl|Z83018|MTCY349_23	7.00E−34
					protein with
NO. 160	BL0255	337060	337929	complement	dehydrogenase or reductase	trembl|AL034443|SC4B5_1	4.00E−68
					protein
NO. 161	BL0257	338565	341258	complement	possible arabinogalactan endo-	tremblnew|AP001514|AP001514_29	5.00E−143
					beta-galactosidase
NO. 162	BL0258	341454	342509	complement	laci-type transcriptional regulator	trembl|AE001777|AE001777_1	2.00E−28
NO. 163	BL0259	342553	344826	complement	beta-galactosidase i(EC 3.2.1.23)	trembl|AL158061|SC6D11_3	5.00E−171
					(lactase)
NO. 164	BL0260	344872	345879	complement	sugar transport system permease	trembl|AL158061|SC6D11_5	5.00E−113
					protein
NO. 165	BL0261	345882	346844	complement	sugar transport system permease	trembl|AL158061|SC6D11_6	5.00E−100
					protein
NO. 166	BL0262	347063	348412	complement	solute binding protein of abc	Trembl|AL158061|SC6D11_4	1.00E−90
					transporter
NO. 167	BL0263	349108	349518	+	fragment of arabinose permease	trenml|Z99121|BSUB0018_82	1.00E−23
NO. 168	BL0264	349792	353853	complement	atp binding protein of abc	swiss|P71355|Y663_HAEIN	5.00E−105
					transporter
NO. 169	DL0266	354798	356621	+	probable long-chain-fatty acid coa	treml|AL049497|SC6G10_4	5.00E−130
					ligase
NO. 170	BL0267	356803	357438	complement	atp binding protein of abc	trembl|AF140784|AP140784_2	7.00E−61
					transporter similar
NO. 171	BL0268	357451	358674	complement	atp binding protein of abc	trembl|AF140784|AF140784_1	4.00E−35
					transporter similar
NO. 172	BL0269	358671	360038	complement	abc-type transporter similar to	trembl|AF140784|AF140784_3	5.00E−67
					vex3 (vexp3) of
NO. 173	BL0271	362037	362753	+	possible amidotransferase subunit	trembl|AL031541|SC135_37	4.00E−26
NO. 174	BL0272	362937	364454	complement	1-arabionse isomerase (EC	trembl|AB036736|AB036736_2	5.00E−135
					5.3.1.4) (araA)
NO. 175	BL0273	364686	365378	complement	1-ribulose-5-phosphate 4-	gp|AB038527|7242885	4.00E−75
					epimerase (EC 5.1.3.4)
NO. 176	BL0274	365463	367109	complement	probable sugar kinase	trembl|AJ249910|PSP249910_1	2.00E−22
NO. 177	BL0275	367264	368418	complement	laci-type transcriptional regulator	trembl|AL158061|SC6D11_7	6.00E−43
NO. 178	BL0276	368506	369345	complement	probable ribonuclease hii (EC	swissnew|O69989|RNH2_STRCO	2.00E−30
					3.1.26.4) (mase
NO. 179	BL0277	369465	370322	complement	probable signal peptidase i (EC	trembl|AL023797|SC2E1_15	2.00E−33
					3.4.21.89)
NO. 180	BL0279	371486	373186	complement	glucose-6-phosphate isomerase	swiss|P77895|G6PI_MYCTU	0
					(gpi) (EC 5.3.1.9)
NO. 181	BL0282	374992	376272	complement	femab-like protein possibly	trembl|U50357|SZU50357_1	5.00E−45
					involved in
NO. 182	BL0283	376322	377632	complement	femab-like protein possibly	trembl|U66883|SSU66883_4	5.00E−41
					involved in
NO. 183	BL0284	377706	378974	complement	femab-like protein possibly	trembl|U50357|SZU50357_1	9.00E−53
					involved in
NO. 184	BL0285	379421	380179	complement	widely conserved by hypothetical	trembl|AL096852|SCE19A_2	1.00E−46
					protein in haml
NO. 185	BL0286	380223	380999	complement	probable ribonuclease ph (EC	trembl|AL096852|SCE19A_4	7.00E−82
					2.7.7.56) (mass
NO. 186	BL0287	381282	382640	complement	conserved hypothetical protein	trembl|AL096852|SCE19A_7	5.00E−128
					with unknown
NO. 187	BL0290	384147	385157	+	possible reductase	trembl|U60828|LLU60828_1	5.00E−104
NO. 188	BL0291	385766	386266	+	phosphopantetheine	swiss|Q9ZBR1|COAD_STRCO	2.00E−35
					adenylyltransferase (EC
NO. 189	BL0293	387403	387882	+	conserved hypothetical protein	trembl|AL034447|SC7A1_14	2.00E−25
					with duf177
NO. 190	BL0295	388208	389041	+	ribonuclease iii (EC 3.1.26.3)	swiss|O69469|RNC_MYCLE	2.00E−47
					(mase iii)
NO. 191	BL0296	389202	391169	+	acetolactate synthase (EC	trembl|AL035569|SC8D9_24	0
					4.1.3.18)
NO. 192	BL0297	391186	391740	+	acetolactate synthase small	trembl|AF175526|AF175526_1	6.00E−52
					subunit (EC
NO. 193	BL0298	392184	392603	+	plasmid stability protein stbb	pironly|H82660|H82660	1.00E−20
					(stbB)
NO. 194	BL0299	392656	394932	complement	atp binding protein of abc	trembl|AL022002|MTV047_2	2.00E−95
					transporter
NO. 195	BL0300	394980	395870	complement	possible amidotransferase	trembl|D64006|SSSLLLH_57	5.00E−25
NO. 196	BL0301	395927	397567	+	cysteinyl-trna synthetase 1 (EC	gp|AL160331|7242756	5.00E−115
					6.1.1.16)
NO. 197	BL0303	398703	400451	+	signal recognition particle protein	trembl|AL023797|SC2E1_3	5.00E−170
					(ffh)
NO. 198	BL0305	401870	402331	+	30s ribosomal protein s16 (rpsP)	swiss|Q10795|RS16_MYCTU	1.00E−28
NO. 199	BL0307	402608	403231	+	possible rim-like protein involved	trembl|AL023797|SC2E1_10	6.00E−22
					in efficient
NO. 200	BL0308	403354	404406	complement	inosine-uridine preferring	trembl|AE001900|AE001900_5	2.00E−40
					nucleoside hydrolase
NO. 201	BL0309	404504	405367	complement	possible oxidoreductase of the	trembl|AE002028|AE002028_7	2.00E−32
					aldo/keto
NO. 202	BL0311	407767	408345	complement	lema-like protein (lemA)	trembl|U66186|LMU66186_1	3.00E−39
NO. 203	BL0312	408640	409419	complement	probable atp-binding protein of	gp|AL353816|7636012	5.00E−101
					abc transporter
NO. 204	BL0313	409472	410437	complement	probable phosphate binding-	gp|AL353816|7636013	2.00E−67
					protein of abc
NO. 205	BL0314	410470	411423	complement	probable phosphate permease	gp|AL353816|7636014	1.00E−75
					protein of abc
NO. 206	BL0315	411634	412767	complement	phosphate-binding transport	gp|AL353816|7636015	4.00E−64
					protein of abc
NO. 207	BL0316	413007	413777	complement	response regulator of two-	tremblnew|AF123314|AF123314_2	2.00E−77
					component system
NO. 208	BL0317	413910	415241	complement	histidine kinase sensor of two-	gp|AL160331|7242750	7.00E−64
					component system
NO. 209	BL0318	415492	416205	complement	probable mta/sah nucleosidase	tremblnew|AP001518|AP001518_69	2.00E−29
					[includes:
NO. 210	BL0319	416327	417559	complement	phospho-2-keto-3-deoxybeptonate	swiss|P00886|AROG_ECOLI	4.00E−97
					aldolase (dahp
NO. 211	BL0320	417688	418821	complement	phospho-2-debydro-3-	pironly|H82856|H82856	5.00E−101
					deoxyheptonate aldolase,
NO. 212	BL0321	419113	420456	complement	aminopeptidase c (EC 3.4.22.—)	swiss|Q48543|PEPC_LACDL	3.00E−88
					(pepC)
NO. 213	BL0323	422296	422973	complement	pyrrolidone−carboxylate peptidase	swiss|P28618|PCP_BACSU	4.00E−26
					(EC 3.4.19.3)
NO. 214	BL0324	422983	423858	complement	probable	trembl|Z37516|HIACAPIID_1	1.00E−31
NO. 215	BL0325	423938	424918	complement	conserved hypothetical protein	swissnew|P45497|YFTZ_STRCO	2.00E−33
					with unknown
NO. 216	BL0326	424996	426717	complement	possible protease or peptidase	tremblnew|AP001511|AP001511—	2.00E−65
						163
NO. 217	BL0327	426776	427531	+	trna (guasine-nl)-	swiss|O69882|TRMD_STRCO	5.00E−60
					methyltransferase (EC
NO. 218	BL0328	427555	428175	complement	hypothetical protein with possible	trembl|Z83018|MTCY349_17	1.00E−26
					methylase
NO. 219	BL0329	428393	431236	complement	atp-dependent dna helicase (EC	trembl|AL034447|SC7A1_10	5.00E−104
					3.6.1.—).
NO. 220	BL0332	433138	434415	+	narrowly conserved hypothetical	swiss|P42306|YXIO_BACSU	2.00E−93
					protein with
NO. 221	BL0335	435958	436491	+	methylated-dna-protein-cysteine	trembl|AL034446|SC1A9_15	4.00E−24
NO. 222	BL0338	439120	440592	+	aspartate ammonia-lyase (EC	tremblnew|AE008304|AE008304_2	1.00E−123
					4.3.1.1) (aspartase)
NO. 223	BL0341	442847	444124	complement	atp binding protein of abc	trembl|ALO31225|SC8B7_10	6.00E−66
					transporter (msiK)
NO. 224	BL0343	444980	445930	complement	possible permease protein of abc	trembl|AL139076|CJ11168X3_S9	7.00E−33
					transporter
NO. 225	BL0344	445942	447108	complement	possible solute binding protein of	pironly|D83240|D83240	2.00E−44
					abc
NO. 226	BL0345	447361	448647	complement	d-alanine-d-alanine ligase (EC	swiss|P95114|DDL_MYCTU	2.00E−76
					6.3.2.4)
NO. 227	BL0346	448735	449736	complement	glycerol-3-phosphate	trembl|AL034447|SC7A1_3	5.00E−79
					dehydrogenase [nad(p)+] (EC
NO. 228	BL0348	430878	451267	complement	hypothetical 14.5 kda translational	swiss|O58584|Y854_PYRHO	7.00E−25
					inhibitor
NO. 229	BL0350	452516	453526	complement	hypothetical protein with marginal	trembl|AL137242|SC8F4_23	8.00E−33
					similarity to
NO. 230	BL0354	455906	456895	+	possible secreted peplidyl-prolyl	trembl|AL132648|SCI41_22	5.00E−25
					cia-trans is
NO. 231	BL0355	456941	457750	complement	narrowly conserved hypothetical	swiss|Q10634|YD21_MYCTU	1.00E−60
					protein with
NO. 232	BL0357	458092	459564	complement	atp synthase beta chain (EC	trembl|Z22606|SLATPSYNA_8	0
					3.6.1.34) (atpD)
NO. 233	BL0358	459573	460496	complement	atp synthase gamma chain (EC	trembl|Z22606|SLATPSYNA_7	1.00E−60
					3.6.1.34) (atpG)
NO. 234	BL0359	460500	462131	complement	atp synthase alpha chain (EC	trembl|Z22606|SLATPSYNA_6	0
					3.6.1.34) (atpA)
NO. 235	BL0360	462207	463043	complement	atp synthase delta chain (EC	swissnew|Q10594|ATPD_MYCTU	2.00E−21
					3.6.1.34) (atpH)
NO. 236	BL0363	463984	464796	complement	atp synthase a chain (EC 3.6.1.34)	swiss|P50012|ATP6_STRLI	9.00E−28
					(atpB)
NO. 237	BL0365	465258	466292	complement	homoserine o-succinyltransferase	swissnew|Q9KAK7|META_BACHD	2.00E−88
					(EC 2.3.1.46)
NO. 238	BL0375	472472	473593	+	hypothetical protein with	trembl|AJ006589|BPH6589_4	3.00E−25
					similarity to gp 34
NO. 239	BL0381	477134	479185	+	phage related protein: putative	trembl|AF011378|AF011378_14	1.00E−34
					minor tail
NO. 240	BL0386	483079	483909	complement	probable phage-family	trembl|Z80225|MTCY441_16	2.00E−47
					integrase/recombinase
NO. 241	BL0388	486597	488837	+	possible glycanase or glycogenase	trembl|AL138978|SC6A11_19	5.00E−174
					with amylase
NO. 242	BL0389	489065	489559	+	inorganic pysophosphatase (EC	swiss|Q9X8I9|IPYR_STRCO	6.00E−51
					3.6.1.1)
NO. 243	BL0390	489793	490377	+	integral membrane protein in the	trembl|AL139074|CJ11168X1_155	2.00E−36
					upf0059
NO. 244	BL0392	491351	492151	+	possible transcriptional requlatory	swissnew|Q05943|GLNR_STRCO	7.00E−69
					protein with
NO. 245	BL0393	492210	492896	+	endonuclease iii (EC 4.2.99.18)	swiss|O69642|END3_MYCTU	7.00E−58
					(dna-(apurinic
NO. 246	BL0395	494523	497363	+	valyl-trna synthetase (EC 6.1.1.9)	Swiss|Q9ZCN6|SYV_RICPR	5.00E−155
					(valine-trna
NO. 247	BL0398	500447	502516	complement	transcription termination factor	trembi|L27277|MLRHO_1	5.00E−151
					rho (rho)
NO. 248	BL0399	502722	504335	complement	hypothetical protein with pyridine	trembl|AP000002|AP000002_120	1.00E−29
NO. 249	BL0400a	506584	507286	+	narrowly conserved hypothetical	trembl|Z97369|MLCB250_15	2.00E−34
					protein with
NO. 250	BL0402	508266	509765	complement	glutamyl-trna(gln)	swiss|Q9Z578|GATB_STRCO	5.00E−176
					amidotransferase subunit b
NO. 251	BL0403	509791	511332	complement	glutamyl-trna(gln)	swiss|Q9Z580|GATA_STRCO	5.00E−164
					amidotransferase subunit a
NO. 252	BL0405	511802	512650	complement	narrowly conserved hypothetical	trembl|AL021931|MTV036_15	6.00E−46
					protein with
NO. 253	BL0407	513370	514773	complement	conserved hypothetical protein	trembl|AF213822|AF213822_7	2.00E−53
					withduf195
NO. 254	BL0408	514837	515118	complement	narrowly conserved hypothetical	trembl|Z97050|MTC128_29	1.00E−28
					protein with
NO. 255	BL0409	515230	517938	+	copper-transporting atpase (EC	trembl|AF067954|AF067954_9	5.00E−76
					3.6.1.36) (silP)
NO. 256	BL0410	518022	518756	complement	glycerol uptake facilitator-like	swiss|Q9X1E3|GLPF_THEMA	2.00E−61
					protein in mip
NO. 257	BL0411	518990	520669	complement	phosphoenolpyruvate-protein	tremblnew|AP001517|AP001517—	5.00E−133
					phosphotransferase	195
NO. 258	BL0413	521316	521762	complement	50s ribosomal protein19 (rpll)	swiss|Q9X8U5|RL9_STRCO	1.00E−21
NO. 259	BL0414	521782	522030	complement	30s ribosomal protein s18-2	swiss|Q9X8K4|R18B_STRCO	3.00E−21
					(rpsR)
NO. 260	BL0415	522091	522747	complement	single-strand binding protein(ssb)	swiss|P71711|SSB_MYCTU	4.00E−38
NO. 261	BL0416	522804	523097	complement	30s ribosomal protein s6. (rpsF)	swiss|P71710|RS6_MYCTU	1.00E−21
NO. 262	BL0418	523863	524876	+	ribose-phosphate	trembl|Z92539|MTCY10G2_4	5.00E−103
					pyrophosphokinase (EC 2.7.6.1)
NO. 263	BL0419	524952	525836	complement	hypothetical protein in upf0001	pironly|H82646|H82646	7.00E−30
NO. 264	BL0420	525916	529632	complement	probable extracellular protein	trembl|Z99113|BSUB0010_109	1.00E−24
					possibly involved
NO. 265	BL0421	529737	535562	complement	narrowly conserved hypothetical	trembl|AJ223998|AOPCZA361_25	0
					protein possibly
NO. 266	BL0422	536261	538231	complement	narrowly conserved hypothetical	tremblnew|AE005584|AE005584_8	5.00E−133
					protein with
NO. 267	BL0423	538240	539058	complement	sugar permease of abc transporter	trembl|AJ223998|AOPCZA361_25	1.00E−38
					system
NO. 268	BL0424	539079	540005	complement	sugar permease of abc transporter	trembl|AL049661|SCE134_5	8.00E−38
					system
NO. 269	BL0425	540293	541618	complement	solute binding protein of abc	trembl|AL138851|SCE59_5	2.00E−20
					transporter
NO. 270	BL0426	542104	543126	+	lacti-type transcriptional regulator	swiss|O87590|CELR_THEFU	3.00E−40
NO. 271	BL0427	543141	544646	complement	hypothetical protein kinaase in	swiss|Q46189|YHGIf_CLOPA	2.00E−78
					abc1 family
NO. 272	BL0429	545394	546146	complement	possible cobyric acid synthase	trembl|AF080002|AF080002_2	3.00E−47
					cobq
NO. 273	BL0430	546249	547721	complement	narrowly conserved hypothetical	trembl|D90914|SSD914_7	9.00E−48
					protein with mur
NO. 274	BL0431	547721	549250	complement	replicative dna helicase (EC	trembl|AL049826|SCH24_3	5.00E−145
					3.6.1.—) (dnaB)
NO. 275	BL0432	549306	550901	+	hypothetical protein in upf0013	trembl|AL049826|SCH24_2	3.00E−62
NO. 276	BL0433	550935	552761	complement	protein-pii; uridylyltransferase	swiss|O69873|GLND_STRCO	1.00E−90
					(EC 2.7.7.59)
NO. 277	BL0434	552869	553207	complement	nitrogen regulatory protein p-ii.	pironly|T35668|T35668	4.00E−43
					(glnB)
NO. 278	BL0435	553209	554504	complement	possible ammonium ion	trembl|AJ010319|CAJ10319_2	5.00E−124
					transporter (amtP)
NO. 279	BL0436	554872	556134	complement	ftsy signal recognition particle	trembl|AJ034447|SC7A1_24	5.00E−102
					(docking
NO. 280	BL0437	556239	557078	+	probable tetr-type transcriptional	trembl|Z92539|MTCY10G2_6	9.00E−51
					regulator
NO. 281	BL0438	557102	558136	+	probable glycosyltransferase	trembl|AJ006986|SPAJ6986_9	1.00E−26
NO. 282	BL0439	558210	559898	complement	dipeptidase (pepD)	trembl|Z38063|LHDIPEP_1	8.00E−97
NO. 283	BL0440	560039	561706	+	glucose-6-phosphate 1-	trembl|AL096839|SCC22_19	0
					dehydrogenase (EC
NO. 284	BL0441	561703	562728	+	narrowly conserved hypothetical	trembl|AL031107|SC5A7_10	1.00E−57
					protein with
NO. 285	BL0443	562865	563797	+	probable 6-	swiss|Q9XAB7|6PGL_STRCO	1.00E−37
					phosphogluconolactonase (EC
					3.1.1.31)
NO. 286	BL0444	564101	565555	complement	6-phosphogluconate	trembl|Z83859|MTCY359_7	5.00E−167
					dehydrogenase,
NO. 287	BL0446	567375	570005	+	hypothetical membrane protein	pironly|A48653|A48653	9.00E−34
					with similarity to
NO. 288	BL0447	570002	572164	+	hypothetical membrane protein	trembl|AE000938|AE000938_8	3.00E−56
					with similarity to
NO. 289	BL0450	573563	574360	complement	atp binding protein of abc	trembl|AL139079|CJ11168X6_108	2.00E−65
					transporter
NO. 290	BL0451	574376	575599	complement	possible permease protein of abc	trembl|AL139079|CJ11168X6_107	3.00E−20
					transporter
NO. 291	BL0452	575633	576937	complement	possible permease protein of abc	trembl|AL139079|CJ11168X6_106	3.00E−48
					transporter
NO. 292	BL0454	578386	579069	complement	narrowly conserved hypothetical	swiss|P19478|TA34_TREPA	7.00E−36
					protein
NO. 293	BL0455	579244	581055	complement	widely conserved hypothetical	trembl|AE001265|AE001265_1	3.00E−55
					membrane protein
NO. 294	BL0457	582190	582831	complement	narrowly conserved hypothetical	trembl|Z99122|BSUB0019_159	1.00E−38
					protein with
NO. 295	BL0458	582999	583358	+	narrowly conserved hypothetical	trembl|AL139079|CJ11168X6_4	5.00E−29
					protein with
NO. 296	BL0460	584343	585326	+	probable lysr-type transcriptional	swiss|P39592|YWBI_BACSU	4.00E−21
					regulator
NO. 297	BL0461	585539	586423	complement	is3-type transposase	tremblnew|AE000433|ECAE433_4	1.00E−46
NO. 298	BL0464	587533	593433	complement	narrowly conserved hypothetical	trembl|AL031155|SC3A7_16	5.00E−144
					protein with
NO. 299	BL0465	593602	594786	+	transpsosase in is256 family	swiss|Q52873|TRA5_RHIME	5.00E−61
NO. 300	BL0469	596683	598203	complement	glutamyl-trna synthetase (EC	swiss|O33120|SYE_MYCLE	5.00E−163
					6.1.1.17)
NO. 301	BL0472	600060	600977	complement	widely conserved hypothetical	pironly|G82131|G82131	5.00E−30
					protein with
NO. 302	BL0474	602113	602772	complement	hypothetical protein with possible	tremblnew|AL392176|SCD65_13	2.00E−36
NO. 303	BL0475	603034	604479	+	hypothetical membrane protein	trembl|AL009204|SC9B10_25	3.00E−32
					with unknown
NO. 304	BL0478	606009	607526	complement	formate-tetrahydrofolate ligase	tremblnew|AL162753|NMA2Z2491—	3.00E−47
					(EC 6.3.4.3)	232
NO. 305	BL0479	607686	609287	complement	dipeptidase (pepD)	trembl|Z38063|LHDIPEP_1	5.00E−105
NO. 306	BL0481	610303	611805	+	is21-type transposase	tremblnew|AP001520|AP001520—	4.00E−52
NO. 307	BL0482	611886	612587	+	istb-like protein	tremblnew|AJ414141|AJ414141_30	1.00E−32
NO. 308	BL0483	612690	613850	complement	possible dna polymerase iii delta	trembl|AL035636|SCH5_3	6.00E−57
					prime
NO. 309	BL0484	613847	614428	complement	thymidylate kinase (EC 2.7.4.9)	trembl|AL035636|SCH5_5	9.00E−47
					(dtmp kinase)
NO. 310	BL0485	614745	617837	complement	dna topoisomerase i (EC 5.99.1.2)	swiss|Q9X909|TOP1_STRCO	0
					(relaxing
NO. 311	BL0487	619475	621889	+	probable penicillin-binding protein	gp|AL353832|7636001	7.00E−84
NO. 312	BL0488	621961	623877	complement	2-isopropylmalate synthase (EC	swiss|P96420|LEU1_MYCTU	0
					4.1.3.12) (leuA)
NO. 313	BL0491	626149	626862	complement	hypothetical protein with unknown	gp|AL353815|7635958	1.00E−20
					function
NO. 314	BL0492	626937	628031	+	aspartate-semialdehyde	swissnew|P41394|DHAS_LEPIN	3.00E−71
					dehydrogenase (EC
NO. 315	BL0493	628113	628655	complement	aspartokinase (EC 2.7.2.4)	trembl|AL079348|SC66T3_26	3.00E−44
					(aspartokinase beta
NO. 316	BL0494	628735	629499	complement	aspartokinase (EC 2.7.2.4)	swissnew|P41403|AK_MYCSM	2.00E−86
					(aspartokinase alpha
NO. 317	BL0495	629860	631143	complement	narrowly conserved hypothetical	trembl|Z97182|MTCY19H5_12	9.00E−21
					protein with
NO. 318	BL0498	632032	633165	+	possible sortase-like protein	trembl|AF019629|AF019629_2	3.00E−45
NO. 319	BL0499	633162	633764	complement	recombination protein recr (recR)	swissnew|Q9XAI4|RECR_STRCO	4.00E−70
NO. 320	BL0500	633790	636702	complement	dna polymerase iii subunit	trembl|AL118514|SCD25_3	5.00E−123
					gamma/tau (EC
NO. 321	BL0502	637695	638825	complement	narrowly conserved hypothetical	trembl|AL021925|MTV022_2	5.00E−23
					protein with
NO. 322	BL0508	641511	642578	complement	hypothetical protein possibly	trembl|AL035636|SCH5_19	9.00E−56
					involved in
NO. 323	BL0510	643758	644483	complement	deda integral membrane protein	swissnew|P09548|DEDA_ECOLI	2.00E−37
					(dsg-1 protein)
NO. 324	BL0512	645418	646221	complement	3-oxoacyl-[acyl-carrier protein]	tremblnew|AP001515|AP001515—	1.00E−44
					reductase (EC	225
NO. 325	BL0515	648919	650271	complement	hypothetical transmembrane	trembl|AE001862|AE001862_175	4.00E−58
					protein in
NO. 326	BL0516	650544	651131	complement	probable merr-type-transcriptional	swissnew|P40183|HSPR_STRCO	7.00E−20
					regulator
NO. 327	BL0517	651146	652165	complement	chaperone protein dnaj. (dnaJ)	trembl|AB009842|AB009842_3	4.00E−40
NO. 328	BL0519	652397	653056	complement	grpe protein (hsp-70 cofactor)	swissnew|Q05562|GRPE_STRCO	1.00E−27
					(grpE)
NO. 329	BL0520	653053	654933	complement	dnak protein (heat shock protein	swiss|Q05558|DNAK_STRCO	0
					70) (hsp70)
NO. 330	BL0523	655916	657997	complement	possible xylosidase or glucosidase	tremblnew|AL512980|SSOLP2N19—	1.00E−41
						30
NO. 331	BL0524	658565	659281	complement	possible permease protein of abc	trembl|AL009199|SC7B7_4	5.00E−21
					transporter
NO. 332	BL0525	659551	660561	+	probable laci-type transcriptional	trembl|AL136502|SCF43_17	7.00E−31
					regulator
NO. 333	BL0527	661816	664053	+	4-alpha-glucanotransferase (EC	swiss|O53932|MALQ_MYCTU	5.00E−158
					2.4.1.25)
NO. 334	BL0528	664185	665219	+	probable laci-type transcriptional	trembl|AL121596|SC51A_33	1.00E−28
					regulator
NO. 335	BL0529	665379	667193	+	probable alpha-1,4-glucosidase	trembl|AF105219|AP105219_2	5.00E−143
					(EC 3.2.1.10);
NO. 336	BL0530	667273	668334	complement	ketol-acid reductoisomerase (EC	swiss|Q9Z565|ILVC_STRCO	5.00E−106
					1.1.1.86)
NO. 337	BL0531	668754	669806	complement	ketol-acid reductoisomerase (EC	swiss|Q9Z565|ILVC_STRCO	5.00E−109
					1.1.1.86)
NO. 338	BL0532	670003	671523	complement	transmembrane transport protein	tremblnew|AE005578|AE005578_1	5.00E−118
					possibly for
NO. 339	BL0533	671998	673041	complement	laci-type transcriptional regulator	swiss|Q54430|SCRR_STRMU	1.00E−39
					(scrR)
NO. 340	BL0536	674947	676473	complement	sucrose phosphorylase (EC	trembl|AF065245|AF065245_3	5.00E−149
					2.4.1.7) (sucrose
NO. 341	BL0537	676808	677857	+	truncated transposase	trembl|AP000342|AP000342_11	1.00E−51
NO. 342	BL0538	677944	678999	complement	probable integrase/recombinase	swissnew|P55636|Y4RC_RHISN	9.00E−20
NO. 343	BL0540	679958	681160	complement	possible integrase/recombinase	swissnew|P55639|Y4RF_RHISN	3.00E−20
NO. 344	BL0543	682749	683783	complement	laci-type transcriptional regulator	tremblnew|AP001514|AP001514—	1.00E−35
						225
NO. 345	BL0544	683955	685754	complement	alpha-1-arabinofuranosidase a (EC	gp|AL163003|7414545	5.00E−161
					3.2.1.55)
NO. 346	BL0545	685919	687712	complement	possible low-affinity potassium	pironly|C83530|C83530	2.00E−65
					uptake system
NO. 347	BL0546	687912	688997	complement	laci-type transcriptional regulator	swiss|Q54430|SCRR_STRMU	7.00E−37
NO. 348	BL0548	690945	692528	complement	probable voltage gated channel	pironly|C82449|C82449	2.00E−50
					protein
NO. 349	BL0549	692552	693838	complement	adenylosuccinate synthetase (EC	swiss|Q9X8P6|PURA_STRCO	5.00E−176
					6.3.4.4)
NO. 350	BL0550	694054	695121	+	fructose-bisphosphate aldolase	swiss|O06313|ALF_MYCTU	5.00E−119
					(EC 4.1.2.13)
NO. 351	BL0551	695332	696252	complement	possible protease htpx (EC	swiss|O06429|HTPX_MYCTU	1.00E−69
					3.4.24.—) (htpX)
NO. 352	BL0552	696445	697896	complement	probable ferredoxin/ferredoxin-	trembl|AL132856|SCF15_2	5.00E−111
					nadp reductase (
NO. 353	BL0553	698027	698869	+	conserved hypothetical protein	trembl|Z97182|MTCY19H5_12	5.00E−22
					with unknown
NO. 354	BL0554	699209	701368	complement	probable cation-transporting	trembl|AL109962|SCJ1_13	4.00E−83
					atpase v (EC
NO. 355	BL0555	701780	703807	complement	possible do serine protease (EC	trembl|AE001732|AB001732_1	5.00E−51
					3.4.21.—) (degP
NO. 356	BL0556	704224	705537	+	queuine trna-ribosyltransferase	swiss|O32053|TGT_BACSU	8.00E−84
					(EC 2.4.2.29)
NO. 357	BL0560	706974	707657	+	hypothetical transmembrane	trembl|AB003158|AB003158_1	7.00E−28
					protein with unknown
NO. 358	BL0562	708341	708673	complement	widely conserved hypothetical	pironly|G82395|G82395	3.00E−28
					protein with
NO. 359	BL0563	708789	710270	+	probable type ii restriction enzyme	trembl|AF051563|AF051563_1	1.00E−37
					similar to
NO. 360	BL0564	710277	711548	complement	modification methylase sau3ai	trembl|AF051563|AF051563_3	1.00E−74
					(EC 2.1.1.73)
