The instant invention is directed to a soluble and stabilized form in aqueous media of the envelope glycoprotein gp41 of HIV-1 suitable for inducing an immune response against a human immunodeficiency virus type 1 (HIV-1), pharmaceutical compositions comprising said gp41, a method of treatment against a human immunodeficiency virus, and/or HIV related diseases or disorders.
HIV-1 encodes a 160 kDa envelope glycoprotein (gp160) precursor, which is proteolytically cleaved into the exterior (gp120) and transmembrane (gp41) glycoproteins.
In the glycoprotein mature envelope, the gp120 glycoprotein remains associated with the gp41 ectodomain through a noncovalent interaction. The native HIV-1 envelope glycoproteins exist predominantly as trimers at the surface of the viral membrane, which consists of three gp120 and three gp41 subunits and are anchored in the viral or infected cell membrane by the gp41 transmembrane region.
It has been shown that the binding of gp120 to the CD4 receptor induces conformational changes that promote subsequent interaction with one of a number of chemokine receptors (CXCR4, CCR5 . . . ). These binding events trigger conformational changes in gp41. In particular, studies by X-ray crystallography and nuclear magnetic resonance indicate that the viral envelope glycoprotein gp41 exists in at least three conformations, a native conformation (spike), a prefusogenic metastable conformation which is converted to a thermostable fusogenic “three hairpin” conformation following a triggering event, such as binding of HIV-1 virus particle to the membrane of target cells.
So, the binding of gp120 to cellular coreceptors induces the gp41 conversion from a prefusogenic form to a fusogenic form.
The linear organization of the gp41 includes a fusion peptide, an ectodomain (a N-terminal coiled-coil, a disulfide-bonded loop region, and a C-terminal a-helical segment) and a transmembrane domain.
In the fusogenic six-helix bundle of the gp41, three N-terminal helices form a trimeric coiled-coil, and three C-terminal helices pack in the reverse direction into three hydrophobic grooves on the surface of the coiled-coil. This helical-hairpin structure corresponds to the fusion-active conformation of gp41. Because the transmembrane anchor and the fusion peptide of the gp41 ectodomain are embedded in the viral and target cell membranes, respectively, the formation of the fusogenic hairpin structure results in the colocalization of the two membranes and thus overcomes the energy barrier for membrane fusion.
The envelope glycoproteins of HIV-1 represent the only realistic viral target for vaccine-induced neutralizing antibody responses because they promote viral membrane fusion through receptor-mediated conformational change and they are expressed on the surface of both virions and infected cells. Monomeric HIV-1 gp120 and derivatives were initially considered to be principal vaccine candidates. However, HIV-1 gp120 is highly variable and has repeatedly proven to be an immunogen ineffective at eliciting neutralizing antibodies against clinical HIV-1 isolates. Few of the antibodies raised by gp120 monomers effectively bind assembled HIV-1 envelope glycoprotein trimers.
In contrast, gp41 is an extremely immunogenic glycoprotein, inducing antibodies in essentially all HIV-infected individuals.
The ectodomain of gp41 is the most conserved region of the HIV-1 envelope, membrane protein which otherwise exhibits considerable genetic diversity even among closely related isolates.
Furthermore, the gp41 performs a critical role in maintaining the conformation and infectivity of the HIV-1 virions.
The antibodies targeting the six-helix bundle (fusogenic form) and prehairpin (prefusogenic form) structures arrest fusion under certain conditions. Antibodies having access to prehairpin and six-helix bundles conformations of gp41 would be capable of inhibiting gp41-mediated fusion. Furthermore, the six-helix bundle is an extremely stable structure.
Those observations allow considering the gp41 six-helix, under a modified form or not, as an attractive target for drugs and vaccine development.
In U.S. Pat. No. 6,455,265, it was shown that some gp41 derivatives could be particularly efficient for obtaining vaccines for preventing the pathogenic effects related to a HIV retroviral infection, with the proviso that the corresponding polypeptides have epitopes having a modified antigenicity so as to obtain a differential immune response with respect to the viral envelope and some self-proteins.
More precisely, it was discovered that conserved and immunodominant regions of the retroviral envelope could be responsible for harmful autoimmune phenomena, particularly in the case of the gp41 retroviral envelope. It was observed that certain immunodominant regions of the gp41 exhibit three-dimensional structural analogies and/or cross-reactivities with certain regions of some proteins of the human immune system, and in particular the interleukin 2 (IL-2).