NO. 361	BL0568	714565	715548	complement	peptide methionine sulfoxide	tremblnew|AL162752|NMA1Z2491—	1.00E−86
					reductase. (msrA)	273
NO. 362	BL0570	716076	718649	complement	hypothetical protein with unknown	swissnew|P94974|SYK2_MYCTU	1.00E−23
					function
NO. 363	BL0575	720885	721994	complement	narrowly conserved hypothetical	tremblnew|AE005358|AE005358_4	4.00E−58
					protein with
NO. 364	BL0577	723052	723771	complement	tela-like protein associated with	swiss|P37535|YAAN_BACSU	3.00E−40
					cryptic
NO. 365	BL0582	727987	730431	+	probable dipeptidyl peptidase iv	trembl|D83263|SMD263_1	1.00E−56
NO. 366	BL0583	730616	731317	+	hypothetical protein with fha	trembl|AL079308|SCH69_13	8.00E−23
					domain
NO. 367	BL0584	731347	731877	+	hypothetical protein with fha	trembl|AL079308|SCH69_14	6.00E−33
					domain
NO. 368	BL0585	731882	733576	+	possible phosphoprotein	trembl|AL079308|SCH69_15	1.00E−61
					phosphatase
NO. 369	BL0586	733573	735132	+	protein involved in cell wall	trembl|AL079308|SCH69_16	5.00E−103
					farmation and
NO. 370	BL0587	735129	736595	+	probable penicillin binding	trembl|Z80233|MTCY10H4_14	1.00E−80
					protein
NO. 371	BL0588	736592	737542	+	probable serine-threonine protein	swiss|P71585|PKNA_MYCTU	5.00E−59
					kinase (pknA)
NO. 372	BL0589	737539	739611	+	probable serine/threonine-protein	trembl|AL079308|SCH69_18	5.00E−106
					kinase pknb
NO. 373	BL0590	739837	740481	complement	para-aminobenzoate synthase	trembl|AL079308|SCH69_21	8.00E−62
					glutamine
NO. 374	BL0591	740532	741770	complement	hypothetical transmembrane	trembl|AL079308|SCH69_19	1.00E−26
					protein with unknown
NO. 375	BL0592	741767	742567	complement	narrowly conserved hypothetical	trembl|AL079308|SCH69_23	6.00E−30
					protein with
NO. 376	BL0594	743795	744640	complement	conserved membrane protein in	trembl|AL021926|MTV031_3	9.00E−24
					rhomboid family
NO. 377	BL0597	745313	747838	complement	glycogen phosphorylase (EC	trembl|D90907|SSD907_48	0
					2.4.1.1) (glgP)
NO. 378	BL0600	749019	750110	+	tryptophanyl-trna synthetase (EC	trembl|AE001959|AE001959_7	1.00E−58
					6.1.1.2)
NO. 379	BL0601	750288	752075	complement	widely conserved hypothetical	trembl|AE002083|AE002083_5	6.00E−36
					protein with
NO. 380	BL0602	752125	753765	complement	possible sodium/proline symporter	swiss|O06493|OPUE_BACSU	5.00E−104
					(opuE)
NO. 381	BL0604	756164	758917	+	phosphoenolpyruvate carboxylase	swiss|P28594|CAPP_ANASP	5.00E−110
					(EC 4.1.1.31)
NO. 382	BL0609	762024	763673	complement	hypothetical protein possibly	trembl|AE002053|AE002053_3	3.00E−34
					related to
NO. 383	BL0610	763888	764895	complement	laci-type transcriptional regulator	trembl|AE001777|AE001777_1	6.00E−24
NO. 384	BL0613	765441	766727	+	probable integral membrane	tremblnew|AP001515|AP001515—	1.00E−68
					transporter	262
NO. 385	BL0614	766844	768760	complement	thioredoxin reductase (EC 1.6.4.5)	pironly|D35156|D35156	2.00E−75
					(trxB)
NO. 386	BL0615	768929	769492	complement	alkyl hydroperoxide reductase c22	trembl|AF016233|AF016233_2	9.00E−66
					protein (EC
NO. 387	BL0616	769698	770381	+	probablecarbonic anhydrase (EC	trembl|AL022075|MTV024_6	1.00E−36
					4.2.1.1) (icfA)
NO. 388	BL0617	770719	771984	+	widely conserved hypothetical	swiss|P74409|Y260_SYNY3	2.00E−55
					protein with duf21
NO. 389	BL0618	772081	772560	+	hypothetical protein in dps family	trembl|AF068267|AF068267_1	4.00E−30
NO. 390	BL0620	774367	774732	complement	probable gluconokinase (EC	trembl|AE002030|AE002030_3	1.00E−25
					2.7.1.12) (gluconate
NO. 391	BL0622	775637	776743	+	conserved hypothetical protein	swiss|P44099|YA38_HAEIN	1.00E−38
					with unknown
NO. 392	BL0628	779817	781151	complement	aspartate aminotransferase (EC	tremblnew|AP001518|AP001518—	7.00E−68
					2.6.1.1)	181
NO. 393	BL0629	781357	781791	+	asnc-type transcriptional regulator	trembl|Z92771|MTCY71_31	1.00E−32
NO. 394	BL0630	782110	783456	+	nadp-specific glutamate	tremblnew|AP001514|AP001514—	5.00E−162
					dehydrogenase (EC	107
NO. 395	BL0631	783833	785254	complement	hypothetical protein with unknown	trembl|AP000004|AP000004_110	3.00E−67
					function
NO. 396	BL0634	786722	789373	complement	dna gyrase subunit a (EC	swiss|P35885|GYRA_STRCO	0
					5.99.1.3) (gyrA)
NO. 397	BL0635	789441	791531	complement	dna gyrase subunit b, novobiocin-	swiss|P50075|GYBS_STRSH	0
					sensitive (EC
NO. 398	BL0637	792179	793366	complement	recombination protein recf (recF)	swissnew|P36176|RECF_STRCO	7.00E−60
NO. 399	BL0638	793445	794569	complement	dna polymerase iii, beta chain (EC	swissnew|P27903|DP3B_STRCO	2.00E−88
					2.7.7.7)
NO. 400	BL0640	795305	796807	complement	chromosomal replication initiator	trembl|AF222789|AF222789_7	5.00E−103
					protein dnaa.
NO. 401	BL0644	797963	798970	+	conserved hypothetical	trembl|AF031590|AF031590_7	6.00E−37
					transmembrane protein in
NO. 402	BL0645	799094	799627	+	narrowly conserved hypothetical	trembl|AF031590|AF031590_6	2.00E−40
					protein with
NO. 403	BL0646	799779	800444	+	possible glucose inhibited division	swiss|O54571|GIDB_STRCO	4.00E−33
					protein b.
NO. 404	BL0647	800655	801665	+	chromosome partitioning protein	trembl|AF187159|AF187159_5	1.00E−76
					para (parA)
NO. 405	BL0648	801665	803026	+	probable chromosome partitioning	trembl|AF031590|AF031590_3	4.00E−68
					protein (parB)
NO. 406	BL0649	803332	804357	complement	thioredoxin reductase (EC 1.6.4.5)	swissnew|O30973|TRXB_MYCSM	4.00E−87
					(trxB)
NO. 407	BL0651	806617	808344	complement	conserved hypothetical membrane	trembl|AL049826|SCH24_16	2.00E−50
					protein in mvin
NO. 408	BL0653	810608	812059	complement	hypothetical protein with possible	trembl|Z94121|MTY15F10_27	3.00E−28
					c-terminal
NO. 409	BL0654	811999	813402	+	probable rna	trembl|AL049826|SCH24_18	5.00E−162
					nucleotidyltransferase (pcnA or
NO. 410	BL0656	814163	815113	complement	4-diphosphocytidyl-2-c-methyl-d-	swissnew|O05596|ISPE_MYCTU	1.00E−30
					erythritol
NO. 411	BL0657	815110	816036	complement	dimethyladenosine transferase	trembl|Z94752|MTC1237_22	8.00E−66
					(EC 2.1.1.—)
NO. 412	BL0660	819239	821479	complement	widely conserved protein with	trembl|AL157953|SCL11_7	7.00E−34
					eukaryotic protein
NO. 413	BL0669	826542	826949	+	nrdi-like protein (nrdI)	swiss|P95107|NRDI_MYCTU	1.00E−33
NO. 414	BL0670	827065	829260	+	ribonucleoside-diphosphate	trembl|L34407|MTRSOR_1	0
					reductase 2 alpha
NO. 415	BL0671	829572	830564	+	ribonucleoside-diphosphate	trembl|U41100|MT41100_1	5.00E−153
					reductase 2 beta
NO. 416	BL0672	830643	831803	+	probable glycosyltransferase	tremblnew|AF267127|AF267127_11	1.00E−33
NO. 417	BL0673	832163	833290	+	atp binding protein of abc	trembl|Y08921|SRMSIK_1	5.00E−127
					transporter for
NO. 418	BL0676	843651	844637	+	sortase-like protein similar to	trembl|AF019629|AF019629_2	4.00E−43
NO. 419	BL0679	845958	847370	+	narrowly conserved hypothetical	trembl|AL357613|SC5F8_10	5.00E−116
					protein with
NO. 420	BL0680	847477	847986	complement	possible trna/rrna	gp|AL160331|7242757	2.00E−66
					methyltransferase (EC
NO. 421	BL0681	848557	849855	+	conserved hypotheticaltransport	tremblnew|AP001518|AP001518_42	7.00E−28
					protein
NO. 422	BL0682	849868	850764	+	protein probably involved in xylan	swiss|P26223|XYNB_BUTFI	9.00E−35
					degradation;
NO. 423	BL0683	850947	853934	+	cation-transporting atpase pacl	tremblnew|AP001515|AP001515—	0
					(EC 3.6.1.—)	249
NO. 424	BL0684	854349	855533	+	transpsosase in is256 family	swiss|Q52873|TRA5_RHIME	5.00E−61
NO. 425	BL0685	855689	856459	+	hisf cyclase (hisF)	trembl|AL096884|SC4G6_17	2.00E−96
NO. 426	BL0686	856593	856988	+	probable phosphoribosyl-amp	trembl|AL096884|SC4G6_13	4.00E−39
					cyclohydrolase (EC
NO. 427	BL0687	857069	858625	+	anthranilate synthase component i	swiss|P96556|TRPE_ARTGO	5.00E−147
					(EC 4.1.3.27)
NO. 428	BL0689	858941	860542	+	atp binding protein of abc	trembl|AL132644|SCI8_25	0
					transporter
NO. 429	BL0691	861364	861732	+	narrowly conserved protein with	trembl|AL118514|SCD25_30	9.00E−23
					unknown
NO. 430	BL0693	862453	864066	complement	atp binding protein of abc	trembl|AE000829|AE000829_9	3.00E−67
					transporter
NO. 431	BL0696	865593	866864	complement	is30-type transposase	trembl|AL021646|MTV014_36	1.00E−78
NO. 432	BL0702	875125	878160	+	excinuclease abc subunit a (uvrA)	swiss|P94972|UVRA_MYCTU	0
NO. 433	BL0703	878310	880676	+	excinuclease abc subunit c (uvrC)	swiss|Q9Z512|UVRC_STRCO	5.00E−180
NO. 434	BL0704	880785	881756	+	probable shikimate 5-	trembl|Z83863|MTCY159_29	9.00E−27
					dehydrogenase (EC 1.1.1.25)
NO. 435	BL0705	881756	882742	+	widely conserved hypothetical	trembl|AF106003|AF106003_2	4.00E−82
					protein with
NO. 436	BL0706	882941	883891	+	narrowly conserved hypothetical	trembl|Z80108|MTCY21B4_38	2.00E−71
					protein with
NO. 437	BL0707	883940	885265	+	phosphoglycerate kinase (EC	swiss|Q9Z519|PGK_STRCO	5.00E−137
					2.7.2.3) (pgk)
NO. 438	BL0708	885322	886125	+	triosephosphate isomerase (EC	swiss|O08408|TPIS_MYCTU	9.00E−68
					5.3.1.1) (tim)
NO. 439	BL0710	886539	887489	+	1-lactate dehydrogenase (EC	trembl|AB033627|AB033627_1	1.00E−67
					1.1.1.27) (ldh)
NO. 440	BL0712	888460	890004	+	probable aminotransferase hi0286	swiss|P71348|YFBQ_HAEIN	5.00E−151
					(EC 2.6.1.—)
NO. 441	BL0714	891415	892752	complement	branched-chain amino acid	trembl|U79494|BSU79494_1	3.00E−73
					transport system
NO. 442	BL0715	892881	893984	complement	transaldolase (EC 2.2.1.2) (tal)	swiss|O06812|TAL_MYCTU	5.00E−108
NO. 443	BL0716	894105	896213	complement	transketolase (EC 2.2.1.1) (tkt)	trembl|AL03I107|SC5A7_13	0
NO. 444	BL0718	896588	897706	+	heat-inducible transcription	swissnew|Q9RDD6|HRCA_STRCO	1.00E−70
					repressor (hrcA)
NO. 445	BL0719	897762	898907	+	chaperone protein (dnaJ)	swissnew|O05825|DNJ2_MYCTU	4.00E−91
NO. 446	BL0720	898953	899744	complement	conserved hypothetical protein	trembl|D90916|SSD916_76	9.00E−21
					with unknown
NO. 447	BL0721	899889	900773	+	possible undecaprenol kinase	trembl|Z95388|MTCY270_6	9.00E−54
					(bacA?)
NO. 448	BL0722	900930	901787	complement	narrowly conserved hypothetical	trembl|U00017|ML017_28	3.00E−35
					protein with
NO. 449	BL0724	902583	904616	+	threonyl-trna synthetase (EC	trembl|AL137778|SCL2_21	0
					6.1.1.3)
NO. 450	BL0725	904756	905340	+	conserved hypothetical protein	trembl|AL137778|SCL2_20	1.00E−49
					with hit domain
NO. 451	BL0726	905479	906234	+	widely conserved hypothetical	swiss|O33214|YQ03_MYCTU	3.00E−84
					protein in upf102
NO. 452	BL0727	906240	906824	+	crossover junction	swiss|Q50627|RUVC_MYCTU	2.00E−42
					endodeoxyribonuclease ruve
NO. 453	BL0728	906882	907508	+	probable bolliday junction dna	trembl|AL137778|SCL2_9	3.00E−29
					helicase ruva.
NO. 454	BL0729	907508	908572	+	bolliday junction dna helicase	trembl|AL137778|SCL2_8	5.00E−113
					ruvb. (ruvB)
NO. 455	BL0731	909135	909716	+	adenine phosphoribosyltransferase	tremblnew|AE005226|AE005226_1	1.00E−36
					(EC 2.4.2.7)
NO. 456	BL0732	909813	911015	+	succinyl-coa synthetase beta chain	trembl|AL035500|MLCL373_3	2.00E−95
					(EC 6.2.1.5)
NO. 457	BL0733	911015	911926	+	succinyl-coa synthetase alpha	trembl|AL035500|MLCL373_4	3.00E−98
					chain (EC 6.2.1.5)
NO. 458	BL0735	913273	914910	+	bifunctional purine biosynthesis	trembl|AB003159|AB003159_3	5.00E−171
					protein purh
NO. 459	BL0737	916421	917191	+	ribosomal large subunit	swiss|O33210|YHI1_MYCTU	2.00E−63
					pseudouridine synthase b
NO. 460	BL0738	917926	919317	+	probable gtp binding protein	tremblnew|AL445403|SC2134_11	5.00E−164
NO. 461	BL0739	919672	921201	+	probable utp-glucose-1-phosphate	swissnew|Q9SDX3|UDPG_MUSAC	5.00E−57
NO. 462	BL0742	923595	926186	+	probable helicase (heIY)	trembl|AL132648|SCI41_14	5.00E−150
NO. 463	BL0743	926301	926648	+	narrowly conserved hypothetical	trembl|AL133213|SC6D7_15	3.00E−23
					protein with
NO. 464	BL0746	928449	929081	complement	hypothetical protein with possible	swiss|Q50603|YI30_MYCTU	4.00E−34
					regulatory
NO. 465	BL0747	929182	929625	complement	possible signal transduction	trembl|AF173844|AF173844_2	8.00E−28
					protein (garA)
NO. 466	BL0748	929632	930453	complement	narrowly conserved hypothetical	swiss|Q50608|YI25_MYCTU	4.00E−23
					protein with
NO. 467	BL0748a	930469	930801	complement	hypothetical membrane protein	swiss|Q50609|YI24_MYCTU	1.00E−30
					with unknown
NO. 468	BL0750	931768	932385	complement	possible	swiss|Q50611|PGSA_MYCTU	2.00E−22
NO. 469	BL0751	932399	933250	complement	atp phosphoribosyltransferase (EC	swiss|O33256|HIS1_MYCTU	2.00E−73
					2.4.2.17)
NO. 470	BL0752	933262	933525	complement	phosphoribosyl-atp	swissnew|Q49786|HIS2_MYCLE	2.00E−25
					pyrophosphatase (EC 3.6.1.31)
NO. 471	BL0753	933588	934256	complement	ribulose-phosphate 3-epimerase	gp|AL159139|7209224	2.00E−69
					(EC 5.1.3.1)
NO. 472	BL0754	934332	935279	complement	probable prolipoprotein	trembl|AL096884|SC4G6_3	3.00E−55
					diacylglyceryl
NO. 473	BL0755	935392	936267	complement	tryptophan synthase alpha chain	swiss|O68906|TRPA_MYCIT	6.00E−65
					(EC 4.2.1.20)
NO. 474	BL0756	936285	938372	complement	tryptophan synthase beta chain	swissnew|O05625|TRPB_STRCO	5.00E−138
					(EC 4.2.1.20)
NO. 475	BL0757	938899	939750	complement	probable endonuclease iv (EC	tremblnew|AP001511|AP001511—	1.00E−52
					3.1.21.2)	275
NO. 476	BL0758	939874	941274	+	amino acid permease	trembl|AB006424|AB006424_71	5.00E−153
NO. 477	BL0764	944658	945116	complement	narrowly conserved hypothetical	trembl|AL031317|SC6G4_19	9.00E−34
					protein with
NO. 478	BL0774	951598	952218	complement	$$-like protein	tremblnew|AP001517|AP001517—	2.00E−37
						211
NO. 479	BL0778	954363	955937	+	histidine permease (hutM)	trembl|AB006424|AB006424_71	5.00E−165
NO. 480	BL0779	956141	956791	complement	probable signal peptidase i-2 (EC	trembl|AL023797|SC2E1_15	6.00E−37
					3.4.21.89)
NO. 481	BL0783	959691	960881	+	probable aminotransferase	trembl|Z99109|BSUB0006_32	2.00E−65
NO. 482	BL0784	960921	962684	+	conserved hypothetical protein	trembl|AL031317|SC6G4_20	1.00E−50
					with unknown
NO. 483	BL0786	963517	964440	+	lysr-type transcriptional regulator	trembl|Y17221|SA17221_1	4.00E−81
					(cpsY)
NO. 484	BL0788	966192	966887	complement	orotate phosphoribosyltransferase	swiss|P50587|PYRE_PSEAE	3.00E−44
					(EC 2.4.2.10)
NO. 485	BL0789	966896	967867	complement	dihydroorotate dehydrogenase	swissnew|O66461|PYRD_AQUAE	4.00E−69
					(EC 1.3.3.1)
NO. 486	BL0790	967870	968694	complement	probable dihydroorotate	swissnew|P25983|PYRK_BACSU	6.00E−31
					dehydrogenase electron
NO. 487	BL0791	968830	969783	complement	orotidine 5′-phosphate	trembl|AE002053|AE002053_4	2.00E−39
					decarboxylase (EC
NO. 488	BL0792	969801	971297	complement	dihydroorotase (EC 3.5.2.3)	swissnew|P46538|PYRC_BACCL	6.00E−58
					(dhoase) (pyrC)
NO. 489	BL0793	971294	971713	complement	aspartate carbamoyltransferase	swiss|O26938|PYRI_METTH	2.00E−24
					regulatory chain
NO. 490	BL0794	971713	972693	complement	aspartate carbamoyltransferase	swiss|P77918|PYRB_PYRAB	2.00E−79
					(EC 2.1.3.2)
NO. 491	BL0795	972817	976047	complement	glutamate-ammonia-ligase	swiss|Q10379|GLNE_MYCTU	5.00E−179
					adenylyltransferase (EC
NO. 492	BL0796	976103	977056	complement	choloylglycine hydrolase (EC	trembl|AF054971|AF054971_3	3.00E−73
					3.5.1.24)
NO. 493	BL0797	977190	978044	complement	5,10-methylenetetrahydrofolate	trembl|AL139077|CJ11168X4_191	3.00E−56
					reductase (EC
NO. 494	BL0798	978103	980406	complement	5-	swissnew|Q9PN94|METE_CAMJE	0
					methyltetrahydropteroyltriglutamat
					e-homocysteine
NO. 495	BL0800	981301	982371	complement	hypothetical protein with	trembl|AL132648|SCI41_34	3.00E−63
					similarity to pirnt
NO. 496	BL0804	983910	984647	complement	probable transcriptional activator	tremblnew|AP001516|AP001516—	5.00E−38
					similar to	108
NO. 497	BL0806	985707	986216	+	conserved hypothetical protein	pironly|E83182|E83182	1.00E−33
					with unknown
NO. 498	BL0821	996596	997183	complement	possible thioredoxin-dependent	gp|AL353832|7636005	2.00E−38
					thiol peroxidase
NO. 499	BL0825	999293	1000039	complement	probable atp binding protein of	trembl|AL021287|MTV012_55	6.00E−45
					abc transporter
NO. 500	BL0826	1000307	1001557	complement	possible glycosyltransferase	trembl|AL133278|SCM11_17	5.00E−110
					(glgA)
NO. 501	BL0829	1004313	1005953	complement	probable oligopeptide binding	trembl|AL022121|MTV025_15	5.00E−126
					protein of abc
NO. 502	BL0833	1008077	1009612	complement	glutamate synthase [nadph] small	trembl|AL109849|SC3A3_3	5.00E−151
					subunit (EC
NO. 503	BL0834	1009614	1014185	complement	glutamate synthase [nadph] large	trembl|AL109849|SC3A3_4	0
					subunit (EC
NO. 504	BL0838	1017184	1018230	complement	laci-type transcriptional regulator	trembl|AL158061|SC6D11_7	1.00E−45
NO. 505	BL0842	1020867	1021508	+	widely conserved hypothetical	tremblnew|AP001514|AP001514—	3.00E_27
					transmembrane	169
NO. 506	BL0843	1021558	1022742	complement	transpsosase in is256 family	swiss|Q52873|TRAS_RHIME	5.00E−61
NO. 507	BL0844	1022814	1023548	+	conserved hypothetical	tremblnew|AP001514|AP001514—	2.00E−20
					transmembrane protein	169
NO. 508	BL0845	1023926	1025146	complement	glycerate kinase (EC 2.7.1.31)	swissnew|P42100|GRK_BACSU	1.00E−83
					(glxK)
NO. 509	BL0846	1025243	1026343	+	laci-type transcriptional regulator	trembl|AB016845|AB016845_1	3.00E−36
NO. 510	BL0847	1026423	1027832	complement	probable oxygen-independent	trembl|AL136503|SCC77_26	6.00E−80
					coproporphyrinogen
NO. 511	BL0848	1027832	1029712	complement	gtp-binding protein lepa (lepA)	swiss|P71739|LEPA_MYCTU	0
NO. 512	BL0850	1030371	1031162	complement	conserved hypothetical	swissnew|O86576|YU26_STRCO	6.00E−35
					transmembrane protein
NO. 513	BL0851	1031410	1032342	complement	conserved hypothetical protein	swiss|P33653|YBL1_STRCI	8.00E−27
					similar to mazg
NO. 514	BL0852	1032503	1033630	complement	probable branched-chain amino	piromly|A82612|A82612	5.00E−103
					acid
NO. 515	BL0853	1033855	1034475	complement	probable 50s ribosomal protein	swiss|P96385|RL25_MYCTU	4.00E−28
					125 (rpIY)
NO. 516	BL0856	1036138	1037562	complement	nad(p) transhydrogenase subunit	trembl|U05294|RR05294_3	5.00E−101
					beta (EC
NO. 517	BL0857	1037883	1039046	complement	nad(p) transhydrogenase subunit	trembl|Z92770|MTCI5_28	5.00E−57
					alpha part 1 (EC
NO. 518	BL0858	1039387	1041498	+	long-chain-fatty-acid-coa ligase	trembl|AL021957|MTV021_21	5.00E−115
					(fadD15)
NO. 519	BL0859	1041551	1042615	complement	widely conserved gtp-binding	swiss|O05834|ERA_MYCTU	2.00E−77
					protein (bex)
NO. 520	BL0860	1042617	1044050	complement	probable conserved integral	swiss|O05832|YN66_MYCTU	4.00E−64
					memebrane protein
NO. 521	BL0861	1044126	1044674	complement	conserved hypothetical protein	swiss|O05831|YN67_MYCTU	2.00E−35
					with duf0054
NO. 522	BL0862	1044664	1045839	complement	phob-like protein.	trembl|AL136534|SCC117_5	2.00E−83
NO. 523	BL0863	1045858	1046196	complement	hypothetical protein in hit family	trembl|AL136503|SCC77_15	1.00E−28
NO. 524	BL0864	1046245	1047042	complement	conserved hypothetical protein	trembl|AL136503|SCC77_19	4.00E−28
					with similarity
NO. 525	BL0865	1047286	1048164	+	possible trna/rrna	trembl|AL157953|SCL11_8	3.00E−65
					methyltransferase (EC
NO. 526	BL0866	1048365	1049609	+	glucose-1-phosphate	swiss|O05314|GLGC_MYCTU	5.00E−122
					adenylyltransferase (EC
NO. 527	BL0867	1049699	1050292	complement	conserved hypothetical protein	trembl|AL021184|MTV007_13	3.00E−26
					with duf59
NO. 528	BL0868	1050299	1050838	complement	hypothetical protein with nifu-like	trembl|AL096839|SCC22_2	1.00E−29
					domain
NO. 529	BL0869	1050865	1052139	complement	nifs-like aminotranferase	trembl|AL021184|MTV007_11	5.00E−103
NO. 530	BL0870	1052278	1053057	complement	probable atp binding protein of	trembl|AL096839|SCC22_4	5.00E−100
					abc transporter
NO. 531	BL0871	1053083	1054318	complement	possible abc transporter	trembl|AL096839|SCC22_6	2.00E−82
					component
NO. 532	BL0872	1054324	1055823	complement	possible abc transporter	trembl|AL096839|SCC22_7	0
					component
NO. 533	BL0874	1057888	1059549	complement	ctp synthase (EC 6.3.4.2) (utp-	trembl|AL109848|SCI51_16	0
					ammonia ligase)
NO. 534	BL0875	1059695	1060981	complement	hypothetical protein in the	trembl|AF008220|AF008220_96	3.00E−33
					m20/m25/m40
NO. 535	BL0876	1061195	1061641	complement	probable 3-dehydroquinate	trembl|AE001933|AE001933_1	2.00E−33
					dehydratase (EC
NO. 536	BL0877	1061805	1063427	complement	bifunctional shikimate kinase (EC	swiss|Q9X5D2|AROB_CORGL	3.00E−91
					2.7.1.71)-
NO. 537	BL0878	1063510	1064697	complement	chorismate synthase (EC 4.6.1.4)	swissnew|P95013|AROC_MYCTU	5.00E−134
NO. 538	BL0880	1065402	1066583	complement	conserved hypothetical protein	tremblnew|AL445503|SC2G38_36	2.00E−34
					with duf175
NO. 539	BL0882	1067061	1069742	complement	alanyl-trna synthetase (EC	swiss|O07438|SYA_MYCTU	0
					6.1.1.7)
NO. 540	BL0885	1071666	1073525	+	hypothetical protein with unknown	trembl|U93874|BSU93874_12	5.00E−63
					function
NO. 541	BL0886	1073616	1074242	complement	30s ribosomal protein s4 (rpsD)	trembl|AF008220|AF008220_126	7.00E−42
NO. 542	BL0887	1074441	1075409	complement	atp binding protein of abc	trembl|AE001001|AE001001_4	2.00E−36
					transporter
NO. 543	BL0890	1077262	1079907	complement	atp-dependent dna helicase pcra	trembl|Z79700|MTCY10D7_10	0
					(EC 3.6.1.—)
NO. 544	BL0891	1080024	1080605	+	xanthine	pironly|E82984|E82984	1.00E−45
					phosphoribosyltransferase (EC
					2.42.—)
NO. 545	BL0892	1080656	1082020	+	xanthine/uracil permease (pbuX)	tremblnew|AL162755|NMA4Z2491—	5.00E−65
						77
NO. 546	BL0893	1082150	1082359	complement	hypothetical protein with probable	trembl|AL121854|SCJ33_10	3.00E−23
					helix turn
NO. 547	BL0895	1083890	1084828	+	narrowly conserved hypothetical	trembl|AL138977|SC7F9_36	2.00E−28
					protein with
NO. 548	BL0897	1085477	1086091	+	probable	trembl|U59967|MT59967_1	5.00E−40
					pyrazinamidase/nicotinamidase
					(pncA)
NO. 549	BL0901	1090564	1091640	complement	probable atp binding protein of	tremblnew|AP001514|AP001514—	2.00E−58
					abc transporter	104
NO. 550	BL0903	1093282	1093938	+	response regulator of two-	trembl|AL079332|SCI5_9	7.00E−32
					component system
NO. 551	BL0905	1094763	1095815	complement	hypothetical protein in pho-4	swiss|O34436|PIT_BACSU	5.00E−50
					inorganic
NO. 552	BL0906	1096190	1098589	complement	carbon starvation protein a (cstA)	swiss|P95095|CSTA_MYCTU	0
NO. 553	BL0907	1098732	1100129	+	possible cyclomaltodextrinase (EC	tremblnew|AP001517|AP001517_49	2.00E−34
					3.2.1.54) or
NO. 554	BL0909	1100941	1103127	complement	possible atp-dependent rna	gp|AL159178|7210999	1.00E−93
					helicase
NO. 555	BL0910	1103507	1104796	complement	probable purine or uracil permease	gp|AL159139|7209210	5.00E−107
					(pyrP)
NO. 556	BL0914	1107193	1108356	complement	narrowly conserved hypothetical	trembl|Y17797|EFY17797_6	1.00E−37
					protein with
NO. 557	BL0918	1111212	1112912	+	hypothetical protein with probable	swiss|P71584|PKNB_MYCTU	4.00E−23
NO. 558	BL0919	1112950	1114440	complement	possible efflux transporter protein	trembl|X92946|LLLPK214_12	1.00E−31
NO. 559	BL0920	1114752	1116803	complement	possible efflux transporter protein	trembl|D50453|BSD453_85	6.00E−96
NO. 560	BL0926	1121476	1122570	complement	widely conserved hypothetical	trembl|AL021897|MTV017_64	5.00E−125
					gtpase-like
NO. 561	BL0927	1122588	1123388	complement	pyrroline-5-carboxylate reductase	swiss|P27771|PROC_TREPA	1.00E−50
					(EC 1.5.1.2)
NO. 562	BL0928	1123463	1124806	complement	proline iminopeptidase (EC	trembl|D61383|HAD383_1	5.00E−103
					3.4.11.5) (pip)
NO. 563	BL0929	1125017	1127593	+	histidine kinase sensor of two-	trembl|AL049630|SCE126_8	5.00E−36
					component
NO. 564	BL0930	1127669	1128415	+	response regulator of two-	trembl|AL031155|SC3A7_31	2.00E−55
					component system
NO. 565	BL0931	1128507	1131149	complement	possible transport protein	trembl|AL021999|MTV044_11	3.00E−22
NO. 566	BL0932	1131191	1131982	complement	possible atp binding protein of abc	gp|AL159178|7211019	8.00E−64
					transporter
NO. 567	BL0933	1132331	1133647	complement	o-acetylhomoserine (thiol)-lyase	tremblnew|AP001516|AP001516_32	5.00E−134
					(EC 4.2.99.10)
NO. 568	BL0934	1134200	1135072	+	possible pyridoxine kinase (EC	trembl|AE001176|AE001176_8	1.00E−24
					2.7.1.35)
NO. 569	BL0936	1135870	1137405	+	conserved hypothetical protein in	swiss|Q10818|YS97_MYCTU	5.00E−118
					chelatase
NO. 570	BL0937	1137402	1139102	+	hypothetical protein with partial	swiss|Q10817|YS96_MYCTU	5.00E−29
					similarity to
NO. 571	BL0938	1139159	1141024	+	succinate dehydrogenase	trembl|AL021841|MTV016_16	5.00E−137
					flavoprotein subunit (EC
NO. 572	BL0939	1141120	1142085	+	probable iorn sulfur protein	trembl|AL021841|MTV016_17	6.00E−35
					associated with
NO. 573	BL0941	1142890	1143831	complement	conserved hypothetical protein	trembl|X81379|CGDAPE_2	9.00E−61
					with unknown
NO. 574	BL0942	1144064	1145482	complement	probable sodium/proton antiporter	trembl|AL035636|SCH5_27	4.00E−69
					(nhaA)
NO. 575	BL0943	1145964	1147457	complement	atp-dependent specificity	trembl|X95306|BSCLPXGEN_1	5.00E−128
					component of theclp
NO. 576	BL0944	1147504	1148205	complement	atp-dependent clp protease	trembl|AF071885|AF071885_2	7.00E−72
					proteolytic subunit 2
NO. 577	BL0945	1148211	1148834	complement	atp-dependent clp protease	swiss|O53188|CLP1_MYCTU	1.00E−57
					proteolytic subunit 1
NO. 578	BL0946	1149435	1150901	complement	conserved hypothetical protein	trembl|AF179611|AF179611_12	2.00E−30
					with unknown
NO. 579	BL0947	1151085	1152464	complement	trigger factor chaperone (tf) (tig)	swissnew|O53189|TIG_MYCTU	5.00E−79
NO. 580	BL0948	1152519	1153820	complement	narrowly conserved hypothetical	trembl|AL023702|SC1C3_16	1.00E−75
					protein with
NO. 581	BL0950	1154518	1155399	complement	pyruvate formate-lyase 1	trembl|AF088897|AF088897_13	9.00E−54
					activating enzyme (EC
NO. 582	BL0951	1155509	1157923	complement	formate acetyltransferase (EC	trembl|AF088897|AF088897_12	0
					2.3.1.54)
NO. 583	BL0953	1158427	1160124	complement	glutamine-dependent nad(+)	trembl|Y17736|SCY17736_1	5.00E−132
					synthetase (EC
NO. 584	BL0954	1160473	1161624	complement	widely conserved hypothetical	swissnew|O34980|YTNL_BACSU	6.00E−75
					protein with
NO. 585	BL0955	1161713	1162399	complement	permease protein of abc	trembl|AE001982|AE001982_3	2.00E−40
					transporter system
NO. 586	BL0956	1162396	1163601	complement	atp binding protein of abc	tremblnew|AP001518|AP001518—	8.00E−77
					transporter	312
NO. 587	BL0957	1163735	1164715	complement	hypothetical protein with	swiss|Q08870|PLPC_PASHA	5.00E−36
					similarity to proteins
NO. 588	BL0958	1164917	1165738	+	possible had-type hydrolase	trembl|AF012285|AF012285_30	2.00E−24
NO. 589	BL0959	1165860	1168337	complement	xylulose-5-phosphate/fructose-6-	trembl|D90917|SSD917_62	0
					phosphate
NO. 590	BL0960	1168738	1170345	+	gmp synthase glutamine	gp|AL161755|7320904	0
					amidotransferase (guaA)
NO. 591	BL0962	1170921	1172795	+	hypothetical membrane protein	trembl|U93874|BSU93874_12	4.00E−61
					with possible
NO. 592	BL0963	1172872	1173903	+	ribose-phosphate	trembl|Z92539|MTCY10G2_4	5.00E−113
					pyrophosphokinase (EC 2.7.6.1)
NO. 593	BL0964	1174185	1175567	+	udp-n-acetylglucosamine	trembl|Z92539|MTCY10G2_5	5.00E−112
					pyrophosphorylase (EC
NO. 594	BL0965	1175571	1175984	+	hypothetical protein with duf143	trembl|AL136518|SCC123_15	1.00E−27
NO. 595	BL0966	1176166	1176864	+	conserved hypothetical protein	trembl|AE001959|AE001959_11	2.00E−20
					with unknown
NO. 596	BL0968	1177494	1179194	+	phosphate acetyltransferase (EC	swiss|P96254|PTA_MYCTU	3.00E−95
					2.3.1.8)
NO. 597	BL0969	1179329	1180558	+	acetate kinase (EC 2.7.2.1)	swiss|P77845|ACKA_CORGL	5.00E−106
					(acetokinase)
NO. 598	BL0970	1180729	1182096	complement	3-phosphoshikimate 1-	trembl|AF114233|AF114233_1	2.00E−96
					carboxyvinyltransferase (EC
NO. 599	BL0972	1183626	1184219	+	hypothetical protein with site-	trembl|AL008967|MTV002_57	2.00E−43
					specific
NO. 600	BL0973	1184206	1185528	+	probable transposase	trembl|AL008967|MTV002_56	1.00E−49
NO. 601	BL0976	1186907	1188394	complement	galactoside symporter (lacS)	swissnew|Q48624|LACY_LEULA	5.00E−149
NO. 602	BL0978	1188759	1191830	+	beta-galactosidase (EC 3.2.1.23)	trembl|AJ242596|BLO242596_1	0
					(lactase)
NO. 603	BL0979	1192644	1193198	+	dna-3-methyladenine glycosylase i	trembl|AJ242596|BLO242596_2	5.00E−108
					(EC 3.2.2.20)
NO. 604	BL0982	1194993	1197134	complement	probable glycogen operon protein	gp|AB031392|7648481	0
					glgx (EC
NO. 605	BL0984	1197908	1198837	complement	conserved hypothetical protein	gp|AL352972|7619756	3.00E−46
					with duf34
NO. 606	BL0985	1198998	1201865	complement	dna polymerase i (EC 2.7.7.7) (pol	swiss|Q07700|DPO1_MYCTU	0
					i) (polA)
NO. 607	BL0986	1201911	1202696	complement	conserved hypothetical protein	trembl|AL109732|SC7H2_27	2.00E−49
					with a response
NO. 608	BL0988	1203789	1205318	complement	pyruvate kinase (EC 2.7.1.40)	trembl|AL109732|SC7H2_28	5.00E−130
NO. 609	BL0989	1205399	1206385	complement	widely conserved hypothetical	trembl|AL035591|SCC54_23	2.00E−82
					protein with
NO. 610	BL0990	1206554	1208665	complement	excinuclease abc subunit b (uvrB)	swiss|O06150|UVRB_MYCTU	0
NO. 611	BL0991	1208677	1209294	complement	hypothetical protein in upf0038	trembl|AL109732|SC7H2_10	7.00E−35
NO. 612	BL0992	1209468	1210943	complement	30s ribosomal protein s1 (rpsA)	trembl|AL109732|SC7H2_12	0
NO. 613	BL0993	1211063	1211941	complement	bifunctional	trembl|AL009198|MTV004_11	6.00E−86
					methylenetetrahydrofolate
NO. 614	BL0994	1212042	1213238	+	possible solute binding protein of	trembl|AL583918|MLEPRTN2_43	5.00E−29
					abc
NO. 615	BL0995	1213315	1214301	+	atp binding protein of abc	tremblnew|	2.00E−27
					transporter (troB)	AP001511|AP001511_283
NO. 616	BL0996	1214368	1215201	+	possible permease of abc	pironly|F82959|F82959	4.00E−30
					transporter system
NO. 617	BL0997	1215253	1215777	complement	2c-methyl-d-erythritol 2,4-	swissnew|P96863|ISPF_MYCTU	5.00E−30
					cyclodiphosphate
NO. 618	BL0998	1215886	1216479	complement	possible transcriptional regulator	trembl|AL022075|MTV024_1	8.00E−46
NO. 619	BL0999	1216696	1218909	+	1,4-alpha-glucan branching	swissnew|Q10625|GLGB_MYCTU	0
					enzyme (glgB)
NO. 620	BL1000	1218945	1219667	+	response regulator of two-	trembl|Z95121|MTY20B11_21	3.00E−47
					component system
NO. 621	BL1001	1219664	1220740	+	histidine kinase sensor of two-	tremblnew|AP001513|	1.00E−37
					component system	AP001513_218
NO. 622	BL1007	1224806	1227901	complement	narrowly conserved hypothetical	trembl|L22864|SAWHIB12X_2	7.00E−26
					protein with
NO. 623	BL1008	1227945	1228244	complement	whib-type transcription regulator	trembl|AL021840|MTV015_3	8.00E−28
					(whiB2)
NO. 624	BL1009	1228495	1229928	+	hypothetical protein with	trembl|AL023702|SC1C3_8	2.00E−25
					similarity to putative
NO. 625	BL1010	1230173	1231924	+	hypothetical protein with	gp|AL160312|7242725	8.00E−48
					ftsk/spoiiie domain
NO. 626	BL1011	1232038	1232316	+	whib-type transcription regulator	trembl|AJ239087|SCO239087_1	1.00E−28
					wbIE)
NO. 627	BL1012	1232389	1233921	complement	histidine kinase-like protein	trembl|Z95120|MTCY7D11_18	7.00E−80
NO. 628	BL1014	1235063	1235881	+	conserved hypothetical protein	trembl|AB003158|AB003158_1	5.00E−33
					with unknown
NO. 629	BL1015	1235936	1236415	complement	transcription elongation factor	tremblnew|AL451182|SCK13_13	2.00E−31
					grea (transcript
NO. 630	BL1016	1236514	1236921	complement	fk506-binding protein (peptidyl-	pironly|S46228|S46228	2.00E−25
					prolyl cis-trans
NO. 631	BL1017	1237063	1239282	complement	1-serine dehydralase (EC 4.2.1.13)	swiss|O86564|SDHL_STRCO	5.00E−136
					(1-serine
NO. 632	BL1019	1239669	1240670	complement	possible exopolyphosphatase-like	trembl|Z92539|MTCY10G2_13	3.00E−57
					protein
NO. 633	BL1020	1240733	1241299	complement	hypothetical protein with unknown	trembl|Z92539|MTCY10G2_12	1.00E−30
					function
NO. 634	BL1022	1241998	1243296	complement	enolase (EC 4.2.1.11) (2-	swiss|P37869|ENO_BACSU	5.00E−143
					phosphoglycerate
NO. 635	BL1023	1243447	1244394	complement	possible oxidoreductase in aldo-	trembl|AE002028|AE002028_7	9.00E−33
					keto reductase
NO. 636	BL1025	1244534	1248118	complement	transcription-repair coupling	swiss|P96380|MFD_MYCTU	0
					factor (mfd)
NO. 637	BL1026	1248108	1248707	complement	peptidyl-trna hydrolase (EC	swiss|P96386|PTH_MYCTU	2.00E−36
					3.1.1.29) (pth)
NO. 638	BL1028	1250516	1251013	complement	possible n-acetyl transferase	trembl|AE001967|AE001967_8	1.00E−21
NO. 639	BL1029	1251136	1254336	complement	narrowly conserved hypothetical	trembl|AL021646|MTV014_38	5.00E−154
					protein with
NO. 640	BL1031	1254509	1255711	+	hypothetical protein in glycosyl	trembl|AL021929|MTV034_1	2.00E−21
					hyrolase family
NO. 641	BL1032	1255809	1256594	complement	possible nicotinate-nucleotide	trembl|AL136518|SCC123_17	3.00E−69
NO. 642	BL1034	1257169	1258581	complement	gamma-glutamyl phosphate	trembl|AL136518|SCC123_23	5.00E−117
					reductase (gpr) (EC
NO. 643	BL1035	1258586	1259287	complement	serine hydroxymethyltransferase	swiss|O53441|GLA1_MYCTU	1.00E−40
					(glyA)
NO. 644	BL1036	1259510	1261000	+	threonine synthase (EC 4.2.99.2)	swiss|Q42598|THRC_SCHPO	7.00E−73
					(thrC)
NO. 645	BL1038	1261520	1264306	+	possible calcium-transporting	trembl|AE000873|E000873_1	5.00E−149
					atpase 10, plasma
NO. 646	BL1041	1265818	1266738	complement	atp binding protein of abc	tremblnew|AP001509|AP001509_90	5.00E−52
					transporter
NO. 647	BL1041a	1266760	1267134	complement	possible gntr-family	tremblnew|AP001509|AP001509_89	3.00E−25
					transcriptional regulator
NO. 648	BL1043	1268017	1269819	complement	dna repair protein recn	swissnew|Q9S220|RECN_STRCO	2.00E−81
					(recombination protein
NO. 649	BL1044	1269819	1270847	complement	widely conserved hypothetical	trembl|AL109848|SCI51_21	4.00E−59
					protein with
NO. 650	BL1045	1271094	1272560	+	hypothetical protein possibly	trembl|Z99119|BSUB0016_183	2.00E−57
					involved in
NO. 651	BL1046	1272611	1273273	+	hypothetical protein possibly	tremblnew|AP001509|AP001509_35	6.00E−31
					involved in
NO. 652	BL1048	1274067	1274909	complement	hemolysin-like protein with s4	gp|AJ271681|7340781	4.00E−47
					domain found in
NO. 653	BL1049	1275097	1276137	complement	conserved hypothetical protein	trembl|AL109848|SCI51_28	1.00E−59
					with possible
NO. 654	BL1050	1276146	1277933	complement	hypothetical protein with unknown	trembl|Z98268|MTCI125_12	2.00E−27
					function
NO. 655	BL1051	1277961	1279283	complement	tyrosyl-trna synthetase (EC	trembl|AL132644|SC18_3	5.00E−122
					6.1.1.1)
NO. 656	BL1054	1281281	1282090	complement	thiamine biosynthesis protein	trembl|AE000735|AE000735_1	4.00E−81
					(thiF)
NO. 657	BL1055	1282167	1283036	complement	thiamine biosynthesis protein	trembl|AL139077|CJ11168X4_37	2.00E−76
					(thiG)
NO. 658	BL1057	1283591	1285063	complement	argininosuccinate lyase (EC	trembl|AL157956|SCL24_6	5.00E−162
					4.3.2.1)
NO. 659	BL1058	1285509	1286747	complement	argininosuccinate (EC	swiss|P50986|ASSY_STRCL	5.00E−152
					6.3.4.5)
NO. 660	BL1059	1286830	1287342	complement	arginine repressor-like protein	trembl|AL157956|SCL24_12	3.00E−28
					(argR)
NO. 661	BL1060	1287339	1288304	complement	ornithine carbamoyltransferase,	swiss|P94991|OTCA_MYCTU	6.00E−96
					anabolic (EC
NO. 662	BL1061	1288348	1289643	complement	acetylornithine aminotransferase	trembl|AL157956|SCL24_13	3.00E−85
					(EC 2.6.1.11)
NO. 663	BL1062	1289633	1290589	complement	acetylglutamate kinase (EC	swiss|Q59281|ARGB_CORGL	1.00E−93
					2.7.2.8) (nag kinase)
NO. 664	BL1063	1290661	1291836	complement	glutamate n-acetyltransferase (EC	gp|Z49111|7328263	4.00E−91
					2.3.1.35)
NO. 665	BL1064	1291833	1292927	complement	n-acetyl-gamma-glutamyl-	swiss|P54895|ARGC_STRCO	5.00E−88
					phosphate reductase (EC
NO. 666	BL1066	1293743	1296352	complement	phenylalanyl-trna synthetase beta	swissnew|O88054|SYFB_STRCO	5.00E−173
					chain (EC
NO. 667	BL1067	1296360	1297427	complement	phenylalanyl-trna synthetase alpha	swissnew|P94984|SYFA_MYCTU	5.00E−100
					chain (EC
NO. 668	BL1068	1297481	1298365	complement	possible rma methylase	trembl|AL031541|SC135_19	6.00E−33
NO. 669	BL1070	299379	1300782	complement	atp binding protein of abc	trembl|AJ002571|BSAJ2571_41	3.00E−70
					transporter
NO. 670	BL1072	1301753	1303120	complement	widely conserved protein in	trembl|AL021185|MTV009_7	5.00E−94
					peptidase or
NO. 671	BL1074	1303982	1305472	+	dihydrolipoamide dehydrogenase	trembl|L38646|SEFORA_2	5.00E−76
					(EC 1.8.1.4)
NO. 672	BL1076	1306658	1308094	+	glutamine synthetase 1 (EC	tremblnew|AX063815|AX063815_1	0
					6.3.1.2)
NO. 673	BL1077	1308172	1308276	complement	fragment of beta-glucuronidase	trembl|AF305888|AF305888_3	5.00E−20
NO. 674	BL1079	1309870	1310070	+	fragment of laca	swissnew|P07464|THGA_ECOLI	1.00E−22
NO. 675	BL1080	1310080	1310754	complement	galactoside o-acetyltransferase	tremblnew|AE005213|AE005213_7	2.00E−47
					(EC 2.3.1.18)
NO. 676	BL1081	1310916	1311608	complement	possible endonuclease iii	trembl|U67584|MJU67584_8	2.00E−30
NO. 677	BL1082	1311616	1312974	complement	conserved hypothetical	tremblnew|AP001514|	9.00E−62
					transmembrane protein in	AP001514_169
NO. 678	BL1083	1313032	1315629	complement	excinuclease abc subunit a-like	trembl|AL133469|SCM10_6	5.00E−145
					protein
NO. 679	BL1090	1322865	1323908	complement	possible alcohol dehydrogenase	trembl|U95372|U95372_2	6.00E−93
NO. 680	BL1094	1325764	1326828	complement	conserved hypothetical protein	swiss|P33019|YEIH_ECOLI	2.00E−31
					with unknown
NO. 681	BL1097	1328892	1330130	complement	elongation factor tu (ef-tu) (tuf)	swiss|P31501|EFTU_MYCTU	5.00E−173
NO. 682	BL1098	1330264	1332387	complement	elongation factor g (ef-g) (fusA)	swiss|O53790|EFG_MYCTU	0
NO. 683	BL1099	1332419	1332889	complement	30s ribosomal protein s7. (rpsG)	trembl|L34681|MSRPSLG_2	4.00E−64
NO. 684	BL1100	1332895	1333266	complement	ribosomal protein s12 (rpsL)	swissnew|P97222|RS12_STRCO	4.00E−55
NO. 685	BL1102	1334032	1335093	complement	probable na+ dependent	trembl|AF027868|AF027868_63	5.00E−64
					transporter possibly for
NO. 686	BL1103	1335655	1336680	+	possible low specificity-threonine	trembl|AE001274|AE001274_45	3.00E−68
					aldolase
NO. 687	BL1104	1336827	1337987	complement	possible glycosyltransferase	trembl|AE001525|AE001525_12	2.00E−61
NO. 688	BL1105	1338155	1339498	+	probable	pironly|B83176|B83176	3.00E−83
					phosphoribosylglycinamide
NO. 689	BL1107	1339891	1340643	+	phosphoribosylaminoimidazole-	tremblnew|AP001509|AP001509_64	8.00E−68
					succinocarboxamide
NO. 690	BL1108	1340706	1344440	+	phosphoribosylformyl-	trembl|	5.00E−50
					glycinamidine	U32759|HI32759_4
					synthase (EC
NO. 691	BL1109	1344331	1345875	+	possible carboxylesterases or	tremblnew|AL512977|SSOLP2N16—	1.00E−30
					lipases.	40
NO. 692	BL1111	1347888	1349402	complement	possible na(+)/h(+) antiporter	pironly|G81187|G81187	5.00E−25
					(sodium/proton
NO. 693	BL1113	1350694	1351671	+	hypothetical protein in aldo/keto	trembl|AE002063|AE002063_8	6.00E−71
					reductase 2
NO. 694	BL1114	1351920	1353515	complement	hypothetical protein in	trembl|AF188935|AF188935_69	1.00E−34
					impb/mucb/samb family of
NO. 695	BL1115	1353674	1355176	+	adenosylhomocysteinase (EC	trembl|AP000060|AP000060_91	3.00E−61
					3.3.1.1)
NO. 696	BL1116	1355216	1356589	+	possible chlorohydrolase-like	swiss|O29265|Y997_ARCFU	1.00E−21
					protein
NO. 697	BL1119	1358229	1359191	+	probable permease protein for abc	trembl|AE001090|AE001090_13	4.00E−28
					transporter
NO. 698	BL1120	1359188	1359973	+	probable atp binding protein of	trembl|AE001058|AE001058_14	7.00E−67
					abc transporter
NO. 699	BL1121	1360377	1361888	+	amidophosphoribosyltransferase	trembl|U64311|U64311_5	0
					precursor (EC
NO. 700	BL1122	1361954	1363045	+	phosphoribosylformyl-	tremblnew|AP001509|AP001509_69	5.00E−123
					glycinamidine
					cyclo-ligase
NO. 701	BL1123	1363072	1364340	+	phosphoribosylamine-glycine	swiss|Q9ZF44|PUR2_LACLA	5.00E−130
					ligase (EC
NO. 702	BL1124	1364714	1366351	complement	fatty aldehyde dehydrogenase (EC	gp|AE003841|7304213	9.00E−81
					1.2.1.3)
NO. 703	BL1125	1366472	1368547	complement	hypothetical protein with	trembl|AB010970|AB010970_8	2.00E−80
					similarity to orf7
NO. 704	BL1128	1370243	1370683	complement	probable metal uptake regulator	trembl|AL137166|SCC121_11	6.00E−31
					similar to
NO. 705	BL1129	1370680	1371858	complement	phosphoribosylaminoimidazole	trembl|AJ000883|LLJ000883_4	5.00E−102
					carboxylase atpase
NO. 706	BL1130	1371842	1372348	complement	phosphoribosylaminoimidazole	swiss|P12044|PUR6_BACSU	9.00E−58
					carboxylase
NO. 707	BL1131	1372444	1373436	complement	nadph: quinone oxidoreductases or	trembl|U75363|RPU75363_7	4.00E−42
					alcohol
NO. 708	BL1132	1373475	1375799	+	probable I-deoxyxylulose-5-	swiss|P26242|DXS_RHOCA	1.00E−71
					phosphate synthase
NO. 709	BL1135	1378547	1379302	complement	atp binding protein of abc	trembl|AE001033|AE001033_4	3.00E−56
					transporter
NO. 710	BL1137	1380999	1382000	complement	protein similar to hex regulon	tremblnew|AL450223|SC7H9_11	5.00E−34
					repressor
NO. 711	BL1138	1381966	1384275	+	alpha-1-arabinofuranosidase a (EC	trembl|U15178|BO15178_1	3.00E−70
					3.2.1.55)
NO. 712	BL1140	1384741	1385928	complement	possible transport protein	swiss|P75788|YBIR_ECOLI	3.00E−27
NO. 713	BL1142	1386478	1387410	complement	1-asparaginase precursor (EC	swiss|P37595|ASGX_ECOLI	3.00E−49
					3.5.1.1)
NO. 714	BL1144	1387766	1389430	complement	probable multiple substrate	trembl|AB027131|AB027131_1	4.00E−72
					aminotransferase
NO. 715	BL1145	1389488	1390126	complement	conserved hypothetical protein in	trembl|AL137778|SC12_12	5.00E−38
					sno glutamine
NO. 716	BL1146	1390212	1391183	complement	widely conserved protein in	swiss|P45293|YG47_HAEIN	5.00E−125
					upfoo19 probably
NO. 717	BL1147	1391279	1393387	complement	dna primase (EC 2.7.7.—) (dnaG)	swissnew|O52200|PRIM_MYCSM	5.00E−125
NO. 718	BL1148	1393551	1394978	complement	deoxyguanosinetriphosphate	trembl|AL137187|SC7A8_9	5.00E−108
					triphosphohydrolase
NO. 719	BL1149	1395030	1396388	complement	alanine racemase (EC 5.1.1.1)	swiss|O86786|ALR_STRCO	6.00E−87
					(alr)
NO. 720	BL1150	1396601	1398037	+	probable amino acid transporter	trembl|Z99109|BSUB0006_21	5.00E−150
					(yfnA)
NO. 721	BL1152	1399009	1399428	complement	autoinducer-2 production protein	swissnew|Q9XDU6|LUXS_CLOPE	2.00E−24
					luxs (ai-2
NO. 722	BL1153	1399616	1401571	complement	atp-dependent dna helicase recq	trembl|AF027868|AF027868_53	5.00E−117
					(EC 3.6.1.—)
NO. 723	BL1155	1403593	1404777	complement	cystathionine gamma-synthase	swiss|P46807|METB_MYCLE	5.00E−126
					(EC 4.2.99.9) (cgs)
NO. 724	BL1156	1404869	1406095	complement	cystathionine beta-synthase (EC	tremblnew|AF319543|AF319543_2	5.00E−121
					4.2.1.22)
NO. 725	BL1157	1406422	1407207	complement	probable atp binding protein of	tremblnew|AE005342|AE005342_4	4.00E−41
					abc transporter
NO. 726	BL1158	1407200	1407991	complement	probable atp-binding protein of	trembl|AJ248288|CNSPAX06_207	4.00E−47
					abc transporter
NO. 727	BL1159	1407988	1408890	complement	probable abc transporter permease	tremblnew|AP001507|AP001507_30	1.00E−33
					protein for
NO. 728	BL1160	1408887	1409864	complement	probable abc transporter permease	trembl|AE000548|AE000548_6	5.00E−46
					protein for
NO. 729	BL1161	1409929	1411548	complement	solute binding protein of abc	trembl|AP000003|AP000003_207	8.00E−39
					transporter
NO. 730	BL1162	1411674	1412444	+	conserved hypothetical protein	tremblnew|AP001507|AP001507_86	6.00E−52
					with unknown
NO. 731	BL1163	1412504	1413880	complement	probable solute binding protein of	trembl|AL158061|SC6D11_4	7.00E−79
					abc
NO. 732	BL1164	1414041	1415384	complement	probable solute binding protein of	trembl|AL158061|SC6D11_4	5.00E−108
					abc
NO. 733	BL1165	1415716	1417068	complement	probable solute binding protein of	trembl|AL158061|SC6D11_4	5.00E−100
					abc
NO. 734	BL1166	1417228	1418928	+	alpha-I-arabinofuranosidase a (EC	gp|AL163003|7414545	5.00E−126
					3.2.1.55)
NO. 735	BL1167	1419048	1420085	complement	laci-type transcriptional regulator	trembl|AE001777|AE001777_1	2.00E−44
NO. 736	BL1168	1420186	1422261	complement	beta-galactosidase i (EC 3.2.1.23)	trembl|AL158061|SC6D11_3	0
					(lactase)
NO. 737	BL1169	1422476	1423486	complement	probable permease of abc	trembl|AL158061|SC6D11_5	5.00E−116
					transporter system for
NO. 738	BL1170	1423542	1424474	complement	probable permease of abc	trembl|AL158061|SC6D11_6	5.00E−102
					transporter system for
NO. 739	BL1171	1424691	1425701	+	probable laci-type transcriptional	trembl|AL158061|SC6D11_7	2.00E−68
					regulator
NO. 740	BL1173	1426727	1427410	+	hypothetical protein with	swiss|P55564|Y4ME_RHISN	2.00E−26
					similarity to hipa
NO. 741	BL1174	1427453	1428154	complement	possible ribosomal pseudouridine	trembl|Z96070|MTCI418A_2	1.00E−44
					synthase
NO. 742	BL1175	1428231	1430123	complement	glucosamine-fructose-6-	trembl|AL031317|SC6G4_18	0
					phosphate
NO. 743	BL1176	1430365	1431195	complement	atp binding protein of abc	tremblnew|AF312768|AF312768_3	1.00E−77
					transporter
NO. 744	BL1177	1431211	1432194	complement	permease protein of abc	trembl|AF104994|AF104994_2	7.00E−59
					transporter system
NO. 745	BL1178	1432325	1433266	complement	probable solute binding protein of	trembl|AF104994|AE104994_1	3.00E−38
					abc
NO. 746	BL1179	1433400	1434464	complement	probable solute binding protein of	trembl|AF104994|AF104994_1	5.00E−39
					abc
NO. 747	BL1180	1434516	1435115	complement	ssra-binding protein(smpB)	trembl|AL138851|SCE59_25	7.00E−52
NO. 748	BL1182	1436620	1437543	complement	ftsx-like protein involved in cell	trembl|AL138851|SCE59_27	3.00E−46
					division
NO. 749	BL1183	1437555	1438724	complement	ftse-like atp binding protein	trembl|AL138851|SCE59_28	1.00E−80
					involved in cell
NO. 750	BL1184	1438733	1439857	complement	peptide chain release factor 2 (rf-	trembl|AL138851|SCE59_31	5.00E−129
					2) (prfB)
NO. 751	BL1186	1441718	1442371	complement	polypeptide deformylase (EC	trembl|AL133422|SCM1_15	5.00E−45
					3.5.1.31) (pdf)
NO. 752	BL1187	1442396	1443781	complement	probable phosphoglucomutase or	trembl|AL031317|SC6G4_14	5.00E−129
NO. 753	BL1190	1444761	1445648	complement	hypothetical transmembrane	trembl|U00011|ML011_29	2.00E−22
					protein with unknown
NO. 754	BL1191	1445826	1448435	complement	aminopeptidase n ec 3.4.11.2)	trembl|AL138662|SC8E4A_13	0
					(lysyl
NO. 755	BL1192	1448477	1450390	complement	widely conserved hypothetical	trembl|AL031260|SC9A10_9	0
					protein with
NO. 756	BL1193	1450412	1451317	complement	dihydrodipicolinate synthase (EC	trembl|AL008967|MTV002_18	1.00E−64
					4.2.1.52)
NO. 757	BL1194	1451480	1452235	complement	dihydrodipicolinate reductase (EC	trembl|AL008967|MTV002_38	1.00E−68
					1.3.1.26)
NO. 758	BL1195	1452571	1453890	complement	possible transport protein	pironly|D83363|D83363	6.00E−42
NO. 759	BL1196	1454102	1458133	complement	widely conserved atp-dependent	trembl|AL021646|MTV014_46	4.00E−71
					dna helicase;
NO. 760	BL1198	1462572	1463993	+	probable serine/threonine-protein	trembl|Z83866|MTCY22D7_29	9.00E−35
					kinase (EC
NO. 761	BL1199	1464160	1470144	+	large protein with c-terminal	tremblnew|AE007470|AE007470_2	2.00E−21