Accordingly, it was proposed in U.S. Pat. No. 6,455,265 modified polypeptides obtained by modifying the antigenicity of the concerned epitope of the envelope protein, in order to obtain a differential immune response with respect to the viral envelope protein and these proteins of the human immune system, in particular IL-2.
According to WO2005/01033, such modified polypeptides with at least one antigenic region of native gp41 protein of HIV-1 have been disclosed
Generally, synthetic gp41 can be produced in transfected baculovirus or mammalian cells but the yield is lower than in E. coli. Furthermore, the glycosylation in baculovirus or mammalian cells is different from the glycosylation of human cells and is not necessary for the immunogenicity of the protein. Gp41 is in fact very immunogenic without glycosylation.
However, full length or shorter recombinant HIV-1 ectodomain of gp41 produced in E. coli generally forms insoluble precipitates (aggregates of gp41 trimeric form) in aqueous media at neutral pH.
There is still a need to produce high levels of gp41 proteins that may be devoid of immunodominant region that trigger antibodies with no neutralizing activities but keeping important gp41 regions to focus the immune response on relevant epitopes that retain their overall immunogenic activity.
However there is still a need for a vaccine that allows for inducing a versatile immune response against HIV infection, and in particular HIV-type 1 infection. There is also a need for the development of non-clade B vaccines, such as, for example, clade C strains.
There is also a need for the development of a vaccine with broad inhibitory spectrum allowing for cross-clade inhibition.
There is a need for a vaccine allowing to induce an innate and/or a humoral and/or cellular immune response against HIV-1 infection.
There is a need for a vaccine allowing to induce an immune response against HIV infection at the mucosal surface level and/or at the blood level.
There is a need for a vaccine suitable for inducing mucosal IgA and/or antibodies and/or systemic IgA and/or IgG antibodies capable of interfering with HIV entry across the mucosa and early cell infection under the mucosa.
There is a need for a vaccine suitable for inhibiting or reducing HIV entry across mucosal tissues, e.g. vaginal mucosal tissues through various mechanisms such as transcytosis and ADCC (Antibody Depedent Cell Cytotoxicity).
It is an object of the invention to satisfy to all those above-mentioned needs.
The instant invention is more precisely directed to propose stabilized hydrosoluble forms of gp41 protein.
Unexpectedly, the inventors have discovered that it was possible to decrease significantly any immunodominant cross reaction with some proteins of the human immune system, the hydrophobicity of the loop, as to increase the solubility and the stability of the gp41 derivatives, resulting in a trimeric soluble form of gp41, without altering its immunogenic reactivity. In addition, according to a preferred, but non exclusive embodiment said polypeptides are easily purified and attached to a vehicule suitable for inducing an immune response against a human immunodeficiency virus, for instance a virosome.
One primary object of the present invention is to design other modified polypeptides having an improved stability, in monomeric or oligomeric form, while keeping their solubility in aqueous media, in particular once they are externally attached or linked to a same virosome particule.
Another object of the present invention is to design other modified peptides, which once conjugated with a virosome-like particle, mimick the orientation / presentation of the gp41 protein on native HIV viral membrane and/or on any HIV infected cell membrane.
Another object of the present invention is to design other modified peptides having effective antigenic possibly immunogenic properties, which makes them possible candidates for prophylaxis treatment against HIV. Correspondingly, one object of the present invention is any antigenic and/or immunogenic compound or composition comprising these other modified peptides.
Another object of the present invention is to design other modified polypeptides effectively eliciting systemic IgG (blood) and possibly complementary mucosal IgA toward relevant conserved regions of gp41 protein, in particular against cross-clade variants of HIV, for instance against clade B and clade C of HIV1, among which various subtypes thereof.
Another object of the present invention is to design other modified peptides effectively eliciting protective antibodies and generating little if none, non neutralizing antibodies against HIV, or having better or optimally focused antibody response against the conserved regions of gp41.
Another object of the present invention is to design other modified peptides capable of blocking virus translocation across the mucosal barrier and/or of inhibiting cell infection, thus preventing HIV-1 infection.
Another object of the present present invention is to provide for gp41 protein like polypeptides capable of being lipidated, i.e. combined directly or indirectly at their C-terminal end with a suitable lipid, with a yield compatible for industrialization/production of any virosome conjugate of same peptide. Another object of the present invention is to provide for gp41 protein like polypeptides capable of being linked, i.e. externally attached, to virosome-like particles, with a yield compatible for industrialization/ production of any conjugate of some peptide.
Within one aspect of the invention there is provided a modified polypeptide comprising three contiguous segments N, L and C represented by the formula N−L−C and comprising: a N-helix region of gp41(N), a C-helix region of gp41(C), and a connecting loop comprising a synthetic linker (L) between the N and C-helices, the linker replacing amino acids 593-617 of gp41, the numbering scheme being based upon the prototypic isolate HIV-1 HxB2 clade B strain, said polypeptide comprising the calveolin-1 neutralizing and 98.6 D epitopes, no 2F5 and 4E10 epitopes, no fusion peptide and has a minimal interleukin 2 (IL-2) immunogenic cross-reactivity.
A polypeptide according to the invention is hereinafter indifferently named “gp41 derived antigen” or “gp41 according to the invention” or “rgp41”.
The polypeptide according to the present invention almost maintain a native conformation of an interaction between the N- and C-helices and have the hydrophobicity that provides a soluble and stable trimeric form to said modified polypeptide without substantially altering its immunogenic reactivity.
In the meaning of the present invention, the 2F5 epitope corresponds to a specific region of gp41 recognized by the human 2F5 antibody which has a broad neutralizing activity for diverse primary HIV-1 isolates (Trkola A. et al., 1995, J. Virol., 69, pp 6609-6617, see
The 4E10 human monoclonal antibody is specific for the transmembrane proximal region of gp41 in a location immediately nearby carboxy terminal to the 2F5 epitope and also has a broad neutralizing activity (Zwick et al., 2001, J. Virol., 75, pp 10892-10905, see
The 98.6D epitope is located in cluster II region of gp 41 and is recognized by the 98.6D human monoclonal antibody as described in Gorny M. K. et al., 1989, Proc. Natl. Acad. Sci., 86, pp 1624-1628 and Xu J.-Y. et al., 1991, J. Virol., 65, pp 4832-4838.
The calveolin-1 binding domain corresponds to the CBD1 peptide (SLEQIWNNMTWMQWDK, SEQ ID No. 8) in gp-41 (Benferhat et al., 2009, Mol. Immunol. 46(4), pp 705-712). The fusion peptide corresponds to the amino-terminal region of gp41, which is exposed after formation of the coiled-coil form. This region is inserted into the membrane of the target cell, resulting in the fusion of virus and cell membranes; it corresponds to the region 512-539 of extracellular portion of gp 41 (Quintana et al., 2005, JCI; see
According to the present invention, a polypeptide allows the formation of gp41-trimers and has retained the native gp41 antigenicity and presents a minimal IL-2 cross reactivity. Such cross reactivity can be determined by methods well known to the skilled man in the art such as gp41-ELISA and gp41-dot blot. An example of such a determination is presented below (see example 3,
According to the present invention, the expression “retains the native gp41 antigenicity” or “without altering its immunogenic activity” means that a polypeptide according to the invention has almost the same level of antigenic and/or immunogenic activity as the wild type gp41.
The N and C segments which constitute a polypeptide according to the present invention may be derived from any gp41 protein of HIV, including the HIV-1 and HIV2 strains, including laboratory strains and primary isolates. Preferably, these segments are derived from an HIV-1 strain, and in particular from an HIV1 HxB2 strain such as described in SEQ ID No. 1.
The nucleotide and peptide sequences of a large number of gp41 proteins are known and available, for example, on the Internet on the site http://www.hiv.lanl.gov/ and also in the corresponding Los Alamos compendia (HIV Sequence Compendium 2005 Leitner T, Foley B, Hahn B, Marx P, McCutchan F, Mellors J, Wolinsky S, and Korber B, Eds., published by Theoretical Biology and Biophysics Group, Los Alamos National Laboratory, NM, LA-UR 06-0680).
Any sequence, as defined above and/or in the claims, into which one or more conservative mutations (which do not substantially modify immunogenicity) have been introduced is also covered by the above definition.
The amino acids are numbered with reference to the sequence of the gp41 protein described in
In a more preferred embodiment the polypeptide of the invention is a sequence described by SEQ ID No. 17 or by SEQ ID No. 18.