					fibronectin type
NO. 762	BL1199a	1470155	1471528	+	methanol dehydrogenase	trembl|AP001509|AP001509_42	2.00E−43
					regulatory protein
NO. 763	BL1202	1475283	1476215	+	probable phosphoprotein	trembl|AL079308|SCH69_15	1.00E−23
					phosphatase (ppp)
NO. 764	BL1204	1477564	1481601	complement	dna-directed rna polymerase beta	swiss|P47769|RPOC_MYCTU	0
					prime chain (EC
NO. 765	BL1205	1481769	1485332	complement	dna-directed rna polymerase beta	gp|AL160431|7248348	0
					chain (EC
NO. 766	BL1207	1486274	1487260	complement	probable a/g-specific adenine	trembl|AL049628|SCE94_6	2.00E−64
					glycosylase
NO. 767	BL1208	1487434	1487943	+	probable rna methyltransferase	trembl|AL009198|MTV004_21	2.00E−40
					(EC 2.1.1.—)
NO. 768	BL1209	1488250	1489614	complement	narrowly conserved hypothetical	tremblnew|AL162757|NMA6Z2491—	5.00E−161
					protein with	172
NO. 769	BL1210	1490105	1491355	complement	galactokinase (EC 2.7.1.6)	swissnew|P96910|GAL1_MYCTU	4.00E−62
					(galactose kinase)
NO. 770	BL1211	1491372	1492622	complement	galactose-1-phosphate	trembl|AF135398|AF135398_6	1.00E−40
					uridylyltransferase (EC
NO. 771	BL1212	1492615	1493511	complement	probable deor-type transcriptional	swiss|O05261|YULB_BACSU	9.00E−32
					regulator.
NO. 772	BL1213	1493920	1494936	+	dihydroorotate dehydrogenase	swissnew|P74782|PYRD_SYNY3.	3.00E−44
					(EC 1.3.3.1)
NO. 773	BL1214	1495104	1496219	complement	probable nadh-dependent flavin	tremblnew|AL445503|SC2G38_2	5.00E−96
					oxidoreductase
NO. 774	BL1215	1496669	1498984	complement	possible penicillin-binding protein	trembl|AL079353|SCH17_14	3.00E−67
NO. 775	BL1216	1499088	1499807	complement	probable transcriptional regulator	trembl|AL079353|SCH17_5	3.00E−50
					with cyclic
NO. 776	BL1217	1500046	1501131	complement	probable lipoate protein ligase	trembl|AJ224512|SNO224512_16	3.00E−67
					(snoP)
NO. 777	BL1218	1501189	1502220	complement	3-isopropylmalate dehydrogenase	swiss|P94631|LEU3_CORGL	5.00E−114
					(EC 1.1.1.85)
NO. 778	BL1219	1502285	1504801	complement	protease ii (EC 3.4.21.83)	trembl|Z80226|MTCY369_27	6.00E−94
					(oligopeptidase b)
NO. 779	BL1220	1504862	1506202	complement	narrowly conserved hypothetical	trembl|AE001968|AE001968_4	3.00E−21
					protein with
NO. 780	BL1221	1506260	1506673	complement	glycine cleavage system h protein	swissnew|O86566|GCSH_STRCO	3.00E−27
					(gcvH)
NO. 781	BL1222	1506699	1507991	complement	#NAME?	swissnew|O53345|NUDC_MYCTU	1.00E−34
NO. 782	BL1224	1508984	1509616	complement	narrowly conserved hypothetical	emnew|AL353870|SC6F7	5.00E−50
					protein with
NO. 783	BL1226	1509814	1510185	+	thioredoxin (trxA2)	trembl|AL133422|SCM1_17	1.00E−26
NO. 784	BL1229	1513262	1514698	complement	possible etk-like tyrosine kinase	trembl|Z99122|BSUB0019_122	6.00E−32
					involved in
NO. 785	BL1234	1517948	1519267	+	hypothetical protein with	trembl|U94520|LLU94520_1	3.00E−27
					similarity to abili:
NO. 786	BL1239	1522841	1523209	complement	hypothetical protein in the	swissnew|Q99338|ISTB_BACTB	2.00E−22
					is21/is1162
NO. 787	BL1244	1528511	1529758	complement	dtdp-glucose 4,6-dehydratase (EC	trembl|AF071085|AF071085_9	5.00E−121
					4.2.1.46)
NO. 788	BL1245	1529912	1531090	+	probable udp-galactopyranose	trembl|AF026540|AF026540_1	5.00E−124
					mutase (EC
NO. 789	BL1247	1532596	1533474	+	possible 2-hydroxyhepta-2,4-	trembl|AL031124|SC1C2_27	6.00E−53
					diene-1,7-dioate
NO. 790	BL1248	1533720	1534595	complement	iclr-type transcriptional regulator	pironly|B83207|B83207	9.00E−26
NO. 791	BL1249	1534841	1536394	+	histidine ammonia-lyase (EC	tremblnew|AL512667|SC2K31_9	5.00E−164
					4.3.1.3) (histidase)
NO. 792	BL1250	1536613	1539282	+	protease of clpa/clpb type (clpB)	trembl|AL049754|SCH10_39	0
NO. 793	BL1251	1539399	1540538	+	probable glutamyl-trna synthetase	pironly|C81210|C81210	4.00E−45
					(EC 6.1.1.17)
NO. 794	BL1253	1541869	1542348	complement	hypothetical protein with dufl 63	trembl|D78193|BSGNTZA_15	1.00E−45
NO. 795	BL1254	1542396	1543022	complement	uracil phosphoribosyltransferase	tremblnew|AP001519|	1.00E−52
					(EC 2.4.2.9)	AP001519_279
NO. 796	BL1258	1545721	1546935	complement	probable mutt1 protein (mutT1)	trembl|Z83018|MTCY349_36	1.00E−28
NO. 797	BL1259	1547078	1549315	complement	polyphosphate kinase (EC 2.7.4.1)	gp|AL353816|7636018	0
NO. 798	BL1261	1551240	1552016	complement	iclr-type transcriptional regulator	trembl|AL031124|SC1C2_33	3.00E−82
NO. 799	BL1262	1552334	1553737	+	3-isopropylmalate dehydratase	trembl|AL031124|SC1C2_34	0
					large subunit (EC
NO. 800	BL1263	1553820	1554512	+	3-isopropylmalate dehydratase	swiss|O33124|LEUD_MYCLE	9.00E−64
					small subunit (EC
NO. 801	BL1266	1557876	1559222	complement	nadh oxidase (EC 1.6.99.3)	swiss|P37061|NAOX_ENTFA	5.00E−120
					(noxase) (nox)
NO. 802	BL1267	1559471	1560796	+	udp-n-acetylglucosamine	trembl|AL138851|SCE59_8	5.00E−168
NO. 803	BL1268	1560845	1562098	complement	probable aminotransferase	trembl|AL021428|MTV030_17	4.00E−62
NO. 804	BL1269	1562192	1563124	complement	probable lysr-type transcriptional	trembl|AL031317|SC6G4_44	5.00E−31
					regulator
NO. 805	BL1270	1563211	1564476	complement	hypothetical transmembrane	trembl|AE001715|AE001715_5	5.00E−35
					protein possibly
NO. 806	BL1272	1565364	1567226	+	arginyl-trna synthetase (EC	swiss|Q10609|SYR_MYCTU	5.00E−149
					6.1.1.19)
NO. 807	BL1273	1567229	1568821	+	probable diaminopirmelate	swiss|P31848|DCDA_MYCTU	5.00E−74
					decarboxylase (EC
NO. 808	BL1274	1568982	1570298	+	homoserine dehydrogenase (EC	swiss|Q10601|DHOM_MYCTU	5.00E−103
					1.1.1.3) (hdh)
NO. 809	BL1275	1570405	1571517	+	possible homoserine kinase (EC	swissnew|P45836|KHSE_MYCU	4.00E−33
					2.7.1.39) (hk)
NO. 810	BL1276	1571654	1573102	+	hypothetical protein with mutt	tremblnew|AL512667|SC2K31_18	1.00E−31
					domain
NO. 811	BL1277	1573298	1574371	+	atp-binding protein of abc	tremblnew|AL391754|SCK7_8	9.00E−60
					transporter system
NO. 812	BL1280	1576974	1578248	+	succinyl-diaminoprimelate	trembl|Z93777|MTC1364_12	2.00E−75
					desuccinylase (EC
NO. 813	BL1281	1578585	1581596	+	ribonuclese g (EC 3.1.4.—) (mase	trembl|AL139298|SCC88_10	5.00E−160
					g) (me)
NO. 814	BL1282	1581748	1582056	+	50s ribosomal protein 121. (rpIU)	swiss|P71907|RL21_MYCTU	3.00E−25
NO. 815	BL1283	1582079	1582327	+	50s ribosomal protein 127. (rpmA)	pironly|H82559|H82559	2.00E−27
NO. 816	BL1284	1582396	1584087	+	gtp-binding protein (obg)	trembl|D87916|SGD916_3	5.00E−142
NO. 817	BL1285	1584088	1585221	+	glutamate 5-kinase (EC 2.7.2.11)	trembl|AL136518|SCC123_25	5.00E−104
					(gamma-glutamyl
NO. 818	BL1286	1585312	1586517	+	aspartate aminotransferase ec	gp|AL160431|7248339	5.00E−139
					2.6.1.1 (aspC)
NO. 819	BL1288	1587018	1587911	+	probable transcription	gp|AL160431|7248341	3.00E−49
					antitermination protein
NO. 820	BL1290	1588174	1588605	+	50s ribosomal protein l11 (rpIK)	trembl|AF130462|AF130462_4	9.00E−54
NO. 821	BL1291	1588621	1589313	+	50s ribosomal protein l1 (rlpA)	gp|AL160431|7248343	6.00E−84
NO. 822	BL1292	1595385	1596212	complement	morphine 6-dehydrogenase (EC	trembl|AF008220|AF008220_185	3.00E−78
					1.1.1.218)
NO. 823	BL1293	1596344	1597795	+	xylulose kinase (EC 2.7.1.17)	swiss|P21939|XYLB_LACPE	1.00E−54
					(xylulokinase)
NO. 824	BL1295	1598185	1599600	+	histidinol dehydrogenase (EC	swissnew|P28736|HISX_MYCSM	5.00E−130
					1.1.1.23) (hdh)
NO. 825	BL1296	1599597	1600757	+	histidinol-phosphate	swissnew|P16246|HIS8_STRCO	5.00E−93
					aminotransferase (EC
NO. 826	BL1297	1600843	1603442	+	imidazoleglycerol-phosphate	swiss|O06590|HIS7_MYCTU	4.00E−65
					dehydratase (EC
NO. 827	BL1299	1602271	1602918	+	aminotransferase hish	swissnew|P16249|HIS5_STRCO	1.00E−60
					(EC 2.4.2.—) (hisH)
NO. 828	BL1300	1602988	1603713	+	phosphoribosylformimino-5-	swissnew|P16250|HIS4_STRCO	8.00E−84
					aminoimidazole
NO. 829	BL1301	1603817	1605250	complement	narrowly conserved hypothetical	trembl|AL031232|SC10H5_7	5.00E−100
					protein with
NO. 830	BL1302	1605399	1606736	+	glutamine synthelase (glutamate-	trembl|AL136500|SC1G2_3	0
					ammonia ligase)
NO. 831	BL1305	1608481	1612689	complement	atp-dependent helicase (hrpA)	trembl|AL118514|SCD25_28	0
NO. 832	BL1306	1612607	1613263	complement	conserved hypothetical protein	swissnew|P37872|YBXB_BACSU	4.00E−31
					possibly in
NO. 833	BL1307	1613422	1614927	+	gtp-binding protein (hflX)	trembl|AL022268|SC4H2_17	5.00E−134
NO. 834	BL1308	1615087	1616070	+	lactate dehydrogenase (EC	swiss|P19869|LDH_BIFLO	0
					1.1.1.27) (ldh)
NO. 835	BL1309	1616212	1617150	complement	probable cation efflux protein	trembl|AL049587|SC5F2A_34	2.00E−57
NO. 836	BL1310	1617316	1618041	complement	lexa repressor (EC 3.4.21.88) (sos	trembl|AJ224870|SCAJ487O_2	3.00E−62
					regulatory
NO. 837	BL1312	1618559	1619035	+	hypothetical protein with high	trembl|AJ224870|SCAJ4870_3	3.00E−52
					similarity to
NO. 838	BL1313	1619170	1620369	complement	d-3-phosphoglycerate	pironly|C82072|C82072	5.00E−111
					dehydrogenase (EC 1.1.1.95)
NO. 839	BL1314	1620380	1622659	complement	narrowly conserved hypothetical	trembl|AL138978|SC6A11_15	5.00E−126
					protein with
NO. 840	BL1315	1622992	1623513	+	conserved hypothetical protein in	tremblnew|AP001516|AP001516_5	2.00E−30
					upf0040
NO. 841	BL1316	1623513	1624592	+	widely conserved hypothetical	trembl|AL109663|SC4A10_25	3.00E−79
					protein in
NO. 842	BL1317	1625045	1626847	+	peptidoglycan synthetase.	trembl|AL109663|SC4A10_23	3.00E−84
					penicillin-binding
NO. 843	BL1319	1627795	1629246	+	udp-n-acetylmuramoylalanyl-d-	trnembl|AL109663|SC4A10_21	2.00E−82
					glutamyl-2,6-diaminopimelate-d-
					alanyl-d-
NO. 844	BL1320	1629291	1630397	+	phospho-n-acetylmuramoyl-	swiss|P56833|MRAY_STRCO	3.00E−87
					pentapeptide-transferase
NO. 845	BL1321	1630452	1631897	+	udp-n-acetylmuramoylalanine-d-	trembl|AL109663|SC4A10_19	5.00E−88
					glutamate ligase
NO. 846	BL1322	1631884	1633101	+	probable ftsw-like protein (fstW)	trembl|U10879|SC10879_2	7.00E−47
NO. 847	BL1323	1633117	1634298	+	udp-n-acetylglucosamine-n-	swissnew|Q9ZBA5|MURG_STRCO	2.00E−87
					acetylmuramyl-(pentapeptide)
NO. 848	BL1324	1634399	1635937	+	udp-n-acetylmuramate-alanine	swiss|Q9X827|MURC_STRCO	5.00E−80
					ligase (EC
NO. 849	BL1325	1638253	1638537	complement	narrowly conserved hypothetical	pironly|F82517|F82517	1.00E−20
					protein with
NO. 850	BL1326	1639341	1639817	+	conserved hypothetical protein	trembl|X72832|SEDEXB_5.	6.00E−34
					with unknown
NO. 851	BL1327	1639978	1643097	+	alpha-mannosidase (EC 3.2.1.24)	trembl|AL133278|SCM11_3	0
NO. 852	BL1328	1643228	1646368	+	alpha-mannosidase (EC 3.2.1.24)	trembl|AL133278|SCM11_3	0
NO. 853	BL1329	1646638	1649742	+	alpha-mannosidase (EC 3.2.1.24)	trembl|AL133278|SCM11_3	0
NO. 854	BL1330	1649938	1651209	+	probable solute-binding protein of	trembl|AL133278|SCM11_7	3.00E−91
					abc
NO. 855	BL1331	1651212	1652150	+	probable sugar permease of abc	trembl|AL133278|SCM11_6	9.00E−74
					transporter
NO. 856	BL1332	1652150	1653007	+	probable sugar permease of abc	trembl|AL133278|SCM11_5	1.00E−73
					transporter
NO. 857	BL1333	1653021	1654310	+	narrowly conserved hypothetical	trembl|AL133278|SCM11_4	5.00E−101
					protein with
NO. 858	BL1334	1654435	1657077	+	probable pentosidase or	tremblnew|AL512980|	9.00E−45
					hexosidase	SSOLP2N19—30
NO. 859	BL1335	1657125	1659938	+	probable endo-beta-n-	tremblnew|AP001509|	5.00E−177
					acetylglucosaminidase;	AP001509_223
NO. 860	BL1336	1660234	1661340	+	probable laci-type transcriptional	trembl|AL133278|SCM11_8	2.00E−59
					regulator
NO. 861	BL1337	1661462	1662760	complement	narrowly conserved hypothetical	swiss|P32140|YIHS_ECOLI	7.00E−83
					protein with
NO. 862	BL1338	1662764	1664062	complement	narrowly conserved hypothetical	tremblnew|AP001509|	5.00E−108
					protein with	AP001509_228
NO. 863	BL1340	1665242	1666456	complement	probable transcriptional repressor	trembl|AL009199|SC7B7_5	7.00E−42
					in the rok
NO. 864	BL1341	1666683	1667597	+	possible sugar kinase	swiss|P54495|GLK_BACSU	2.00E−32
NO. 865	BL1342	1667747	1668871	complement	nagc/xlyr-type transciptional	tremblnew|AP001516|	2.00E−33
					regulator	AP001516_187
NO. 866	BL1343	1669209	1670021	+	glucosamine-6-phosphate	swiss|O31458|YBFT_BACSU	7.00E−49
					isomerase 1 (EC
NO. 867	BL1344	1670077	1671360	+	n-acetylglucosamine-6-phosphate	trembl|AL021841|MTV016_30	8.00E−55
					deacetylase (EC
NO. 868	BL1345	1671640	1673274	+	probable solute-binding protein of	trembl|AL132648|SCI41_38	2.00E−89
					abc
NO. 869	BL1346	1673439	1674530	+	probable permease of abc	trembl|AE001772|AE001772_4	2.00E−76
					transporter for
NO. 870	BL1347	1674649	1675701	+	probable permease of abc	trembl|AE000980|AE000980_2	1.00E−58
					transporter for
NO. 871	BL1348	1675705	1677414	+	atp binding protein of abc	trembl|D90720|ECD720_13	5.00E−124
					transporter
NO. 872	BL1349	1677464	1677985	complement	hypothetical protein containing	tremblnew|AL445963|SC2G2_26	3.00E−32
					mutt-like
NO. 873	BL1350	1678034	1679629	complement	xaa-pro aminopeptidase i (EC	swiss|Q05813|AMP1_STRLI	5.00E−110
					3.4.11.9) (x-pro
NO. 874	BL1353	1682038	1683627	+	folylpolyglutamate synthase ec	trembl|AL139298|SCC88_25	5.00E−104
					6.3.2.17 (folC or
NO. 875	BL1354	1683688	1687365	+	chromosome partitioning protein	trembl|AL034447|SC7A1_21	0
					smc (smc)
NO. 876	BL1356	1688601	1690154	complement	udp-n-acetylmuramoylalanyl-d-	swiss|O69557|MURE_MYCLE	6.00E−39
					glutamate-2,6-diaminopimelate
NO. 877	BL1357	1690272	1691081	+	rna polymerase sigma-e factor	trembl|AF144091|AF144091_4	6.00E−37
					(sigma-24) (sigH)
NO. 878	BL1359	1691667	1692611	complement	hypothetical protein with possible	tremblnew|AE005619|AE005619_2	8.00E−30
NO. 879	BL1360	1692736	1693692	complement	hypothetical protein in aldose	tremblnew|AE005619|AE005619_2	4.00E−24
					epimerase family
NO. 880	BL1361	1693917	1694975	+	lytb protein involved with rela and	swissnew|O53458|LYB1_MYCTU	9.00E−89
					the
NO. 881	BL1362	1695015	1695452	complement	conserved hypothetical protein	trembl|AL096884|SC4G6_27	1.00E−33
					very similar to
NO. 882	BL1363	1695618	1696676	complement	glyceraldehyde 3-phosphate	trembl|AJ000339|LDGAPPGK_2	5.00E−120
					dehydrogenase c (EC
NO. 883	BL1366	1699250	1699885	+	translation initiation factor if-3	swiss|O88060|IF3_STRCO	2.00E−48
					(infC)
NO. 884	BL1367	1700113	1700496	+	50s ribosomal protein l20. (rpIT)	swiss|O88058|RL20_STRCO	4.00E−50
NO. 885	BL1368	1700611	1701537	+	probable integrase/recombinase	trembl|Z98268|MTCI125_22	5.00E−70
NO. 886	BL1369	1701665	1704511	+	large protein with n-terminal	trembl|U73183|U73183_1	5.00E−111
					similarity to atp
NO. 887	BL1370	1704713	1705612	+	widely conserved hypothetical	trembl|AL109848|SCI51_12	2.00E−86
					protein in para
NO. 888	BL1371	1705631	1706545	+	narrowly conserved hypothetical	trembl|Z98268|MTCI125_30	5.00E−42
					protein with
NO. 889	BL1372	1706558	1707274	+	conserved hypothetical protein	trembl|AL109848|SCI51_9	6.00E−46
					with unknown
NO. 890	BL1373	1707406	1708233	+	narrowly conserved hypothetical	trembl|D90913|SSD913_123	1.00E−30
					protein possibly
NO. 891	BL1374	1708294	1709574	+	quinolinate synthetase (nadA)	tremblnew|AP001511|	5.00E−104
						AP001511_109
NO. 892	BL1375	1709662	1711293	+	1-aspartate oxidase (EC 1.4.3.16)	trembl|AL049628|SCE94_33	2.00E−94
					(quinolinate
NO. 893	BL1376	1711297	1712190	+	probable nicotinate-nucleotide	tremblnew|AX064321|AX064321_1	7.00E−77
					pyrophosphorylase
NO. 894	BL1377	1712193	1713440	+	possible pyridoxal-phosphate-	trembl|AL031184|SC2A11_20	5.00E−72
					dependent
NO. 895	BL1378	1713472	1714821	+	probable sugar transporter	tremblnew|AX066931|AX066931_1	5.00E−127
NO. 896	BL1379	1715136	1717067	+	widely conserved protein similar	trembl|Z95584|MTCI65_32	0
					to those
NO. 897	BL1381	1717693	1718670	+	probable chorismate mutase (EC	embl|AE000889|AE000889	6.00E−22
					5.4.99.5) (cm);
NO. 898	BL1382	1718664	1719731	+	probable prephenate	trembl|AE001962|AE001962_4	1.00E−30
					dehydrogenase ec1.3.1.12
NO. 899	BL1384	1720235	1721308	+	probable integrase/recombinase	trembl|Z97369|MLCB250_29	3.00E−59
					protein similar
NO. 900	BL1386	1721561	1723201	+	solute binding protein of abc	trembl|AL022121|MTV025_15	5.00E−114
					transporter system
NO. 901	BL1387	1723502	1724428	+	probable permease protein of abc-	trembl|AL022121|MTV025_14	5.00E−71
					transporter for
NO. 902	BL1389	1724447	1725451	+	probable permease protein of abc-	trembl|AL022121 |MTV025_13	1.00E−77
					transporter for
NO. 903	BL1390	1725474	1727483	+	probable atp binding protein of	trembl|AL022121|MTV025_12	5.00E−135
					abc transporter
NO. 904	BL1391	1727588	1728448	+	possible exodeoxyribonuclease	trembl|AL132674|SCE87_25	2.00E−58
					(EC 3.1.11.2)
NO. 905	BL1392	1728516	1729370	+	narrowly conserved hypothetical	trembl|AL021530|SC2E9_10	1.00E−24
					protein with
NO. 906	BL1394	1730095	1731402	+	conserved hypothetical protein	trembl|AL021529|SC10A5_6	1.00E−50
					with duf90
NO. 907	BL1396	1732200	1734713	+	probable cation-transporting	trembl|AL035654|SCE8_9	5.00E−159
					atpase (EC 3.6.1)
NO. 908	BL1397	1734834	1737533	+	aconitate hydratase (EC 4.2.1.3)	trembl|AL021184|MTV007_22	0
					(citrate
NO. 909	BL1402	1741470	1742195	complement	response regulator of two-	trembl|AL132824|SCAH10_19	5.00E−35
					component system
NO. 910	BL1403	1742230	1743498	complement	atypical histidine kinase sensor of	trembl|AL132824|SCAH10_18	5.00E−20
NO. 911	BL1405	1744823	1745722	+	conserved hypothetical protein	tremblnew|AE005259|AE005259_8	1.00E−31
					with mutt type
NO. 912	BL1406	1745862	1746878	+	possible integral membrane	pironly|B83194|B83194	6.00E−42
					protein with duf6
NO. 913	BL1407	1746911	1747753	complement	narrowly conserved hypothetical	tremblnew|AP001513|	2.00E−43
					protein with	AP001513_158
NO. 914	BL1408	1747795	1749237	+	widely conserved hypothetical	trembl|AL022268|SC4H2_8	5.00E−152
					protein in
NO. 915	BL1409	1749248	1750234	+	trna delta(2)-	swissnew|O69967|MIAA_STRCO	4.00E−78
					isopentenylpyrophosphate
NO. 916	BL1411	1751229	1754138	+	cell division protein ftsk (ftsK)	trembl|AL031031|SC7C7_5	0
NO. 917	BL1412	1754291	1754950	+	cdp-diacylglycerol-glycerol-3-	trembl|U00019|ML019_22	1.00E−27
					phosphate
NO. 918	BL1415	1756716	1757909	+	reca protein (recombinase a)	swissnew|Q9S660|RECA_BIFBR	0
					(recA)
NO. 919	BL1416	1757912	1758505	+	recx-like protein	embl|AF094756|AF094756	1.00E−81
NO. 920	BL1417	1758685	1759251	+	hypothetical protein with unknown	embl|AF094756|AF094756	4.00E−36
					function
NO. 921	BL1418	1759382	1760044	+	hypothetical protein in sigma 54	trembl|Z95121|MTY20BI1_16	4.00E−33
					modulation
NO. 922	BL1419	1760206	1763100	+	preprotein translocase seca	swissnew|P55021|SECA_STRCO	0
					subunit (secA)
NO. 923	BL1422	1764354	1765400	+	anthranilate	swiss|O68608|TRD1_STRCO	4.00E−75
					phosphoribosyltransferase 1 (EC
NO. 924	BL1424	1766545	1767249	+	widely conserved hypothetical	trembl|AL157956|SCL24_2	5.00E−58
					protein with acyl
NO. 925	BL1425	1767301	1769574	complement	probable serine-threonine protein	trembl|AL109661|SC6E10_4	4.00E−59
					kinase
NO. 926	BL1426	1769718	1770836	complement	probably bifunctional short chain	trembl|AL021957|MTV021_7	9.00E−30
					isoprenyl
NO. 927	BL1428	1771872	1773296	+	ma polymerase principal sigma	trembl|M90411|SAHRDB_1	5.00E−143
					factor, sigma 70
NO. 928	BL1429	1773354	1775672	+	dna gyrase subunit b, (EC	trembl|AL022374|SC5B8_12	0
					5.99.1.3) (gyrB)
NO. 929	BL1431	1777139	1778101	+	probable ribokinase (EC 2.7.1.15)	pironly|B83403|B83403	5.00E−50
NO. 930	BL1432	1778117	1782850	+	atp-dependent helicase ii (1 hr)	trembl|AL031031|SC7C7_16	0
NO. 931	BL1434	1783794	1786523	complement	dna gyrase subunit a (EC	trembl|AL009204|SC9B10_3	0
					5.99.1.3) (gyrA)
NO. 932	BL1435	1786753	1788042	+	narrowly conserved hypothetical	trembl|AL009204|SC9B10_11	3.00E−48
					protein with
NO. 933	BL1438	1789595	1790071	+	deoxyuridine 5′-triphosphate	swiss|O54134|DUT_STRCO	4.00E−42
					nucleotidohydrolase
NO. 934	BL1439	1790184	1792529	+	gtp pyrophosphokinase (EC	swissnew|P52560|RELA_STRCO	0
					2.7.6.5) (atp:gtp
NO. 935	BL1440	1792647	1793531	complement	is3-type transposase	tremblnew|AE000433|ECAE433_4	9.00E−48
NO. 936	BL1442	1794113	1794661	complement	possible peptidyl-prolyl cis-trans	tyembl|U64692|SCU64692_1	6.00E−48
					isomerase
NO. 937	BL1444	1796077	1797012	complement	widely conserved hypothetical	trembl|AP000002|AP000002_291	3.00E−23
					transmembrane
NO. 938	BL1447	1799086	1799931	+	possible phosphoglycerate mutase	trembl|Z81368|MTCY253_35	2.00E−22
NO. 939	BL1448	1800046	1800996	+	possible magnesium and cobalt	trembl|AE002075|AE002075_11	1.00E−61
					transport protein
NO. 940	BL1449	1801011	1801937	+	solute binding protein of abc	trembl|AL020958|SC4H8_15	1.00E−32
					transporter
NO. 941	BL1450	1801980	1804943	+	leucyl-trna synthetase (EC	trembl|AL136518|SCC123_9	0
					6.1.1.4)
NO. 942	BL1452	1805946	1807634	+	conserved hypothetical	trembl|AL136518|SCC123_5	3.00E−26
					transmembrane protein
NO. 943	BL1453	1807774	1809120	+	possible prolidase ec 3.4.13.9 (x-	tremblnew|AP001517|AP001517_57	2.00E−37
					pro
NO. 944	BL1454	1809283	1810158	+	hypothetical protein with possible	trembl|AL136518|SCC123_2	2.00E−35
					dna binding
NO. 945	BL1457	1812256	1813299	+	metalloendopeptidase gcp (gcp)	swiss|O86793|GCP_STRCO	9.00E−98
NO. 946	BL1458	1813966	1814901	+	probable integrase/recombinse	trembl|Z80225|MTCY441_16	3.00E−25
NO. 947	BL1467	1822821	1824281	complement	possible trag-related protein	tremblnew|AL391754|SCK7_2	3.00E−22
NO. 948	BL1469	1825372	1828008	+	dna topoisomerase iii (topb) (EC	trembl|AB001488|BSAB1488_10	9.00E−87
					5.99.1.2)
NO. 949	BL1472	1829232	1830500	complement	type ii restriction enzyme very	trembl|AJ224995|ECO224995_1	8.00E−37
					similar to
NO. 950	BL1473	1830546	1831517	complement	modification methylase very	swissnew|P24581|MTNX_NEILA	3.00E−84
					similar to ecorii
NO. 951	BL1476	1833873	1835348	complement	conserved hypothetical protein	swiss|P55564|Y4ME_RHISN	6.00E−36
					with unknown
NO. 952	BL1479	1837643	1839451	complement	narrowly conserved hypothetical	trembl|AL049645|SCE2_7	2.00E−59
					protein similar
NO. 953	BL1483	1842269	1843783	complement	narrowly conserved hypothetical	tremblnew|AP001204|AP001204_38	3.00E−56
					protein with
NO. 954	BL1484	1843882	1845369	complement	narrowly conserved hypothetical	tremblnew|AP001204|AP001204_39	9.00E−50
					protein with
NO. 955	BL1489	1858431	1863242	complement	hypothetical protein with limited	trembl|M64978|PPPRGAB_4	5.00E−28
					similarity to
NO. 956	BL1492	1866104	1866697	complement	hypothetical protein with	tremblnew|AF121000|AF121000_7	8.00E−29
					similarity to the par
NO. 957	BL1497	1871350	1872039	+	narrowly conserved hypothetical	swiss|Q10812|YS91_MYCTU	3.00E−20
					protein in
NO. 958	BL1499	1873997	1875217	complement	isocitrate dehydrogenase [nadp]	swiss|O53389|IDH_MYCTU	5.00E−179
					(EC 1.1.1.42)
NO. 959	BL1500	1875345	1876469	+	inosine-5′-monophosphate	gp|AL161755|7320890	5.00E−147
					dehydrogenase (guaB)
NO. 960	BL1501	1877213	1879300	+	possible long-chain-fatty acid coa	trembl|AL021957|MTV021_21	5.00E−118
					ligase
NO. 961	BL1502	1879307	1879795	+	polypeptide deformylase (EC	swiss|Q9XAQ2|DEF_STRCO	2.00E−29
					3.5.1.31) (pdf)
NO. 962	BL1503	1880107	1880997	+	30s ribosomal protein s2. (rpsB)	trembl|AL023797|SC2E1_41	1.00E−94
NO. 963	BL1504	1881076	1881927	+	elongation factor ts (ef-ts) (tsf)	swiss|O31213|EFTS_STRCO	1.00E−49
NO. 964	BL1505	1882101	1882841	+	uridylate kinase (EC 2.7.4.—) (uk)	trembl|AL023797|SC2E1_43	6.00E−82
					(uridine
NO. 965	BL1506	1882918	1883469	+	ribosome recycling factor	swiss|O86770|RRF_STRCO	5.00E−55