In a further aspect of the invention, the polypeptide also comprises at least one spacer peptide segment S. In a specific aspect, the polypeptide of the invention is represented by SEQ ID No. 19 or SEQ ID No. 20, and respectively named Mo or M1.
Said spacer sequence being useful to obtain a better conjugation, e.g. linking of the polypeptide with a carrier, e.g. a virosome, rendering the reactive amino acids on which said grafting is done more accessible.
In particular it may allow to move further apart the amino-acid(s) on which said grafting is done from the membrane of the virosome.
The composition of said spacer segment, e.g. amino acid sequence can also be designed in order to help in the production process of a polypeptide according to the invention. In a particular embodiment of the invention, said spacer segment can comprise histidine residues that can participate to the purification step of the whole polypeptide (see below in example 1).
Said spacer peptide comprises at least the amino acid sequence described by SEQ ID No. 9, SEQ ID No. 10, SEQ ID No. 11 or SEQ ID No.12 at the C-terminal part of the polypeptide of the invention.
Said spacer sequence may also participate in the immunogenicity of a polypeptide according to the invention.
In preferred embodiments the N segment is represented by the amino acids 540-592 of gp41, the numbering scheme being based upon the prototypic isolate HIV-1 HxB2 and/or the C segment is represented the amino acids 618-664 of gp41 the numbering scheme being based upon the prototypic isolate HIV-1 HxB2.
According to a preferred embodiment, the N segment is the sequence described by SEQ ID No.13 or SEQ ID No. 14 and /or the C segment is the sequence described by SEQ ID No.15.
In a still further aspect of the invention, said L fragment is a sequence described by SEQ ID No. 16.
The polypeptides of the invention are able to form trimers.
In another aspect, the present invention deals with an aqueous composition comprising a polypeptide of the invention, said polypeptide forming a stable trimers in an aqueous medium
The present invention, in particular as defined in the following claims, encompasses polypeptides equivalent to those previously defined or described, in particular analogues thereof as defined hereunder with reference to other additional antigens suitable for carrying out the present invention.
Within the meaning of the invention, the expression “analogue thereof with respect to a gp41-derived antigen intends to refer to a peptide having substantial (at least 85%, in particular at least 90% and more particularly at least 95%) amino acid sequence identity or homology (i.e. aminoacid residue replaced by an aminoacid residue of the same family, of similar polarity or charge, for example) with the amino-acid sequence of said gp41-derived antigen, and which has similar or conserved biological properties, in particular with respect to the binding antigen portion of immunoglobulin directed against the gp41 protein.
According to the characteristics described above, a polypeptide according to the present invention forms soluble trimers in solution.
As such, in a further aspect, the invention deals with an aqueous composition comprising a polypeptide according to the invention, said polypeptide, forming a trimer in an aqueous medium. In said aqueous composition said trimer is stable.
The oligomeric, e.g. trimeric, state of a peptide according to the invention can be determined by methods well known to those skilled in the art such a gel filtration for instance FPLC with a separation between 3000 and 600 000 Daltons.
The stability of the trimers formed by the peptide of the invention can be measured by techniques well known to those skilled in the art such as several cycles of freeze and thawing of the aqueous composition comprising the polypeptide of the invention.
The polypeptides according to the invention are obtained by any conventional or standard technique of chemical synthesis or of genetic engineering well known by the person skilled in the art.
According to one option, the polypeptides are produced by chemical synthesis: they may be synthesized in the form of a single sequence, or in the form of several sub-sequences which are then linked to one another. The chemical synthesis may be carried out in solid phase or in solution, these two synthesis techniques being well known to those skilled in the art. These techniques are in particular described by Atherton and Shepard in “Solid phase peptide synthesis” (IRL press Oxford, 1989) and by Houbenweyl in “Methoden der organischen Chemie” [Methods in Organic Chemistry] published by E. Wunsch Vol. 15-1 and 11, Stuttgart, 1974, and also in the following articles, which are entirely incorporated herein by way of reference: P. E. Dawson et al. (Science 1994; 266(5186), pp 776-779); G G Kochendoerfer et al. (1999; 3(6), pp 665-671); P E Dawson et al. (2000, 69, Annu. Rev. Biochem., pp 923-960).
According to another option, the polypeptides according to the invention are produced using genetic engineering techniques well known to those skilled in the art. When the said polypeptides according to the invention are produced by genetic engineering, they may comprise, at the NH2-terminal end, an additional methionine residue corresponding to the translation of the first initiation codon.
These techniques are described in detail in Molecular Cloning: a molecular manual, by Maniatis et al., Cold Spring Harbor, 1989. Conventionally, the PCR technique is used to produce the DNA sequence encoding the polypeptides according to the invention in a form which can be inserted into an expression vector. The expression vector containing the sequence of interest is then used to transform a host cell which allows for expression of the sequence of interest. The polypeptides produced are then isolated from the culture medium using conventional chromatography techniques well known to those skilled in the art. High performance liquid chromatography (HPLC) is preferably used in the purification stage. Typically, the cells are collected by centrifugation at the end of culture, and are taken up in a neutral buffer, in order to be disrupted by any suitable means. The cell lysate is then centrifuged in order to separate the soluble material from the insoluble material. SDS-PAGE analysis of the supernatant and of the pellet from centrifugation reveals whether the polypeptide is soluble or not. If the peptide is insoluble, solubilization is obtained using a buffer containing urea, guanidine or any other solubilizing agent. Centrifugation at this step makes it possible to remove debris and other insoluble products which would hamper the chromatography. The following step consists in loading the solubilized molecule onto an affinity column, which may be of the metal chelate type if a plurality of histidine residues such as in the linker segment L which can be integrated onto the polypeptide of interest. The system which enables the affinity purification may be varied in nature, such as immunoaffinity, affinity on cibachron blue, etc. At this stage, the polypeptide exhibits a degree of purity close to or greater than 80%, in particular of at least 90%, as may be determined by colorimetry of a SDS-PAGE electrophoresis followed by Coomassie blue staining. Densitometric measurement of the bands makes it possible to quantify the degree of purity. The degree of purity may also be measured by reverse-phase HPLC, by measuring the area of the various peaks. An additional chromatography step may be added in order to further purify the polypeptide; by way of example, mention may be made of gel filtration and reverse-phase chromatography.
In a further embodiment, the present invention also concerns a polynucleotide encoding the above defined polypeptides.
The polynucleotides of the present invention include both single-stranded and double-stranded DNA/RNA molecules.
In a specific aspect the present invention, a polynucleotide encoding a rgp41 according to the present invention is described by SEQ ID No.21 or SEQ ID No. 28.
Additional DNA sequences encoding modified polypeptides, remaining within the scope of the present invention, can be readily generated by those of ordinary skill in the art, based on the genetic code and the polypeptide sequences described in the present specification. Counterpart RNA sequences can be generated by substitution of U for T. Those skilled in the art will readily recognize that, in view of the degeneracy of the genetic code, sequence variation is possible among polynucleotide molecules coding for the polypeptides according to the present invention, in particular the polynucleotide sequences described in the present specification.
Conversely, any person skilled in the art will recognize that sequence variation is possible among polypeptides molecules encoded by the polynucleotides molecules according to the present invention, in particular the polynucleotide sequences described in the present specification, still in view of the degeneracy of the genetic code.
All these variations are encompassed by the invention definition(s) and appended claims, in so far that those variations do not substantially alter the structure/conformation, and/or function(s) and/or properties of the resulting polypeptide with reference to the ones specifically previously and/or hereinafter described.
According to one embodiment of the invention, a polynucleotide sequence according to the invention is directly chemically synthesized (Young L and Dong Q., 2004,-Nucleic Acids Res., April 15; 32(7), Hoover, D. M. and Lubkowski, J. 2002,. Nucleic Acids Res., 30, Villalobos A, et al., 2006. BMC Bioinformatics, June 6; 7:285).
The polynucleotide sequences of the invention thus obtained can be introduced in a known manner into any appropriate vector which makes it possible to express said polypeptide, optionally in modified form, in convenient cell systems.
The polynucleotide sequences thus obtained can be introduced into a host cell, so as to transform the host and promote expression (e.g. transcription and translation) of the introduced sequence. Vectors include plasmids, phages, etc. Use is preferably made of vectors in which the DNA sequence encoding a polypeptide according to the invention is under the control of a strong promoter, which may or may not be inducible. As an example of a promoter which may be used, mention is made of the T7 RNA polymerase promoter. The expression vectors may include a selectable marker, such as the ampicillin, tetracycline or other antibiotic resistance genes appropriate for use in humans. Alternatively the transformed cells can be selected thanks to an auxotrophic marker, or any kind of antibiotic-free selection means (complementation of an essential gene previously knocked-out into the host's genome).