					(ribosome releasing
NO. 966	BL1507	1883492	1884478	+	probable phosphatidate	trembl|AL031035|SC6A9_39	3.00E−29
					cytidylyltransferase (EC
NO. 967	BL1508	1884689	1885858	+	widely conserved hypothetical	trembl|AL031035|SC6A9_22	5.00E−115
					protein with
NO. 968	BL1509	1885859	1886407	complement	hypothetical protein in the thij/pfpi	pironly|D83125|D83125	3.00E−37
					family
NO. 969	BL1510	1886616	1887800	+	transpsosase in is 256 family	swiss|Q52873|TRA5_RHIME	5.00E−61
NO. 970	BL1512	1889585	1890166	complement	deoxycytidine triphosphate	swissnew|Q9X8W0|DCD_STRCO	5.00E−72
					deaminase (EC
NO. 971	BL1515	1892320	1893174	+	widely conserved hypothetical	tremblnew|AP001518|	2.00E−20
					transmembrane	AP001518_285
NO. 972	BL1516	1893218	1895290	complement	probable nhap-type na(+)/h(+)	trembl|Z99121|BSUB0018_28	2.00E−76
					exchanger
NO. 973	BL1517	1895390	1895866	+	possible cytidine and	trembl|AL022121|MTV025_101	1.00E−37
					deoxycytidylate deaminase
NO. 974	BL1518	1895986	1898292	+	alpha-galactosidase (EC 3.2.1.22)	trembl|AF124596|AF124596_1	0
					(melibiase)
NO. 975	BL1520	1898457	1899665	complement	possible nagc/xylr-tpye	tremblnew|AL449216|SC35B7_12	8.00E−49
					transcriptional
NO. 976	BL1521	1899839	1901128	+	sugar binding protein of abc	swiss|Q00749|MSME_STRMU	5.00E−28
					transporter system
NO. 977	BL1522	1901150	1902079	+	sugar permease of abc transporter	swiss|Q00750|MSMF_STRMU	2.00E−50
					system
NO. 978	BL1523	1902098	1902964	+	sugar permease of abc transporter	swiss|Q00751|MSMG_STRMU	6.00E−48
					system
NO. 979	BL1526	1904380	1906200	+	oligo-1,6-glucosidase (EC	swiss|P29094|O16G_BACTR	5.00E−168
					3.2.1.10)
NO. 980	BL1527	1906486	1907733	+	catabolic threonine dehydratase	tremblnew|AL451182|SCK13_16	2.00E−87
					(tdcB)
NO. 981	BL1528	1907879	1908529	complement	sir2-type regulatory protein	trembl|AE001726|AE001726_9	4.00E−31
NO. 982	BL1530	1915778	1916530	+	probable iclr-type transcriptional	trembl|AL078635|CZA382_19	2.00E−20
					regulator
NO. 983	BL1531	1916637	1917503	complement	narrowly conserved hypothetical	trembl|AL133423|SC4A7_14	7.00E−24
					protein with
NO. 984	BL1535	1921809	1923773	+	acetyl-/propionyl-coenzyme a	trembl|AF126429|AF126429_1	5.00E−131
					carboxylase alpha
NO. 985	BL1536	1923766	1925388	+	propionyl-coa carboxylase beta	tremblnew|AL512667|SC2K31_15	5.00E−153
					chain (EC
NO. 986	BL1537	1925427	1934945	+	type i multifunctional fatty acid	trembl|X87822|MAFASGEN_1	0
					synthase
NO. 987	BL1542	1942976	1944082	complement	transpsosase in is 30 family	trembl|AF189147|AF189147_1	4.00E−45
NO. 988	BL1543	1944703	1947231	+	endo-1,4-beta-xylanase d (EC	trembl|Z99113|BSUB0010_109	5.00E−128
					3.2.1.8)
NO. 989	BL1544	1947454	1950330	+	possible extracellular exo-	trembl|AF005383|AF005383_5	3.00E−95
					xylanase (EC 3.2.1.8)
NO. 990	BL1546	1952294	1955035	+	polyribonucleotide	pironly|T10932|T10932	0
					nucleotidyltransferase (EC
NO. 991	BL1547	1955462	1956856	complement	widely conserved hypothetical	pironly|B82096|B82096	3.00E−90
					protein with
NO. 992	BL1549	1958210	1958731	+	50s ribosomal protein 110 (rpIJ)	swiss|P36257|RL10_STRGR	6.00E−48
NO. 993	BL1550	1958840	1959220	+	50s ribosomal protein 17/112	trembl|D50624|SVVBRA1_8	2.00E−20
					(rpIL)
NO. 994	BL1555	1966051	1966800	complement	hypothetical protein in the	trembl|AL132674|SCE87_33	2.00E−23
NO. 995	BL1556	1966827	1967522	+	possible acetytransferase	embl|AL132674|SCE87	9.00E−27
NO. 996	BL1558	1969200	1969493	+	groes (groES)	trembl|AF071828|AF071828_1	1.00E−30
NO. 997	BL1559	1970167	1971690	complement	possible cystathiomine gamma	trembl|U93874|BSU93874_2	8.00E−70
					lyase (EC
NO. 998	BL1561	1972567	1973667	+	udp-n-	gp|AL160431|7248337	2.00E−55
					acetylenolpyruvoylglucosamine
					reductase
NO. 999	BL1562	1973819	1975345	+	possible cationic amino acid	trembl|Z95121|MTY20B11_28	5.00E−125
					transporter
NO. 1000	BL1563	1975406	1975726	+	ferredoxin (fdxC)	trembl|AL391751|SC9E12_20	2.00E−42
NO. 1001	BL1564	1975841	1977076	+	probable aminotransferase (EC	trembl|AL010186|MTV005_13	2.00E−61
					2.6.1.—)
NO. 1002	BL1565	1977103	1978449	complement	dna-damage-inducible protein p.	tremblnew|AL162756|NMA5Z2491—	7.00E−47
						212
NO. 1003	BL1566	1978489	1979553	+	conserved hypothetical	pironly|A83476|A83476	5.00E−24
					transmembrane protein
NO. 1004	BL1567	1980088	1981431	+	narrowly conserved hypothetical	trembl|AL133469|SCM10_29	6.00E−42
					protein with
NO. 1005	BL1568	1981505	1982521	+	possible 2-hydroxyacid	trembl|AL133236|SCE65_14	1.00E−34
					dehydrogenase
NO. 1006	BL1569	1982700	1983224	+	conserved hypothetical protein in	tremblnew|AE005615|AE005615_10	5.00E−23
					upf 0029
NO. 1007	BL1570	1984143	1986308	+	4-alpha-glucanotransferase (EC	swiss|O53932|MALQ_MYCTU	5.00E−150
					2.4.1.25)
NO. 1008	BL1571	1986706	1987155	+	50s ribosomal protein l13	swiss|Q53874|RL13_STRCO	2.00E−47
NO. 1009	BL1572	1987178	1987669	+	30s ribosomal protein s9 (rpsl)	swiss|Q53875|RS9_STRCO	5.00E−46
NO. 1010	BL1573	1987760	1990300	complement	family 13 glycosyl hydrolase	trembl|AL157916|SC3D11_13	5.00E−133
NO. 1011	BL1574	1990297	1991490	complement	probable repressor in the rok	tremblnew|AP001509|	3.00E−20
					(nagc/xylr)	AP001509_138
NO. 1012	BL1575	1992005	1994734	+	aldehyde-alcohol dehydrogenase 2	swissnew|Q24803|ADH2_ENTHI	0
					[includes:
NO. 1013	BL1577	1996328	1996636	+	30s ribosomal protein s10 (rpsJ)	gp|AL161803|7321291	1.00E−37
NO. 1014	BL1578	1996653	1997294	+	50s ribosomal protein l3 (rplC)	gp|AL161803|7321292	2.00E−72
NO. 1015	BL1579	1997301	1997957	+	50s ribosomal protein l4. (rplD)	gp|AL161803|7321293	3.00E−58
NO. 1016	BL1580	1997963	1998259	+	50s ribosomal protein l23. (rplW)	gp|AL161803|7321294	2.00E−30
NO. 1017	BL1581	1998296	1999126	+	50s ribosomal protein l2. (rplB)	swiss|P95052|RL2_MYCTU	5.00E−116
NO. 1018	BL1582	1999142	1999420	+	30s ribosomal protein s19 (rpsS)	swiss|O32985|RS19_MYCLE	2.00E−42
NO. 1019	BL1583	1999437	1999796	+	50s ribosomal protein l22 (rplV)	gp|AL161803|7321297	1.00E−34
NO. 1020	BL1584	1999799	2000602	+	30s ribosomal protein s3 (rpsC)	gp|AL161803|7321298	2.00E−91
NO. 1021	BL1586	2000609	2001028	+	50s ribosomal protein l16. (rplP)	gp|AL161803|7321299	8.00E−54
NO. 1022	BL1589	2001282	2001542	+	30s ribosomal protein s17. (rpsQ)	swiss|O32990|RS17_MYCLE	4.00E−27
NO. 1023	BL1590	2001637	2002005	+	50s ribosomal protein l14. (rplN)	gp|AL161803|7321302	2.00E−52
NO. 1024	BL1591	2002007	2002342	+	50s ribosomal protein l24 (rplX)	swiss|P33103|RL24_MICLU	2.00E−25
NO. 1025	BL1592	2002339	2002911	+	50s ribosomal protein 15 (rplE)	gp|AL161803|7321304	4.00E−71
NO. 1026	BL1593	2002913	2003098	+	30s ribosomal protein s14-1.	gp|AL161803|7321305	4.00E−25
					(rpsN)
NO. 1027	BL1594	2003188	2003586	+	30s ribosomal protein s8 (rpsH)	swiss|P95066|RS8_MYCTU	3.00E−46
NO. 1028	BL1595	2003604	2004143	+	50s ribosomal protein l6 (rplF)	gp|AL161803|7321307	6.00E−49
NO. 1029	BL1596	2004145	2004516	+	50s ribosomal protein l18 (rplR)	gp|AL161803|7321308	9.00E−38
NO. 1030	BL1597	2004543	2005244	+	ribosomal protein s5 (rpsE)	gp|AL161803|7321309	3.00E−56
NO. 1031	BL1599	2005438	2005890	+	50s ribosomal protein l15 (rplO)	swiss|P33101|RL15_MICLU	2.00E−48
NO. 1032	BL1600	2006164	2007501	+	preprotein translocase secy	swiss|P43416|SECY_STRSC	5.00E−143
					subunit. (secY)
NO. 1033	BL1601	2007671	2008231	+	adenylate kinase (EC 2.7.4.3)	swissnew|P33107|KAD_MICLU	2.00E−46
					(atp-amp
NO. 1034	BL1602	2008408	2008626	+	translation initiation factor if-1.	trembl|U15140|MB1540_1	1.00E−26
					(infA)
NO. 1035	BL1604	2008912	2009289	+	30s ribosomal protein s13. (rpsM)	swiss|O06327|RS13_MYCTU	1.00E−52
NO. 1036	BL1605	2009315	2009812	+	hypothetical protein with unknown	embl|AL031317|SC6G4	5.00E−24
					function
NO. 1037	BL1606	2009856	2010851	+	dna-directed rna polymerase alpha	swiss|O06324|RPOA_MYCTU	5.00E−134
					chain (EC
NO. 1038	BL1607	2010951	2011484	+	50s ribosomal protein l17 (rplQ)	swiss|O86775|RL17_STRCO	2.00E−35
NO. 1039	BL1608	2011566	2012477	complement	trna pseudouridine synthase a (EC	swiss|O86776|TRUA_STRCO	7.00E−54
					4.2.1.70)
NO. 1040	BL1609	2012753	2014933	+	narrowly conserved hypothetical	trembl|AE002040|AE002040_9	5.00E−102
					protein with
NO. 1041	BL1610	2015140	2015940	+	narrowly conserved hypothetical	trembl|AE002037|AE002037_7	4.00E−21
					protein in
NO. 1042	BL1611	2016516	2018318	+	alpha-1-arabinofuranosidase a (EC	gp|AL163003|7414545	5.00E−162
					3.2.1.55)
NO. 1043	BL1613	2018851	2019894	+	laci-type tanscriptional regulator	trembl|AE001777|AE001777_1	3.00E−29
NO. 1044	BL1615	2020871	2021938	+	n utilization substance homolog	trembl|Z95207|MTCY24A1_1	1.00E−76
					(nusA)
NO. 1045	BL1616	2022208	2025072	+	translation initiation factor if-2	swiss|Q9Z519|IF2_MYCLE	0
					(infB)
NO. 1046	BL1617	2025225	2025698	+	ribosome-binding factor a. (rbfA)	swiss|Q9Z527|RBFA_STRCO	1.00E−25
NO. 1047	BL1618	2025700	2026863	+	trna pseudouridine synthase b (EC	trembl|AL035559|SC9F2_7	2.00E−53
					4.2.1.70)
NO. 1048	BL1619	2026961	2028085	+	protein ribf [includes: riboflavin	trembl|AL035559|SC9F2_5	9.00E−41
					kinase (EC
NO. 1049	BL1620	2028100	2029638	complement	alkylation damage repair protein	trembl|AL049628|SCE94_2	5.00E−117
					(radA or sms)
NO. 1050	BL1623	2030832	2031530	complement	probable ribose 5-phosphate	swiss|P72012|RPIA_METTH	2.00E−43
					isomerase (EC
NO. 1051	BL1624	2031661	2032647	complement	ribonuclease h (EC 3.1.26.4)	pironly|G82101|G82101	1.00E−21
					(mase h) (rnh)
NO. 1052	BL1626	2033184	2034818	complement	possible class i pyridine	swiss|P77212|YKGC_ECOLI	1.00E−57
NO. 1053	BL1630	2037432	2039108	complement	phosphoglucomutase (EC 5.4.2.2)	trembl|AL158061|SC6D11_39	5.00E−180
					(glucose
NO. 1054	BL1631	2039195	2040748	complement	d-xylose-proton symporter (xylT)	swiss|O52733|XYLT_LACBR	5.00E−100
NO. 1055	BL1632	2041248	2043623	+	pts system, glucose-specific iiabc	trembl|AF045481|AF045481_1	5.00E−154
					component
NO. 1056	BL1633	2043641	2044480	+	transcription antiterminator similar	swiss|P39805|LICT_BACSU	9.00E−38
					to lict
NO. 1057	BL1634	2044504	2045883	complement	conserved hypothetical protein	swiss|Q55452|Y036_SYNY3	7.00E−20
					wish possible
NO. 1058	BL1635	2045919	2047205	+	seryl-trna synthetase (EC	swiss|P96244|SYS_MYCTU	5.00E−126
					6.1.1.11)
NO. 1059	BL1638	2048211	2049527	+	solute binding protein of abc	trembl|AL132973|SCF91_20	1.00E−39
					transposter for
NO. 1060	BL1639	2049667	2050689	+	permenase of abc transporter for	trembl|AL158061|SC6D11_6	2.00E−56
					sugars
NO. 1061	BL1640	2050689	2051639	+	permease of abc transporter for	trembl|AL158061|SC6D11_5	3.00E−58
					sugars
NO. 1062	BL1642	2054142	2055221	+	narrowly conserved hypothetical	trembl|D90908|SSD908_48	7.00E−55
					protein wilh
NO. 1063	BL1643	2055268	2056815	+	galactose-1-phosphate	trembl|AF082008|AF082008_2	1.00E−72
					uridylyltransferase (EC
NO. 1064	BL1644	2056884	2057906	+	ndp-glucose 4-epimerase (EC	swiss|P24325|GALE_HAEIN	5.00E−119
					5.1.3.2)
NO. 1065	BL1645	2057954	2058649	complement	response regulator of two-	trembl|AL109661|SC6E10_14	1.00E−30
					component system
NO. 1066	BL1652	2067540	2068730	complement	araj-like protein probably involved	trembl|U73857|ECU73857_115	7.00E−69
					in transport
NO. 1067	BL1654	2069231	2070913	+	lysyl-trna synthetase 1 (EC	swissnew|O06284|SYK1_MYCTU	5.00E−154
					6.1.1.6)
NO. 1068	BL1655	2070975	2071940	+	probable 1,4-dihydroxy-2-	swiss|O07134|MENA_MYCLE	1.00E−44
					naphthoate
NO. 1069	BL1656	2071970	2072740	+	phosphoglycerate mutase (EC	trembl|M83661|SCPGM_1	1.00E−86
					5.4.2.1)
NO. 1070	BL1657	2073099	2073773	complement	response regulator of two-	swissnew|O07167|PHU1_MYCTU	2.00E−30
					component system
NO. 1071	BL1658	2073788	2075158	+	histidine kinase sensor of two	gp|AL160331|7242750	6.00E−50
					component
NO. 1072	BL1660	2075668	2076810	complement	probable phosphoserine	swissnew|O33062|SERC_MYCLE	5.00E−120
					aminotransferase (EC
NO. 1073	BL1661	2077204	2078160	+	hypothetical protein with c-	trembl|AJ243106|STH243106_4	2.00E−25
					terminal homology to
NO. 1074	BL1664	2080185	2081222	+	widely conserved protein in	swiss|Q10851|YK05_MYCTU	2.00E−26
					universal stress
NO. 1075	BL1665	2081894	2082694	+	thymidylate synthase(EC	swiss|O33306|TYSY_MYCTU	5.00E−109
					2.1.1.45) (thyA)
NO. 1076	BL1666	2082804	2083466	+	dihydrofolate reductase (EC	trembl|AF006616|AF006616_1	3.00E−26
					1.5.1.3) (dfrA)
NO. 1077	BL1667	2083590	2084108	+	law molecular weight	swissnew|P53433|PTPA_STRCO	8.00E−22
NO. 1078	BL1668	2084287	2084619	complement	branched-chain amino acid	swiss|O07923|AZLD_BACSU	9.00E−37
					permease (alzD)
NO. 1079	BL1669	2084616	2085632	complement	narrowly conserved hypothetical	swiss|O07942|AZLC_BACSU	6.00E−74
					protein with
NO. 1080	BL1670	2085856	2086716	complement	widely conserved hypothetical	swiss|P32049|YGGH_ECOLI	1.00E−30
					protein with
NO. 1081	BL1671	2087044	2088057	+	udp-glucose 4-epimerase (EC	tremblnew|AL163672|SCE50_16	1.00E−85
					5.1.3.2)
NO. 1082	BL1672	2088998	2090302	complement	possible cyclopropane-fatty-acyl-	trembl|AL023596|MLCB2407_9	3.00E−98
					phospholipid
NO. 1083	BL1673	2090742	2091893	+	possible lactaldehyde reductase	swiss|P11549|FUCO_ECOLI	5.00E−120
					(EC 1.1.1.77)
NO. 1084	BL1675	2093118	2094632	+	hypothetical integral membrane	trembl|AL020958|SC4H8_6	2.00E−61
					protein in
NO. 1085	BL1676	2094632	2095855	+	narrowly conserved hypothetical	trembl|L39794|PPRRMP_7	2.00E−25
					transmembrane
NO. 1086	BL1677	2095950	2096906	+	atp-binding protein of abc	trembl|AP000005|AP000005_137	3.00E−40
					transporter system
NO. 1087	BL1679	2098599	2100089	+	hypothetical secreted protein with	trembl|AL049841|SCE9_15	2.00E−30
					d-ala-d-ala
NO. 1088	BL1680	2100179	2101345	+	narrowly conserved hypothetical	trembl|AL049841|SCE9_13	3.00E−39
					protein similar
NO. 1089	BL1681	2101332	2101895	+	hypoxanthine-guanine	trembl|AL049841|SCE9_12	4.00E−47
					phosphoribosyltransferase
NO. 1090	BL1682	2101892	2103982	+	atp-dependent zinc	trembl|AL049841|SCE9_11	0
					metallopeptidase involved in
NO. 1091	BL1683	2104077	2104676	+	gtp cyclohydrolase i (EC 3.5.4.16)	swissnew|Q9X8I3|GCH1_STRCO	3.00E−64
					(gtp-ch-i)
NO. 1092	BL1684	2104739	2105614	+	dihydropteroate synthase i (EC	trembl|AL049841|SCE9_5	2.00E−58
					2.5.1.15)
NO. 1093	BL1685	2105725	2107137	+	probable bifunctional folate	trembl|AL049841|SCE9_8	1.00E−30
					synthesis protein
NO. 1094	BL1687	2107939	2108838	complement	acyl-coa thioesterase ii	pironly|A82248|A82248	7.00E−39
					(EC 3.1.2.—) (teii)
NO. 1095	BL1688	2109150	2110829	complement	atp binding protein of abc	trembl|AL021246|MTV008_32	0
					transporter
NO. 1096	BL1691	2111662	2112612	+	glucokinase (EC 2.7.1.2) (glucose	swissnew|P40184|GLK_STRCO	1.00E−70
					kinase
NO. 1097	BL1692	2112637	2113503	complement	atp binding protein of abc	trembl|AL009199|SC7B7_7	4.00E−57
					transporter for
NO. 1098	BL1693	2113541	2114710	complement	probable repressor protein in	trembl|AL009199|SC7B7_5	5.00E−74
					(nagc/xylr)
NO. 1099	BL1694	2114962	2116119	+	probable sugar binding protein of	trembl|AL133423|SC4A7_32	7.00E−71
					abc
NO. 1100	BL1695	2116220	2117773	+	atp binding protein of abc	trembl|AF160811|AF160811_1	5.00E−168
					transporter for
NO. 1101	BL1696	2117773	2118990	+		trembl|AF160811|AF160811_2	4.00E−89
NO. 1102	BL1699	2120080	2120502	+	hypothetical transmembrane	trembl|AB000617|AB000617_2	5.00E−22
					protein possibly
NO. 1103	BL1700	2120510	2120929	+	polypeptide deformylase (EC	swiss|O08450|DEF_CLOBE	8.00E−32
					3.5.1.31) (pdf)
NO. 1104	BL1704	2123529	2124878	+	xylose isomerase (EC 5.3.1.5)	swiss|P29443|XYLA_LACBR	0
					(xylA)
NO. 1105	BL1705	2125144	2126421	+	transpsosase in is 256 family	trembl|AF082836|AF082836_1	5.00E−155
NO. 1106	BL1706	2126337	2126684	+	possible sugar premease	trembl|AF160811|AF160811_2	9.00E−20
NO. 1107	BL1709	2127852	2129372	complement	xylulose kinase (EC 2.7.1.17)	swiss|P27156|XYLB_STRRU.	1.00E−78
					(xylulokinase)
NO. 1108	BL1710	2129592	2130821	+	possible xylr-type repressor	trembl|AL133210|SCG11A_2	1.00E−47
NO. 1109	BL1711	2131150	2131362	+	50s ribosomal protein l31.(rpmE)	swiss|Q10608|RL31_MYCTU	7.00E−22
NO. 1110	BL1712	2131516	2132604	+	peptide chain release factor 1 (rf-1)	swiss|Q10605|RFI_MYCTU	5.00E−104
					(prfA)
NO. 1111	BL1713	2132691	2133575	+	possible methylase protein	swiss|Q10602|HEMK_MYCTU	2.00E−34
NO. 1112	BL1714	2133848	2135035	+	solute binding protein of abc		3.00E−39
					transporter for
NO. 1113	BL1715	2135277	2136203	+	permease of abc transporter for	swiss|P30295|LIVH_SALTY	2.00E−64
					branched-chain
NO. 1114	BL1716	2136220	2137296	+	permease of abc transporter for	pironly|A83032|A83032	1.00E−47
					branched-chain
NO. 1115	BL1717	2137293	2138153	+	atp binding protein of abc	trembl|AE001771|AE001771_7	1.00E−71
					transporter for
NO. 1116	BL1718	2138153	2138857	+	atp binding protein of abc	trembl|AL109732|SC7H2_26	7.00E−76
					transporter for
NO. 1117	BL1719	2138989	2139666	complement	probable sugar o-acetyltransferase	swiss|Q09707|YA39_SCHPO	6.00E−36
					(EC 2.3.1.18)
NO. 1118	BL1720	2139841	2140515	+	conserved protein in the	trembl|AF144563|AF144563_3	2.00E−23
					sua5/ycio/yrdc family
NO. 1119	BL1721	2140629	2141795	+	possible undecaprenyl-phosphate	swiss|P45830|RFE_MYCLE	1.00E−65
NO. 1120	BL1722	2141764	2143401	+	inosine-5′-monophosphate	gp|AL161755|7320889	5.00E−171
					dehydrogenase (EC
NO. 1121	BL1723	2143569	2144219	+	probable oligoribonuclease (EC	swissnew|P57666|ORN_STRCO	8.00E−54
					3.1.—.—) (orn)
NO. 1122	BL1724	2144268	2145686	+	possible helicase	trembl|AF074944|AF074944_1	2.00E−55
NO. 1123	BL1726	2147513	2148685	+	possible pyruvate formate-lyase	trembl|Z83867|MTCY3A2_8	5.00E−108
					activating
NO. 1124	BL1728	2149479	2151272	+	prolyl-trna synthetase (EC	swiss|O05814|SYP_MYCTU	5.00E−176
					6.1.1.15)
NO. 1125	BL1730	2152374	2154611	complement	belongs to peptidase family m13	trembl|AL021928|MTV033_5	5.00E−165
					(zinc
NO. 1126	BL1732	2155895	2156677	+	methionine aminopeptidase (EC	trembl|AL023861|SC3C8_28	1.00E−65
					3.4.11.18) (map)
NO. 1127	BL1733	2156951	2158243	+	citrate synthase 1 (EC 4.1.3.7)	swiss|Q10530|CISY_MYCTU	5.00E−124
					(gltA2)
NO. 1128	BL1734	2158457	2159476	complement	widely conserved hypothetical	trembl|Z93777|MTCI364_11	3.00E−84
					protein with
NO. 1129	BL1736	2160873	2165057	+	possible helicase	trembl|X98455|BCX98455_2	5.00E−108
NO. 1130	BL1738	2165706	2166305	complement	hypothetical protein with probable	tremblnew|AJ251800|STH251800_1	7.00E−25
NO. 1131	BL1739	2166307	2166822	+	possible xorii very-short-patch-	swissnew|Q9JWD6|VSR_NEIMA	3.00E−34
					repair
NO. 1132	BL1740	2166853	2167908	complement	probable oxidoreductase	trembl|AL133220|SCC75A_31	3.00E−46
NO. 1133	BL1741	2168002	2169225	+	probable aspartate	pironly|D83057|D83057	6.00E−87
					aminotransferase
NO. 1134	BL1742	2169403	2170371	+	widely conserved hypothetical	trembl|AL049819|SCE7_15	1.00E−80
					protein with
NO. 1135	BL1748	2173544	2175409	+	probable long-chain-fatty-acid-	trembl|AL049497|SC6G10_4	5.00E−136
					coa ligase (EC
NO. 1136	BL1749	2175548	2176072	complement	possible nad(p)h oxidoreductase	swiss|P54439|YRKL_BACSU	7.00E−36
					(EC 1.6.99.—)
NO. 1137	BL1751	2176548	2177918	complement	exonuclease vii, large subunit	tremblnew|AL391754|SCK7_29	2.00E−88
					(EC 3.1.11.6)
NO. 1138	BL1752	2178386	2180794	+	anaerobic ribonucleoside-	trembl|U73336|U73336_1	0
					triphosphate reductase
NO. 1139	BL1753	2180861	2181670	+	anaerobic ribonucleoside-	trembl|U73336|U73336_2	7.00E−64
					triphosphate reductase
NO. 1140	BL1754	2181898	2187036	+	long hypothetical protein with	trembl|AE000682|AE000682_3	2.00E−73
					unknown function
NO. 1141	BL1755	2187342	2188478	+	possible glutamate-cysteine	trembl|AF128454|AF128454_1	3.00E−33
					ligase, (EC
NO. 1142	BL1757	2189465	2191828	+	possible beta-glucosidase (EC	trembl|AF006658|BFAF6658_1	5.00E−119
					3.2.1.21)
NO. 1143	BL1761	2192953	2194167	+	probable beta-1,3-exoglucanase	tremblnew|AY005434|AY005434_1	5.00E−37
NO. 1144	BL1763	2194834	2195973	+	possible beta-glucosidase b (EC	trembl|U92808|U92808_1	1.00E−58
					3.2.1.21)
NO. 1145	BL1766	2197109	2199067	+	atp-binding protein of abc	trembl|AE001710|AE001710_10	5.00E−114
					transporter
NO. 1146	BL1767	2199064	2201079	+	abc transporter, atp-binding	tremblnew|AP001509|	5.00E−110
					transmembrane	AP001509_253
NO. 1147	BL1768	2201259	2202284	+	probable laci-type transcriptional	trembl|AL136519|SCC57A_15	4.00E−43
					regulator
NO. 1148	BL1770	2202998	2203918	+	widely conserved hypothetical	tremblnew|AE005179|AE005179_9	8.00E−74
					protein in the
NO. 1149	BL1771	2204020	2205450	+	c4-dicarboxylate transporter	pironly|G82431|G82431	3.00E−65
					(dcuC)
NO. 1150	BL1772	2205676	2206644	+	sugar kinase in pfkb family	trembl|AL136519|SCC57A_18	2.00E−43
					(rbsK)
NO. 1151	BL1774	2207174	2208181	+	laci-type transcriptional regulator	tremblnew|AP001514|AP001514_24	2.00E−58
NO. 1152	BL1775	2208244	2208846	complement	fragment of beta galactosidase	trembl|AJ242596|BLO242596_1	3.00E−62
NO. 1153	BL1776	2208904	2210115	complement	probable aminotransferase	swiss|Q08432|PATB_BACSU	4.00E−54
NO. 1154	BL1777	2210709	2214020	+	isoleucyl-trna synthetase (EC	swiss|Q10765|SYI_MYCTU	0
					6.1.1.5)
NO. 1155	BL1778	2214216	2214866	+	truncated type i restriction system	embl|I46882|I46882	2.00E−51
					specificity
NO. 1156	BL1779	2214859	2215788	complement	phage family integrase	trembl|L44593|LLATTP_8	2.00E−51
NO. 1157	BL1780	2215779	2216348	complement	truncated type i restriction system	trembl|AF153410|AF153410_1	2.00E−54
					specificity
NO. 1158	BL1781	2216382	2217317	+	our restriction endonuclense (mrr)	trembl|Z83863|MTCY159_5	2.00E−50
NO. 1159	BL1782	2217349	2219916	+	modification (methylase) protein	trembl|AF177167|AF177167_4	5.00E−103
					of type i
NO. 1160	BL1783	2219916	2221136	+	hsds specificity protein of type i	trembl|AF027167|AF027167_1	1.00E−66
					restriction-
NO. 1161	BL1785	2222715	2226002	+	hsdr-like protein of type i	trembl|AF013165|AF013165_2	7.00E−93
					restriction
NO. 1162	BL1786	2226070	2227290	complement	s-adenosylmethionine synthetase	tremblnew|AX063959|AX063959_1	5.00E−136
					(EC 2.5.1.6)
NO. 1163	BL1788	2228055	2229917	+	dihydroxy-acid dehydratase (EC	swissnew|O69198|ILVD_STRCO	0
					4.2.1.9) (dad)
NO. 1164	BL1789	2230008	2230994	complement	methionyl-trna formyltransferase	gp|AL159139|7209233	2.00E−80
					(EC 2.1.2.9)
NO. 1165	BL1791	2231781	2234093	complement	probable primosomal protein n'	gp|AL159139|7209235	3.00E−72
					(replication
NO. 1166	BL1792	2234133	2234885	complement	probable phosphoserine	trembl|AL096844|SCI28_2	3.00E−49
					phosphatase (EC 3.1.3.3)
NO. 1167	BL1793	2234906	2235604	+	hypothetical conserved	trembl|D64004|SSSLRF_46	4.00E−38
					transmembrane protein in
NO. 1168	BL1794	2235665	2237230	+	probable aaa-family atpase	swiss|O33250|YL15_MYCTU	5.00E−114
NO. 1169	BL1795	2237252	2238919	+	hypothetical proteasome-	trembl|Z97559|MTCY261_8	6.00E−95
					associated protein
NO. 1170	BL1797	2240121	2241581	+	hypothetical proteasome-	trembl|AL035310|MLCB2533_19	4.00E−88
					associated protein
NO. 1171	BL1799	2242124	2244685	complement	narrowly conserved hypothetical	trembl|AL021942|MTV039_22	3.00E−54
					membrane
NO. 1172	BL1800	2244817	2246262	complement	adenylosuccinate lyase (EC	pironly|A82237|A82237	5.00E−111
					4.3.2.2)
NO. 1173	BL1811	2254166	2255254	complement	widely conserved moxr-like	pironly|C83106|C83106	4.00E−72
					protein in magnesium
NO. 1174	BL1812	2255285	2255926	complement	Uracil-dna glycosylase	swiss|P95119|UNG_MYCTU	2.00E−77
					(EC 3.2.2.—) (udg) (ung)

[0038] The ORFs corresponding to NO. 1 to 1147 nucleotide sequences are defined in table 1, supra, and are represented by their position in the genomic sequence SEQ. ID. NO. 1. For example, the ORF3 sequence is defined by the nucleotide sequence between the nucleotides at position 4622 and 6472 on the sequence SEQ No. 1, ends included.

[0039] The open reading frames have been identified via homology analyses as well as via analyses of potential ORF start sites. It is to be understood that each identified ORF comprises a nucleotide sequence that spans the contiguous nucleotide sequence from the codon immediately 3′ to the stop codon of the preceding ORF and through the 5′ codon to the next stop codon of SEQ. ID. NO. 1 in frame to the ORF nucleotide sequence.

[0040] Table 1 also depicts the results of homology searches that compared the sequences of the polypeptides encoded by each of the ORFs to sequences present in public published databases. It is understood that in one embodiment, those polypeptides listed in Table 1 as exhibiting greater than about 99% identity to a polypeptide present in a publicly disclosed database are not considered part of the present invention. Likewise in this embodiment, those nucleotide sequences encoding such polypeptides are not considered part of the invention.

[0041] As regards the homology with the ORF nucleotide sequences, the homologous sequences exhibiting a percentage identity with the bases of one of the ORF nucleotide sequences of at least 80%, preferably 90% and 95%, are preferred. Such homologous sequences are identified via, for example, the algorithms described above and in the examples below. The said homologous sequences correspond to the homologous sequences as defined above and may comprise, for example, the sequences corresponding to the ORF sequences of a bacterium belonging to the Bifidobacterium family.

[0042] These homologous sequences may likewise correspond to variations linked to mutations within the same species or between species and may correspond in particular to truncations, substitutions, deletions and/or additions of at least one nucleotide. The said homologous sequences may also correspond to variations linked to the degeneracy of the genetic code or to a bias in the genetic code which is specific to the family, to the species or to the variant and which are likely to be present in Bifidobacterium.

[0043] Particularly interesting sequences are nucleotide sequences, which encode the following polypeptides or fragments thereof:

(a) SEQ. ID. NO.5 (ORF13)
MPTGRVRWFDAAKGYGFITSEEGKDVFLPAQALPTGVTTLRKGAKVEYSV
VDGRRGPQAMDVRLIASAPSLVKATRPKADDMAAICEDLIKMLDAAGNTL
RRHRYPSAADSKKLATLLRAVADQFDVQD
(b) SEQ. ID. NO.525 (ORF1827)
MTTAAAQAPAPGKLEFKDDYTPDEAERVIRNSKGLPVGVRPKMVWTWKKA
LLWAAIAIVCACGWAILAVSRGEQISAIWFLVVALSSYAIAYRFYAYYIQ
IKIMRTDDANATPAERVHDGANFERTDRRVLFGQHFAGISGAGPLVGPIL
AAQMGYLPSTLWIILGVIFAGAVQDMLVLWISAKRRGRSLGQMATDEMGK
FGGMILSIFLVVMTAIAMAFLALVAIKAMAASPWAVFSIGMTIPIALIMG
CYQRFLRPGRVIETTLLGFVLLVLDIVAGGWIASIPAVAAVFTLDAKQLV
IALVIYSFAAAALPHWLLVTPRDYLSTLMKIGTLVLLVIGIIIANPSVKV
PGLTELASTSTGPTFSGNLFPFLFITIACGALSGFHGAVSSGLTPKAVEK
ENQIRMIGYGSMLVESFTAVIALIAAITISQGVYFSTNMSAAQITAASGV
SISATSTPGEQADAAVKAVESMKVSDIEGNQMQVTWDSVDENGAAKTYEG
AAALEQAAADIGETSIVSRTGGATTFAMGMANFLKSYLGGHDSMAFWYHF
AIMFEALFILTTVDNGTRVARYQIGEMLGNVRKLKKFADPTWKPGN
IITTLIATALWGGLLWMGVSDANGGINAMVPIFGISNQLLAAACFV
LITVCVAKMGYWKHLWIPVVPLVWDIAVTFTADFQKIFGPLSYFTT
ASKYQAQIDSGELTGEALTNAKAALSNAYLDGVLSVFFLVMMGVFV
VVGIVVVARTFAAGKYGAETTSEEPFVESQWFAPSSLVATALEKKV
QREYSAKLHELVRNGQVAA
c) SEQ. ID. NO.424 (ORF1473)
MTQSRRMLVLRAVVEDYIRSQEPVGSTSLTRDHDLGVSSATIRNDMAALE
DEGYLIQPHTSAGRVPTEKGYRYFVDRLATVVPLSEAQRRGINSFLSGSV
SLKDALQRSARLLSEITGQVAVVASPSLAKATLRHVEMVPVAMTTLLAVV
ITDTGRVAQHGLTIASMPAVDEINRLSNTVNEQCDGLSLSKSAETVRSIA
ASAGYESVRGVADTLADAFESMALDERANELYMSGTSHLAHSRSLADLAP
LFDALEEQVVLMKLMSNLSEETNASGVGVAIGSEMHTPGLLHASVVSSGY
GRSGAAGEPAGNDPVGEPETESETESQTNDTEPIAFVGSIGPTHMDYAAT
MAAVRAVARYLTAFLSEGRTQD
d) SEQ. ID. NO.548 (ORF1905)
MYFKDGNDNAQRGGSTVRRSRQRRIMGRVVSYNEDVPRCTFCGKTEHQVR
KLVAGPNASICDECIALCVDIISEERVKDAEVNSLSLPKPAQIFDYLNRY
VIGQENAKRALSVAVYNHYKRVNMELQESAEQLDGNNGHSGQTSKQAKQS
VPTQTRATRRSNDPLADVEVAKSNILLLGPTGVGKTYLAQALARVMNVPF
VITDATTLTEAGYVGDDVETVLQRLLQAADGDVSRAQHGIIYIDEIDKIA
RKSGENTSITRDVSGEGVQQALLKILEGTIASVPLEGTRKHKEQDVAQMD
TRGILFICGGAFVGLTDIVRKRLGRRETGFGANWHDADMKDEELLEQVNA
DDLAEFGLLPEFIGRLPVTSVLKELTVDDLTAILTQPANALIKQYRKLFA
VDGVDLQFTEQAIRAIADIAIKQGTGARGLRSIIERTLQDTMFQLPSLDD
VRQVIVDKASVEGSSTPKLLREAVDVPQGRLKVAQSVLLDRVRTHEA
e) SEQ. ID. NO.74 (ORF219)
MSEQLMEQYRLRGQRKCRNACIAAIVTVVLVLAVAGGVWWTAGDGSALVR
NMFKPKATPATQPVVNSTATFAYRTAPEFLAMEAGDRGTGNVNYSPASMW
MALAIAAQGANGTTRSQLNELLGSGSLTDSDYQSLLSSINGQYSGAKSEM
SAANSLWIDDDYSLASDYQSTVKKMFEAEVTTLPFDDQAAAKMSDWIAKH
TNGSLKPKITLRDREVLSIINTVYADGRWKDPFEEQSTGNGTFHGEAGDA
QVPMMHQTFSQMAYGHDEYNTWQRVEIPFDNGGNLAIVLPAEGHFDELAG
DAEKLSWAFGTCSTASLGEGAMGCAADSMPGWGVSVNSVMVNVTLPRFTI
DSMFDSEATIKAFEKLGVTDAFSAGDADFTKMIDTGSHGENLYIGSILQG
TRIEVNEAGAKAMSFTKVGADSVSAPVDNVEFTVDRPFLYSYVTPDGIPL
FIGAVRNLGGVGGEN
f) SEQ. ID. NO.576 (ORF1972)
MQIRPGSMYPLGASYDGAGVNFALYSQVAQKVELCLFDEHDVETRIEMTE
RNSYVWHNYIPGLHPGQRYGYRVYGPYDPVHGLRCNPNKLLLDPYAKAIE
GNIDGDESLFSYWFKSPDDNSAMNDLDSAAHTMKSAVINPYFDWGNDQHP
YISYHDSVIYEAHVRGMTNLNMDVPPDIRGTYAGLAYPSVIEYLKKLGIT
AIELMPIHQFVNDSFLQEKGLSNYWGYNTIGFFAPHNAYSSSGERGEQVN
EFKSMVKAYHRAGMEVILDVVYNHTAEGNHMGPTLSFKGIDNASYYRLVE
GDQQHYFDTTGTGNSLLMRSPHALQLITDSLRYWVTEMHVDGFRFDLAAT
LARQFQEVDKLSAFFDIVEQDPIISRVKLIAEPWDLGSGGYQVGGFPSSW
SEWNGRYRDTVRDFWRSQPSTLPEFASRLMGSSDLYQVNGRRPVASVNFI
TAHDGFTMNDLVSYNEKHNEANGEGNRDGESNNRSWNCGVEGPTNIPDVN
DLRQRQMRNMFATLLFSQGIPMICGGDEVARTQQGNNNAYCQDNEISWTN
WHLDKGRKELLAFVSKLIHLRLDHPVLHRRRFFTGREPGDDSNTIPQVEW
FDHTGSIMDMDDWQNTHAFSMMIYLNGSDIPEVDWYGNRMVDNDFILIFN
AHYEPIMFTLPDERYGRKWQLVVDTHNPNEPALSYEAGFMITAQSRSFLM
LMSAKKPKKPMGL
g) SEQ. ID. NO.403 (ORF1403)
MEIRARPHMASGSYRELFSARMMYGMQYIQQTIVGIDGSEARFFGYVADN
SEEMEPDRIRPAILILPGGGYAMTSDREAEPVALQFLAKGFAVFVLRYSV
QPSRYPVALLEAAEAMRLIRANVDQWHVNPAQVAVLGFSAGGHLAANLAT
SVGDEDIREQGGMDPDAVRPNALMLSYPVITAGKYAHRGSFQCLLGDQAH
NQALLDKFSIEKHIDAKTPPVFVWHTMTDDAVPVENTLMLIQACRAAGVS
IEAHLFPEGSHGLSLANAETAGNGFYAHIVECVQCWPDLAEAWLRRLF
(h) SEQ. ID. NO.804 (ORF2676)
MFLKPEQQLERCRRIVRQRVDPHIHPSIAQLTVESYDIPGEPMPSDEFFA
KLDRGDIDFKPFMLGSEWGTTWGTVWFRLTGTVPAGYPKGKPLELILDLG
WYPHSCGGHIEGLVYRADGTAIKAVHPLNYWVPFMDAEGNAQVPVAEDGS
FTLYLEAASNPLLLGVPPFIETELGDHATGKPDEPYVFKSADLAEFDERY
ENYSVDLDVVSSLMEFADKQSPRYWQLAKALQRSLNAYDERNPESVEAAR
AVLAGVLAKPANASAMNVSAIGHAHIDSAWLWPVRETRRKVARTVSNALA
LMDADPDFKYAMSSAQQYAWLEEDHPDIFKRMKRRIEEGRFIPVGGMWVE
ADGMLPAGESLIRQIAYGRKYFKEHLGVEPKGVWLPDSFGYTGAWPQIAR
RAGYEWFLTQKISWNDTTKFPHHSFMWEGIDGSRIFTHFPPADTYAAWCK
VQELDYAEKNFQDKDLSDRSLLLFGFGDGGGGPTRNMMEHLHRYENLEGV
SKVSIEEPNDFFDKAHQQLAENAGPEMPVWKGELYLELHRGTLTSQQDMK
RGCRQEESLLRTVEYLGAAAVLSDPEYVYPREELDRIWKTLLLNQFHDIL
PGSAIAWVHREAREDYRRDLKRLAEIAQDMCAVLRKANPQADLLAEARIS
QFRNDGASWHANRINEPTDALSVLTQTLDNGRVLLANGVLSVTIEADGTI
SSLLDEEHGRELVPAGTRLGQYELLRDEPAVWDAWEIERESLLMANAVTG
SIESVNTENGAAQVHVHTADGDTVITTTITLRPGSHTLDFHADIDWHERE
RFLKVDLPLGIVADQATYDCQYGLIRRPIVKNTASDEAKYESSTNRFAII
GDAGYAAAVINGSVYGSDASPIAGNAAEGRDSGTMFRLSLLSAPTFPDPR
TDIGSHEFDWSVVADATVDRALDAAGVLNAPVLHDVPDITPLASIESVNG
TVVLDWMKLADDGSGDLIVRAYEAAGGQADAMLHVCPALAGASVHETNVL
EGDDLAADLPVALQDGRQNAEGATLHFGPFQLATLRITR
(i) SEQ. ID. NO.313 (ORF1077)
MISRDGWAVIDDSAANIIIETDTVNGKANPFGTWVSPPATAETDLYFFGY
GHRYIEAVRDFYRLTGPTPLLPRFAMGNWWSRYYRYTQDGYLALMDRFKR
EGIPFTTSVIDMDWHRVDDVDPKYGSGWTGYSWNRELFPDPPAFLADLHR
RGLRTTLNVHPRDGVRAFEDAYPEVAKRVGIDPATEENVEFDLTNPDFVD
AYFDMHHRMEAEGVDFWWLDWQQGGVTRQKGLDPLWMLNHMHYLDSGRGG
NWPLTFSRYAGPGSHRYPVGFSGDTIVTWESLAFQPQFTATASNIGYGWW
SHDIGGHMFGYRNEELEARWYQLGAFSPINRLHSSNSPFSGKEPWNFNRD
VSAAMVDALRLRHAMMPYLYTMNYRAAEAGRPLVEPMYWQNPDTPDAYEV
PDEFRFGTELVVAPIVSPDDAAACRGRADAWLPQGEWFDFFDGRRYVSSD
AAGRRLEVWRSLDRTPVFAKAGAIVPLQDVAESGEAINSIANPQALRVLV
FPGADGSFVMREDRGTWGAPSADTAIAFTWGGADASPSAFTVAPVTGDTS
AVPELRDWTVVFRGVAPVDAASGVRAWSGEAPVEATVAYDEATMSLTVSV
TGISSAASLRIEIPGGLRIADNPVESDAMDLLLHAQMLYRTKELALQAVH
KLGIGAIGALRTMNRGPRYANDFWITDMPDAVAGALEEILLRS

[0044] It will be understood that the sequence information contained in the present application may be utilized for selecting a polynucleotide of interest, i.e. a nucleic acid containing an open reading frame encoding a known or an unknown, putative polypeptide and transforming micro-organisms with the selected polynucleotide. As transformation vehicles the well known plasmids, phage vectors (transfection) or F-vectors (conjugation) may be utilized. The nucleic acid introduced into the micro-organism selected may be expressed and its biological function may be either utilized as such, if known, or elucidated, in case a so far unknown polypeptide is expressed. The micro-organism selected may be a Bifidobacterium itself or other well known micro-organisms, such as bacteria, e.g. E. coli, Lactobacilli, Streptococci or yeast, insect cells or even-animal and plant cells.

[0045] It will be understood that the polypeptide may be expressed as such or as a fusion polypeptide. The skilled person is well aquatinted with techniques performing such a ligation and expressing the corresponding fusion-polypeptide in an appropriate cell.

[0046] In view of the present invention also new recombinant vectors for the cloning and/or the expression of a nucleotide sequence according to the present invention may be devised. The vectors comprise elements necessary to enable expression and/or secretion of the nucleotide sequences in a given host cell, such as a promoter, signals for initiation and for termination of translation, as well as appropriate regions for regulation of transcription. For example, expression of a protein or peptide may be controlled by any promoter/enhancer element known in the art. Exemplary promotors are the CMV promoter, the SV40 early promoter region, the promoter contained in the 3′ long terminal repeat of the rous sarcoma virus, the herpes thymidine kinase promoter, the regulatory sequences of the metallothionein gene, or, for prokaryotic expression systems, the β-lactamase promoter, the tac promoter or the T7 promoter.

[0047] The vector should be capable of being stably maintained in the host cell and may optionally possess particular signals specifying the secretion of the translated protein. These different elements are chosen according to the host cell utilized. To this effect the nucleotide sequences according to the invention may be inserted into autonomously-replicating vectors within the chosen host, or integrative vectors in the chosen host, such as e.g yeast artificial chromosomes, plasmids or viral vectors. It will be appreciated that the vector may well be the plasmid according to SEQ. ID. NO. 2 or a recombinant form thereof, which has been supplemented by particular ori's that enable a high copy number.

[0048] Any of the standard methods known to those skilled in the art for inserting DNA fragments into a vector may be used to construct expression vectors containing a chimeric gene consisting of appropriate transcriptional/translational control signals and the protein coding sequences. These methods may include in vitro recombinant DNA and synthetic techniques and in vivo recombinants (genetic recombination).

[0049] The vector may be used for transcripton and/or translation of a nucleic acid comprised in/by SEQ. ID. NO. 1 or SEQ. ID. NO. 2, to produce RNA or antisense RNA, respectively. Such a vector can remain episomal or become chromosomally integrated, as long as it can be transcribed to produce the desired transcript.

[0050] The antisense nucleic acids of the invention comprise a sequence complementary to at least a portion of a RNA transcript of a polynucleotide sequence in SEQ. ID. NO. 1, designating a sequence having sufficient complementarity to be able to hybridize with the RNA, forming a stable duplex. In the case of double-stranded antisense nucleic acid sequence, a single strand of the duplex DNA may thus be tested, or triplex formation may be assayed.

[0051] The invention also encompasses host cells transformed with a nucleic acid or a vector according to the present invention and as described above. These cells may be obtained by introducing into an appropriate cell a nucleotide sequence or a vector as defined above, and then culturing the said cell under conditions allowing the replication and/or the expression of the transformed/transfected nucleotide sequence.

[0052] The host cell may be chosen from eukaryotic or prokaryotic system, such as for example bacterial cells, yeast cells, animal cells as well as plant cells. In the context of this invention a cell shall be understood to comprise higher biological systems. Such as animals, whole plants or parts thereof. Furthermore, a host cell strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired.

[0053] A preferred host cell for the expression of the proteins of the invention consists of prokaryotic cells, such as gram negative or gram positive bacteria. A further preferred host cell according to the invention is a bacterium belonging to the Bifidobacterium family, more preferably belonging to the species Bifidobacterium longum or chosen from a microorganism associated with the species Bifidobacterium longum.

[0054] The transformed/transfected cells according to the invention may advantageously serve as a model and may be used in methods for studying, identifying and/or selecting compounds capable of being responsible for any of the beneficial effects brought about by the present Bifidobacterium strain.

[0055] The invention further provides polypeptides encoded by the Bifidobacterium longum ORFs, in particular those listed in table 1 and identified in the sequence listings. In the present description, the terms polypeptide, peptide and protein are used interchangeably. Furthermore the present invention also pertains to method for preparing such polypeptides by recombinant means comprising the steps of (a) culturing a host cell according to the present invention under conditions suitable to produce the polypeptide encoded by the polynucleotide; and (b) recovering the polypeptide from the culture.

[0056] It will be appreciated that the above polypeptides may also be obtained using combinatory chemistry, wherein the polypeptide is modified at some locations before testing them in model systems, so as to select the compounds which are the most active or which exhibit the desired properties.

[0057] In this context, chemical synthesis has the advantage of being able to use non-natural amino acids or nonpeptide bonds. Accordingly, in order to e.g. extend the life of the polypeptides according to the invention, it may be advantageous to use such non-natural amino acids, for example in the D form, or alternatively amino acid analogues, preferably sulphur-containing forms.

[0058] Finally, the structure of the polypeptides according to the invention, its homologous or modified forms, as well as the corresponding fragments may be integrated into chemical structures of the polypeptide type and the like. Accordingly, in order to preserve the polypeptide in an in vivo environment it will be preferred to provide at the N- and C-terminal ends compounds which convey a resistance to degradation to proteases.

[0059] It will also be appreciated that the different polypeptides according to the present invention and produced by the above method may represent antigens to the immune system of a host animal, so that antibodies may be produced directed against said polypeptides. These antibodies may be used for the detection of a polypeptide of interest in a mixture or generically of a strain of Bifidobacterium in a sample. In addition they may be used as research tools by e.g. producing antibodies against cellular surface epitopes and determining the effect of blocking certains polypeptides on the bacterial cell wall. Therefore, according to another aspect, the invention provides antibodies directed to epitopes on the various polypeptides provided by this invention.

[0060] According to another aspect the present invention also provides a method for the detection and/or identification of Bifidobacterium longum in a biological sample. This method may comprise several techniques known in the art, such as PCR or simply hybridisation with a suitable probe.

[0061] Alternatively, an antibody raised against a cell wall epitope of Bifidobacterium longum may be used for said purpose. It will be appreciated that the above method may also be reversed and the presence of antibodies against Bifidobacterium may be determined by contacting the sample to be tested with a polypeptide of Bifidobacterium under conditions to allow formation of immune complexes.

[0062] The polypeptides according to the invention, the antibodies according to the invention described below and the nucleotide sequences according to the invention may be used in in vitro and/or in vivo methods for the detection and/or the identification of bacteria belonging to the species Bifidobacterium in a biological sample (biological tissue or fluid) which is likely to contain them. These methods, depending on the specificity of the polypeptides, of the antibodies and of the nucleotide sequences according to the invention which will be used, may detect and/or identify the bacterial variants belonging to the species Bifidobacterium as well as associated microorganisms capable of being detected by the polypeptides, the antibodies and the nucleotide sequences according to the invention which will be chosen. It may, for example, be advantageous to choose a polypeptide, an antibody or a nucleotide sequence according to the invention, which is capable of detecting any bacterium of the Bifidobacterium family by choosing a polypeptide, an antibody and/or a nucleotide sequence according to the invention which is specific to the family.

[0063] All the sequences referred to herein (SEQ ID. NO. 1 and SEQ ID. NO. 2) are listed in the attached sequence listings which is to be considered as part of the specification.

[0064] The invention also comprises the nucleotide sequences or polypeptides according to the invention covalently or noncovalently immobilized on a solid support. In the first case such a support may serve to capture, through specific hybridization, the target nucleic acid obtained from a biological sample to be tested. If necessary, the solid support is separated from the sample and the hybridization complex formed between the capture probe and the target nucleic acid is then detected by means of a second probe, called detection probe, labelled with an easily detectable element.

[0065] Such support may take the form of so-called DNA array or DNA chips, a multitude of molecular probes precisely organized or arrayed on a solid support, which will allow sequencing genes, studies of mutations contained therein and the expression of genes, and which are currently of interest given their very small size and their high capacity in terms of number of analyses.

[0066] The function of these arrays/chips is based on molecular probes, mainly oligonucleotides which are attached to a carrier having a size of generally a few square centimetres or more as desired. For an analysis the carrier (DNA array/chip) is coated with probes that are arranged at a predetermined location of the carrier. A sample containing fragments of a target nucleic acid to be analysed, for example DNA or RNA or cDNA, that has been labelled beforehand, is subsequently contacted with the DNA array/chip leading to the formation, through hybridization, of a duplex. After a washing step, analysis of the surface of the chip allows the effective hybridizations to be located by means of the signals emitted by the labels tagging the target. A hybridization fingerprint results from this analysis which, by appropriate computer processing, allows to retrieve information such as the expression of genes, the presence of specific fragments in the sample, the determination of sequences and the presence of mutations.

[0067] The hybridization between the probes of the invention, deposited or synthesized in situ on the DNA chips, and the sample to be analysed, may, e.g. be determined by means of fluorescence, radioactivity or by electronic detection.

[0068] The nucleotide sequences according to the invention may be used in DNA arrays/chips to carry out analyses of the expression of the Bifidobacterium genes. This analysis is based on DNA arrays/chips on which probes, chosen for their specificity to characterize a given gene, are present. The target sequences to be analysed are labelled before being hybridized onto the chip. After washing the labelled compounds are detected and quantified, with the hybridizations being carried out at least in duplicate. Comparative analyses of the signal intensities obtained with respect to the same probe for different samples and/or for different probes with the same sample, determine a differential transcription of RNA derived from the sample.

[0069] The DNA arrays/chips according to the present invention may also contain nucleotide probes specific for other microorganisms, which will enable a serial testing allowing rapid identification of the presence of a microorganism in a sample.

[0070] The principle of the DNA chip, as detailed above may also be used to produce protein chips on which the support has been coated with a polypeptide or an antibody according to the invention, or arrays thereof, in place of the DNA. These protein chips make it possible to analyse the biomolecular interactions (BIA) induced by the affinity capture of target analytes onto a support coated e.g. with proteins, by surface plasma resonance (SPR). The polypeptides or antibodies according to the invention, capable of specifically binding antibodies or polypeptides derived from the sample to be analysed, may thus be used in protein chips for the detection and/or the identification of proteins in samples.

[0071] The present invention also relates to a computer readable medium having recorded thereon one or more nucleotide and/or a polypeptide sequences according to the invention. This medium may also comprise additional information extracted from the present invention, such as e.g. analogies with already known sequences and/or information relating to the nucleotide and/or polypeptide sequences of other microorganisms so as to facilitate the comparative analysis and the exploitation of the results obtained. Preferred media are e.g. magnetic, optical, electrical and hybrid media such as, for example, floppy disks, CD-ROMs or recording cassettes.

[0072] The invention also relates to kits or sets for the detection and/or the identification of bacteria belonging to the species Bifidobacterium longum or to associated microorganisms, which comprises, a polypeptide according to the invention, where appropriate, the reagents for constituting the medium appropriate for the immunological or specific reaction, the reagents allowing the detection of the antigen-antibody complexes produced by the immunological reaction between the polypeptide (s) of the invention and the antibodies which may be present in the biological sample, it being possible for these reagents also to carry a label, or to be capable of being recognized in turn by a labelled reagent, more particularly in the case where the polypeptide according to the invention is not labelled, a reference biological sample (negative control) free of antibodies recognized by a polypeptide according to the invention, a reference biological sample (positive control) containing a predetermined quantity of antibodies recognized by a polypeptide according to the invention.

[0073] The invention also relates to a kit or set for the detection and/or the identification of bacteria belonging to the species Bifidobacterium longum or to an associated microorganism, or for the detection and/or the identification of a microorganism, wherein the kit comprises a protein chip according to the invention.

[0074] The novel microorganism termed NCC2705, described herein by way of its genomic sequences, has been deposited according to the Budapest Treaty with the Institute Pasteur on Jan. 29th, 2001 and received the deposit no. CNCM I-2618. This micro-organism belongs to the genus Bifidobacterium, species Bifidobacterium longum and is a probiotc micro-organism, i.e. it may pass the gastrointestinal tract in an essentially live and viable form and has the capability of preventing colonization of the intestine with pathogenic bacteria causing diarrhea and in addition may prevent or reduce the occurence of infection of intestinal cells by rotaviruses.

[0075] The microorganism is gram positive, catalase negative and CO2 production negative, it produces L(+) lactic acid and essentially prevents colonization of intestinal cells by bacteria bringing about diarrhea, such as pathogenic E. coli, e.g. enteropathogenic E. coli (SPEC), or salmonella, e.g. Salmonella typhimurium and prevents infection of intestinal cells by rotaviruses.

[0076] The novel microorganism may be used for the preparation of a variety of carrier materials, such as e.g. milk, yogurt, curd, fermented milks, milk based fermented products, fermented cereal based products, milk based powders, infant formulae and may be included in the support in an amount of from about 105 cfu/g to about 1011 cfu/g. For the purpose of the present invention the abbreviation cfu shall designate a “colony forming unit” that is defined as number of bacterial cells as revealed by microbiological counts on agar plates.

[0077] The present invention also provides a food or a pharmaceutical composition containing at least the Bifidobacterium NCC 2705 and/or containing a supernatant, in which the microorganisms have been grown or an active fraction/metabolite thereof, respectively.

[0078] For preparing a food composition according to the present invention at least one of the Bifidobacteria of the present invention is incorporated in a suitable support, in an amount of from about 105 cfu/g to about 1012 cfu/g, preferably from about 106 cfu/g to about 1010 cfu/g, more preferably from about 107 cfu/g to about 109 cfu/g.

[0079] In case of a pharmaceutical preparation the product may be prepared in form of tablets, liquid bacterial suspensions, dried oral supplements, wet oral supplements, dry tube feeding or a wet tube feeding with the amount of the Bifidobacterium/Bifidobacteria to be incorporated therein being in the range of up to about 1012 cfu/g, preferably from about 107 cfu/g to about 1011 cfu 1 g, more preferably from about 107 cfu/g to about 1010 cfu/g.

[0080] The activity of the novel microorganism in the individual's intestine is of course dose dependent. That is, the more the novel microorganism or an active component thereof is incorporated by means of ingesting the above food material or the pharmaceutical composition the higher the protective and/or curing activity. Since the novel microorganism is not detrimental to mankind and animals and has eventually been isolated from baby feces a high amount thereof may be incorporated so that essentially a high proportion of the individual's intestine will be colonized by the novel microorganisms.

[0081] Yet, according to another preferred embodiment the supernatant of a culture of the Bifidobacterium of the present invention, or an active fraction thereof, may be used for preparing the carrier. The supernatant may be used as such or may be dried under conditions that do not destroy the metabolic compounds secreted by the microrganisms into the liquid medium, such as e.g. freeze drying, and may be included in the carrier. In order to minimize the number of unknown compounds in the supernatant the Bifidobacteria will preferably be grown in a defined media, the composition of which is known and does not negatively affect the host incorporating it. Further, the skilled person will, based on his general knowledge optionally deplete the supernatant from unwanted products, such as e.g. by means of chromatography.

[0082] The present inventors have investigated baby feces and isolated a variety of different bacterial strains therefrom. These strains were subsequently examined for their capability to prevent prevent colonization and/or invasion of epithelial cells with bacteria that are known to cause diarrhea, such as E. coli, Sigella, Kiebsiella, Yersinia, Pseudomonas aeruginosa Listeria, Streptococcus, Staphilococcus, Clostridium difficile, H. pyori and also Candida albicans.

[0083] Several bacterial genera comprising Bifidobacterium, Lactococcus and Streptococcus were screened for their diarrhea inhibitory properties. The tests for the inhibitory property were performed with pathogenic microorganisms, such as E. coli, Klebsiella, Yersinia, Pseudomonas aeruginosa, H. pyori, and Salmonella typhimurium as representatives for pathogenic micro-organisms causing diarrhea in affected individuals.

[0084] The various bacteria were grown in a suitable medium, such as MRS, Hugo-Jago or M17 medium at temperatures of from about 30 to 40° C. corresponding to their optimal growth temperature. After reaching stationary growth the bacteria were collected by centrifugation and resuspended in physiological NaCl solution. Between the different tests the bacterial cells were stored frozen (−20° C.).

[0085] For assessing anti-bacterial properties the following approaches were chosen.

[0086] According to one protocol the cultured Bifidobacterium of the present invention was examined for its capability to decrease the viability of the different pathogenic micro-organisms. To this end, a culture of pathogenic bacteria was contacted with a concentrated supernatant of a Bifidobacterium culture and the growth potential of the pathogenic bacteria was assessed.

[0087] According to a second protocol the adhesion capability of the Bifidobacteria of the present invention to T84 cells, a cell culture model for the intestine, was determined by culturing the Bifidobacterium with T84 cells and the rate of adhesion was assessed.

[0088] According to another protocol the potential of the Bifidobacterium of the present invention to prevent infection of intestinal cells by Salmonella, using the cell line Caco-2 as a model for the intestine, was determined. In this respect, the supernatant of a cell culture of the Bifidobacteria of the present invention was added together with the pathogenic microorganism to the intestinal cells and the rate of adhesion, or invasion, respectively, was assessed.

[0089] Thus, it could be shown that the cultured Bifidobacterium and the supernatant proofed to be extremely effective in preventing both adhesion to and invasion into the intestinal cells indicating that one or more metabolic compounds secreted by the microorganism is/are likely to be responsible for the anti-diarrhea activity.

[0090] According to yet another protocol it was further assessed, whether NCC2705 would be capable to prevent invasion of epithelial cells by rotaviruses. Two different protocols were applied. According to one protocol the various bacterial strains were examined for their direct interaction with the rotavirus strain while in the second protocol the bacteria were screened for those strains that interact with cellular rotavirus receptors.

[0091] The first protocol involved contacting the respective bacterial suspension each with a different rotavirus strain and incubating in suitable media. Subsequently, the virus-bacteria mixture was applied to a monolayer of cells of the human undifferentiated colon adenoma cells HT-29 (intestinal epithelial cell line) and incubation was continued. Virus replication was then assayed.

[0092] The second protocol involved incubating the respective bacterial suspension first together with a monolayer of cells of the human undifferentiated colon adenoma cells HT-29 and adding the virus subsequently. After continued incubation virus replication was assayed.

[0093] Rotavirus replication was assessed by histo-immunological staining of rotavirus proteins in infected cells. A rotavirus inhibitory effect was attributed to a given bacterium when the number of infected cells was reduced by 90% in the cell culture inoculated with rotavirus plus the indicated bacteria in comparison with cells inoculated only with rotavirus.

[0094] The present invention will now be described by way of examples without limiting the same thereto.

[0095] Media and Solutions:

[0096] MRS (Difco)

[0097] Hugo-Jago (tryptone 30 g/l (Difco), yeast extract 10 g/l (Difco), lactose 5 g/l (Difco), KH2PO4 6 g/l, beef extract 2 g/l (Difco), agar 2 g/l (Difco))

[0098] M17 (Difco)

[0099] Eugon Tomato Agar (Canned tomato juice 400 ml, Eugon agar BBL 45.5 g, Maltose Difco 10 g,

[0100] Hemin Sigma 5 mg, Agar Difco 5 g, distilled water 600 ml)

[0101] DMEM (Dulbecco's modified Eagle medium)

[0102] CFA (according to Ghosh et al. Journal of Clinical Microbiology, 1993 31 2163-6) Müller Hinton agar (Oxoid)

[0103] LB (Luria Bertami, Maniatis, A Laboratory Handbook, Cold Spring Harbor, 1992) C14-acetate (53.4 Ci/mMol, Amersham International PLC)

[0104] PBS (NaCl 8 g/l, KCl 0.2 g/l, Na2HPO4 1.15 g/l, KH2PO4 0.2 g/l))

[0105] Trypsin-EDTA solution (Seromed)

[0106] FCS Fetal calf serum (Gibco)

[0107] E. coli DAEC C 1845 was obtained from Washington University, Seattle and E. coli JPN15 was obtained from the Center for Vaccine Development of the University of Maryland, USA). The Salmonella typhimurium strain SL1344 was obtained from the department of Microbiology, Stanford University, CA, USA. This strain acts as a pathogen on mice and is resistant to Streptomycin. It adheres to Caco-2 colon cells (Finlay and Falkow, 1990). The Klebsiella was obtained from stock clinical isolates from the microbiological laboratory of the Faculté de Pharmacie Paris XI, Châtenay-Malabry, France. The Yersinia was obtained from INSERM Unit 411, Hôpital Necker, Paris, France. The Pseudomonas aeruginosa was obtained from stock clinical isolates from the microbiological laboratory of the Faculté de Pharmacie Paris XI, Châtenay-Malabry, France.

[0108] The H. pylori was obtained from Institute of Microbiology, Lausanne University, Lausanne, Switzerland.

[0109] Human rotavirus Wa (G1 serotype) and simian rotavirus SA-1 (G3 serotype) were obtained from P.A. Offit, Children's Hospital of Philadelphia, U.S.A. The DS-1{tilde over (x)}RRV reassortant virus was obtained from A. Kapikian, NIH Bethesda, U.S.A. The serotype 4 human rotavirus Hochi was obtained from P. Bachmann, University of Munich, Germany.

EXAMPLE 1

[0110] Isolation of Bifidobacteria

[0111] Fresh feces were harvested from diapers of 16 healthy babies 15 to 27 days old. 1 g of fresh feces was placed under anaerobic conditions for transportation to the laboratory and microbiological analyses were run within 2 hours from sampling by serial dilutions in Ringer solution and plating on selective media. Eugon Tomato Agar (Canned tomato juice 400 ml, Eugon agar BBL 45.5 g, Maltose Difco 10 g, Hemin Sigma 5 mg, Agar Difco 5 g, distilled water 600 ml) incubated anaerobically at 37° C. for 48 hours was used to isolate bifidobacteria. Colonies were randomly picked up and purified. Physiological and genetic characterisation was performed on the isolates.

EXAMPLE 2

[0112] Cultivating Cell Lines

[0113] Caco-2 Cells:

[0114] For the inhibition assays the cell line Caco-2 was utilized as a model of mature enterocytes of the small intestine. This cell line presents characteristic of intestinal cells such as e.g. polarization, expression of intestinal enzymes, production of particular structural polypeptides etc. The cells were grown on different supports, namely on plastic dishes (25 cm2, Corning) for growth and propagation, on defatted and sterilized 6 well glass plates (22×22 mm, Corning) for the adhesion and the inhibition tests. After the second day in culture the medium (DMEM) was changed on a daily basis. Before use the medium was supplemented with 100 U/ml penicilline/streptomycine, 1 μg/ml amphoterine, 20% FCS inactivated at 56° C. for 30 min and 1% of a solution containing non-essential amino acids (10 mM) (Eurobio, Paris, France). Culturing was performed at 37° C. in an atmosphere comprising 90% air and 10% CO2. The cells were splitted every six days. The cells were detached from the walls of the well by treatment in PBS with 0.015% trypsine and 3 mM EDTA at pH 7.2. For neutralizing the effect of trypsine an equal volume of the culture medium containing FCS was added to the cell suspension obtained, the mixture was centrifuged (10 min at 1000 rpm) and the pellet was again dissolved in culture medium. Living cells (not dyed with trypane blue) were counted. About 3.5×105 living cells were transferred to a new culture bottle and about 1.4×105 cells per well and cultivated until a confluent monolayer was obtained.

[0115] T84 Cells:

[0116] For the adhesion assays the cell line T84 was utilized as a model of colon cells from the intestine. This cell line presents characteristics of intestinal cells such as e.g. polarisation, expression of intestinal enzymes, production of particular structural polypeptides etc. T84 cells were obtained from University of California, San Diego, Calif. Cells were grown in DMEM (50%) and Ham's F12 (50%) supplemented with 2 mM glutamine, 50 mM HEPES, 1% non-essential amino acids and 10% inactivated (30 min, 56° C.) fetal calf serum Boechringer, Mannheim, Germany) at 37° C. in a 10% CO2/90% air atmosphere. Cells were seeded at a concentration of 106 cells per cm2. Cells were used for adherence assays at late post-confluence, i.e., after 10 days.

[0117] All strains except Bifidobacteria were kept at −80° C. in their culture medium containing 15% glycerol. As the number of transfers into new media has an influence on the adhesion factors, the Salmonella strain was only transferred twice within a period of 24 hours, the first transfer taking place when the strain was frozen. All cultures were raised aerobically.

[0118] Bifidobacteria

[0119] The bacterial strain (Bifidobacterium longum CNCM I-2618 (NCC2705) was stored at −20° C. in MRS medium containing 15% glycerol. The strain was grown under anaerobic conditions in MRS and transferred twice to new media at intervals of 24 hours before use in the inhibition assays. For the assay a concentration of 2×109 cfu/ml was utilized. The supernatant was collected by centrifugation for 1 hour at 20.000 rpm and the supernatant obtained was subsequently checked for the presence of bacteria. The strains of Bifidobacterium were cultivated anaerobically in MRS during 18 hours at 37° C. The cultures were then centrifuged (20 min. at 4° C.), the supernatant was collected, lyophilized, returned to the solution and then concentrated ten times (10×). The pH of the supernatant was finally adjusted to 4.5.

[0120] E. coli C 1845:

[0121] The first passage after thawing was effected on a CFA—Müller Hinton agar, which is suitable to effect expression of adhesion factors by the bacterium. Before each experiment the bacterial cells were incubated at 37° C. with a transfer to a new medium being effected twice after 24 hours each.

[0122] Klebsiella:

[0123] Bacteria were grown overnight for 18 hrs at 37° C. in Luria broth.

[0124] Yersinia:

[0125] Bacteria were grown overnight for 18 hrs at 37° C. in Luria broth.

[0126] Pseudomonas aeruginosa:

[0127] Bacteria were grown overnight for 18 hrs at 37° C. in Luria broth.

[0128] H. pylori:

[0129] Bacteria were grown on Brain-Heart Infusion (BHI)-agar plates containing 0.25% yeast extract (Difco Laboratories, Detroit, Mich.), 10% horse serum and 0.4% Campylobacter selective complement (Skirrow supplement, SR 69; Oxoid Ltd, Basingstoke, England).

EXAMPLE 4

[0130] The Caco-2 and T84 monolayers, prepared on glass coverslips which were placed in six-well Corning tissue culture plates (Corning Glass Works, Corning, N.Y.), were washed twice with phosphate-buffered saline (PBS). Bifidobacteria (1 ml, 4×108 bacteria/ml in spent culture supernatant, treated-supernatant or fresh MRS broth) were added to 1 ml of the cell line culture medium. This suspension (2 ml) was added to each well of the tissue culture plate and the plate incubated at 37° C. in 10% CO2/90% air. After 1 hour of incubation, the monolayers were washed five times with sterile PBS, fixed with methanol, stained with Gram stain, and examined microscopically. Each adherence assay was conducted in duplicate over three successive passages of intestinal cells. For each monolayer on a glass coverslip, the number of adherent bacteria was evaluated in 20 random microscopic areas. Adhesion was evaluated by two different technicians to eliminate bias.

[0131] The results are shown in FIG. 1 from which it becomes obvious that NCC2705 is capable to adhere to intestinal cells as compared to to the known cell line GG (WO 97/00078), La1 (EP 0 577 903) or another Bifido strain (BL28/Cal).

EXAMPLE 5

[0132] As candidates for pathogenic bacteria E. coli, Klebsiella, Yersinia, Pseudomonas aeruginosa and H. pyori were used.

[0133] Based on a culture of NCC2705 kept in MRS medium for 18 hours, an exponentially growing culture was produced (3 hours at 37° C.). 2 ml of this solution were removed and centrifuged for 5 min. at 5500 g, +4° C. After collection of the supernatant the cell pellet was washed in sterile PBS. After centrifuging, the pellet was collected and 2 ml of sterile PBS were added. The bacteria were counted and the suspension was adapted in such a way that between 1 and 5×106 bacteria/ml were produced.

[0134] The assessment of the antimicrobial effect exerted by the Bifidobacteria of the present invention was carried out according to the Lehrer method described in Lehrer et al., J. Imunol. Methods 137 (1991), 167-173, which document is incorporated here by way of reference. The results thereof are shown in FIGS. 2 and 3.

[0135] From the above results it may be seen that the Bifidobacterium of the present invention may effectively inhibit growth of the various pathogenic bacteria.

EXAMPLE 6

[0136] Inhibition Assay for Salmonella

[0137] Salmonella are bacteria that invade epithelial cells and multiply therein. For determining the inhibitory activity of the Bifidobacteria of the present invention towards Salmonella typhimurium the strain SL1344 and following procedure was used.

[0138] The pathogenic cells were cultivated in LB-medium. After the second passage to new medium the bacterial strains were marked with radioisotopes using C14-acetate at 10 μCi/ml in LB-medium. Incubation of the strains in this medium was performed for 18 hours at 37° C.

[0139] The bacterial suspension was subsequently subjected to centrifugation (1041 rpm, 15 min) so as to eliminate the remaining C14-acetate from the supernatant The pellet was suspended and washed in PBS and the cells were suspended at a concentration of about 108 cells/ml in 1% sterile mannose. Mannose is known to inhibit non specific adhesion. The bacterial solution was then adjusted to 2×108 cells/ml.

[0140] The pathogen (1 ml; 2×108 cells) and an aliquot of a supernatant (1 ml) of a Bifidobacterium culture are pre-incubated for 2 hours at 37° C. The suspension is subsequently centrifuged, the resulting supernatant is removed and the pellet is again suspended in 0.5 ml PBS. This pathogen solution (0.5 ml) is then brought in contact with human intestine cells in culture. The culture was washed with sterile PBS twice and 0.5 ml adhesion medium (DMEM) was added. The cells are then incubated for 1 hour at 37° C. under 10% CO2.

[0141] After incubation the number of bacteria in the incubation medium and on/in the intestinal cells are counted. In order to determine the amount of cells adhering on or having invaded into the intestinal cells the following approaches have been chosen.

[0142] For determining the number of adhering bacteria the medium was decanted and the cells were washed once with culture medium and once with sterile PBS. Subsequently, 1 ml of sterile H2O was added per compartment, to lyse the cells and to form a cell solution which was incubated for 1-2 hours at 37° C., after which successive dilutions were carried out. La order to count the number of adhering and invasive bacteria, the cell solution was centrifuged to remove cell debris and the radioactivity was measured.

[0143] According to another protocol 10 aliquots were each put on TSA medium. The media were then incubated for 18-24 hours at 37° C.

[0144] For determining the amount of invaded bacteria the Caco-2 cells were washed with PBS so as to eliminate all non-adhering cells. Subsequently, a medium containing gentamycin (20 μg/ml) was added and incubation was continued for 1 hour at 37° C. Gentamycin is an antibiotic not penetrating intestinal cells so that all extracellular microorganisms were filled, while bacteria having already invaded intestinal cells will survive. The cells were then incubated for another hour at 37° C. and were then washed twice with PBS. The cells were lysed by addition of and incubation in sterile distilled water for for 1-2 hours at 37° C. After removing the cell debris radioactivity was determined. According to another protocol successive dilutions were carried out, which were put on TSA medium. Incubation: 18-24 hours at 37° C.

[0145] It may be seen that cultured cells and the culture supernatant were extremely effective in preventing adhesion of and invasion into intestinal cells by Salnonella

EXAMPLE 7

[0146] Infection of Mice by the Strain S. typhimurium C5

[0147] Adult, 7-8 weeks old, axenic, female mice (C3H/He/oujco conventional, Iffa Credo, France), raised under sterile conditions, were orally infected with a fixed concentration of S. typhimurium (0.2 ml, 108− cfu/mouse). Some mice were rendered monoxenic by the implantation of a range of Bifidobacteria strains. With some mice, the Bifidobacteria in segments of the intestine were counted after its removal and mincing of the organs in PBS. With other mice, the protection against infection was assessed in such a way that they were continuously kept in a sterile environment and the days of survival were compared to the control group.

[0148] The results are shown in FIG. 4. As may be derived therefrom in the control group nearly all mice died after a time period of about 10 days. In contrast thereto, all mice treated with NCC2705 were alive after 10 days with only 20% dying from the detrimental effect exerted by Salmonella after a period of 30 days.

EXAMPLE 8

[0149] 1st Protocol:

[0150] 30 μl of the respective bacterial suspension (containing on average 3×106 bacteria) were mixed with 70 μl M199 medium supplemented with 10% tryptose phosphate broth (Flow) and 5% trypsin-EDTA solution (Seromed) to which were added 100 μl of virus in supplemented M199 medium. The virus-bacteria mixture thus obtained was incubated for 1 hour at 4° C. and for 1 hour at 37° C. Separately, cells of the human undifferentiated colon adenoma cells HT-29 growing as a confluent monolayer in 96-well microtiter plates (in M199 medium supplemented with 10% tryptose phosphate broth (Flow) and 5% trypsin-EDTA solution (Seromed) 1:4 diluted with PBS) were washed three times with phosphate-buffered saline (PBS; pH 7.2). The virus-bacteria mixture processed as indicated above was transferred to the cells and the microtiter plates were incubated for 18 h in a CO2 incubator (Heraeus). Virus replication was assayed as described below.

[0151] 2nd Protocol:

[0152] 30 μl of the bacterial suspension (supra) were mixed with 70 μl M199 medium supplemented with 10% tryptose phosphate broth Flow) and 5% trypsin-EDTA solution (Seromed) and applied directly on HT-29 cells grown and pretreated as described in the 1st protocol in the microtiter plates. After one hour incubation at 37° C. 100 μl of virus in supplemented M199 medium were added to the cells in the microtiter plates. The incubation was continued for 18 h in a CO2 incubator (Heraeus). Virus replication was assayed as described below.

[0153] The rotavirus replication was assessed by histo-immunological staining of rotavirus proteins in infected cells as described hereafter.

[0154] One day after infection, the cell culture medium was removed from the microtiter plates and the cells were fixed with absolute ethanol for 10 min. Ethanol was discarded, and the plates were washed three times in PBS buffer. Then 50 μl of an anti-rotavirus serum (mainly directed against VP6 protein), produced in rabbits (obtained from the ISREC University of Lausanne) and diluted 1:2000 in PBS was added to each well and incubated for 1 h at 37° C. with a cover slip to prevent desiccation of the wells. The anti-serum was discarded afterwards and the plates were washed three times with PBS. Then 50 μl of anti-rabbit immunoglobulin G (IgG) antiserum produced in goats and coupled to peroxidase (GAR-IgG-PO; Nordic) were added at a dilution of 1:500 in PBS to each well and the plates were incubated for 1 hour at 37° C. The serum was discarded and the plates were again washed three times with PBS. Then 100 μl of the following substrate mixture was added to each well: 10 ml of 0.05 M Tris-hydrochloride (pH 7.8), 1 ml of H2O2 (30% suprapur, diluted 1:600 in H2O; Merck) and 200 μl of 3-amino-9-ethylcarbazole (0.1 g/10 ml of ethanol stored in 200 μl aliquots at −80° C.; A-5754; Sigma). The plates were incubated for at least 30 min at room temperature. The substrate was discarded and the wells were filled with 200 μl of H2O to stop the reaction. Infected cell foci were counted with an inverted microscope (Diavert; Leitz).

[0155] Only very few bacterial strains interacted with rotaviruses. Merely 4 out of the 260 bacterial cells primarily selected inhibited rotavirus replication in at least one protocol. Bifidobacterium adolescentis CNCM 1-2618 (NCC2705) showed an extremely high activity against Serotype 1 Rotavirus, Serotype 3 rotavirus SA-11 and Serotype 4 rotavirus Hochi.

[0156] NCC2705 is gram positive and catalase negative, it does not produce CO2 during fermentation and produces just L (+) lactic acid according to methods disclosed in the “Genera of lactic acid bacteria”, Ed. B. J. B. Wood and W. H. Holzapfel, Blackie A&P.

[0157] These results show the extreme superior properties of the Bifidobacterium of the present invention.

Claims

1. A Bifidobacterium longum strain characterized by its genomic and plasmid sequences identified by SEQ ID. NO. 1 and SEQ ID. NO. 2.

2. A polynucleotide having a nucleotide sequence as identified by (a) the nucleotide sequence of SEQ. ID. NO. 1 or parts thereof; (b) a nucleotide sequence exhibiting at least 90% identity with the sequence of SEQ. ID. NO. 1.

3. A polynucleotide having a nucleotide sequence selected from the group: (a) a nucleotide sequence as identified by SEQ ID. NO. 2 or parts thereof; (b) a nucleotide sequence exhibiting at least 90% identity with SEQ. ID. NO. 2.

4. A method for producing a polypeptide of Bifidobacterium longum, comprising: (a) selecting a nucleotide sequence exhibiting an open reading frame contained in the polynucleotide sequence according to claim 2 or 3; (b) inserting the nucleotide in a vector or a chromosome of a host cell; (c) transforming a host cell with the vector of step (b); (d) culturing the host cell under conditions suitable to produce the polypeptide encoded by the polynucleotide; and optionally (e) recovering the polypeptide.

5. The method according to claim 4, wherein the polypeptide is produced as a fusion polypeptide.

6. A method for raising antibodies to Bifidobacterial proteins, which comprises, (a) producing a Bifidobacterial polypeptide according to a method of claims 4 or 5; (b) immunizing animals with the polypeptide obtained; and (c) collecting antibodies produced by the animal against the Bifidobacterial proteins.

7. A method for the detection, identification and/or selection of a Bifidobacterial strain, preferably Bifidobacterium longum in a biological sample, comprising: (a) contacting the sample with a nucleotide sequence derived from a polynucleotide sequence according to any of the claims 2 or 3 in the presence of a polymerase enzyme and nucleotides under conditions which permit extension of the nucleotide; and (b) detecting the presence of extension products in the sample in which the detection of primer extension products indicates the presence of a Bifidobacterial strain in the sample.

8. A method for the detection, identification and/or selection of a Bifidobacterial strain, preferably Bifidobacterium longum in a biological sample, comprising: (a) contacting the sample with a nucleotide sequence derived from a polynucleotide sequence according to any of the claims 2 or 3 under conditions which permit hybridization of complementary base pairs; and (b) detecting the presence of hybridization complexes in the sample in which the detection of hybridization complexes indicates the presence of a Bifidobacterial strain in the sample.

9. A method for the detection, identification and/or selection of a Bifidobacterial strain, preferably Bifidobacterium longum in a biological sample, comprising: (a) contacting the sample with an antibody produced according to the method of claim 6 under conditions suitable for the formation of immune complexes; and (b) detecting the presence of immune complexes in the sample, in which the detection of immune complexes indicates the presence of a Bifidobacterial strain in the sample.

10. A method for the detection, identification and/or selection of antibodies directed to Bifidobacterial polypeptides in a biological sample, comprising: (a) contacting the sample with a polypeptide produced according to claim 4 or 5 under conditions suitable for the formation of immune complexes; and (b) detecting the presence of immune complexes in the sample, in which the detection of immune complexes indicates the presence of Bifidobacterial polypeptides in the sample.

11. Use of a polynucleotide according to claim 2 or 3 or a part thereof for elucidating interactions between a host and bacteria.

12. The use according to claim 11, wherein the interaction is based on probiotic properties of bacterial strains, preferably on anti-pathogenic properties and/or anti-viral properties.

13. A DNA array/chip containing an array of polynucleotides comprising at least a polynucleotide according to any of the claims 2 or 3 or parts thereof.

14. A protein array/chip containing an array of polypeptides comprising at least one of the polypeptides produced according to the method of claims 4 or 5.

15. An antibody chip containing an array of antibodies comprising at least one of the antibodies produced according to the method of claim 6.

16. A screening assay, comprising: (a) contacting a test compound with a polynucleotide according to any of the claims 2 to 3 or with a part thereof; and (b) detecting whether binding occurs.

17. A screening assay, comprising: (a) contacting a test compound with a polypeptide produced according to a method of claim 4 or 5; and (b) detecting whether binding occurs.

18. A screening assay, comprising: (a) contacting a test compound with an antibody produced according to a method of claim 6; and (b) detecting whether binding occurs.

19. A kit comprising a polynucleotide according to any of the claims 2 or 3 or parts thereof.

20. The kit according to claim 19, wherein the polynucleotide is a primer or a probe and wherein the kit optionally contains a polymerase and deoxynucleotide triphosphates.

21. A kit comprising containing an antibody produced according to the method of claim 6.

22. A computer readable medium having recorded thereon a nucleic acid sequence according to any of the claims 2 or 3.

23. A computer readable medium having recorded thereon a polypeptide sequence derived from the nucleotide sequence according to any of the claims 2 or 3.

24. The computer readable medium according to any of the claims 22 or 23, wherein said medium is selected from the group consisting of: (a) a floppy disc; (b) a hard disc; (c) random access memory (RAM); (d) read only memory (ROM); and (e) CD-ROM.

25. A computer-based system for identifying fragments of the Bifidobacterium longum genome comprising the following elements: (a) a data storage means comprising a nucleic acid sequence according to any of the claims 2 or 3; (b) search means for comparing a target sequence to the nucleotide sequence of the data storage means of step (a) to identify homologous sequence (s); and (c) retrieval means for obtaining said homologous sequence (s) of step (b).

26. Use of a Bifidobacterium according to claim 1, or a micro-organism, containing a polynucleotide sequence according to any of the claims 2 or 3, or a culture supernatant thereof, or a metabolite thereof for the preparation of a carrier.

27. The use according to claim 26, wherein the Bifidobacterium is contained in the carrier in an amount of from about 105 cfu/g to about 1012 cfu/g carrier material.

28. The use according to any of the claims 26 and 27, wherein the carrier is for the prevention and/or treatment of gut disorders or gut discomforts, preferably IBD (intestinal bowel disease), Crohn's-disease or diarrhoea.

29. The use according to claim 28, wherein the gut disorders or gut discomfort is brought about by pathogenic bacteria and/or rotaviruses.

30. The use according to any of the claims 26 to 29, wherein the carrier is a food composition selected from milk, yoghurt, curd, cheese, fermented milks, milk based fermented products, ice-creams, fermented cereal based products, milk based powders, infant formulae, pet food or a pharmaceutical composition selected from tablets, liquid bacterial suspensions, dried oral supplement, wet oral supplement, dry tube feeding or wet tube-feeding.