Examples of expression vectors which may be used include the plasmids pET21b, pET30 (Novagen), yeast, bacteria, viral vectors, such as: baculoviruses, and poxviruses.
In order to promote the expression and purification of a polypeptide, according to the present invention, the latter may be expressed in a modified form, such as a fusion protein, and may include not only secretion signals, but also additional heterologous functional regions. For example, a region of additional amino acids, particularly charged amino acids, may be added at the N-terminal of the polypeptide in order to improve stability and persistence in the host cell.
An object of the invention also deals with an expression vector comprising a polynucleotide as described above.
Said vector can be used to transform a host organism, said host organism forming another object of the present invention.
The invention also provides a host cell transformed with said vector. Any host cell conventionally used in combination with the expression vectors described above may be used, for instance E. coli, 21(DE3), BLR(DE3), origami 2(DE3), Bacillus or other gram positive hosts such as Lactococcus lactis, yeast, baculovirus and eukaryotic cells such as CHO or Vero. Preferred cell expression systems include E. coli such as BL21 (DE3).
In another of its aspect, the present invention deals with a conjugate, such conjugate comprises a polypeptide according to the present invention.
An in a specific aspect, the polypeptide the invention is conjugated with a virosome-like vesicle.
Virosome-Like Vesicle
A virosome-like vesicle suitable for the instant invention comprises at least virosomal lipids and preferably exhibits fusion membrane properties.
According to an embodiment, a virosome-like vesicle of the invention may comprise a unilamellar lipid bilayer.
According to an embodiment, a virosome-like vesicle of the invention may be a bi- or a multilamellar vesicle.
According to an embodiment, a virosome-like vesicle may have a diameter generally in the range of 50 to 600 nm, and in particular a diameter from 100 nm to 300 nm, and in particular from 200 nm to 400 nm.
Virosome-like vesicles of the invention may be spherical unilamellar vesicles with a mean diameter with approximately 150 nm. Virosome-like vesicles comprise, incorporated into the lipid bilayer, viral membrane proteins with or without fusion properties or fragments thereof.
The expression “fusion proteins or fragments thereof” is intended to refer to proteins or fragments thereof capable of inducing and/or promoting a fusion reaction between a virosome-like vesicle membrane and a biological membrane of the target cell.
For example, fusion proteins may be influenza membrane glycoproteins such as hemagglutinin (HA).
According to an embodiment, at least two different fusion proteins or fragments thereof may be used, that may display distinct fusion characteristic. According to another embodiment, distinct fusion characteristics may be, for example, different sensitivity to temperature, to ion concentration, to acidity, to cell type and to tissue type specificity.
According to an embodiment, a virosome-like vesicle may contain fusion proteins that mediate fusion at two distinct temperatures. According to another embodiment, hemagglutinin (HA) from different virus strains may be used to construct a virosome-like vesicle. As an example, HA molecules from both X-31 and PR8/34 virions may be capable of catalyzing two distinct fusion reactions at distinct temperatures.
Fusion proteins with different fusion characteristics may be derived from different influenza strains, or fusion proteins may be derived from other viruses, such as the vesicular stomatitis virus (VSV) E1 protein, the Semliki Forest virus (SFV) envelope protein complex, or the Sendai virus F protein.
An antigen coupled to the membrane of a virosome-like vesicle may be degraded within the endosome and may be presented to the immune system by MHC class II receptors. An antigen contained within the lumen of a virosome can be delivered to the cytosol of an antigen-presenting cell by membrane fusion and degraded in the cytosol, after which it may be presented MHC Class I antigens. Cross-presentation of antigens delivered by virosomes may also occur.
Therefore, a virosome-like vesicle may be able to induce a humoral and/or a cellular immune response.
In particular, a virosome-like vesicle might induce the production of IgA antibodies, such as secretory IgA, as well as IgG or IgM. Protocols of preparation are well-known by the skilled person in the art. Suitable protocols for the preparation of virosomes are described, for example, in WO 2004/045582 or EP 0 538 437, EP 1 633 395, EP 1594466, which are incorporated herein by reference.
According to an embodiment, a virosome-like vesicle according to the invention may be obtained either from a virosome vesicle as such, or from a vesicle resulting from the fusion of a virosome vesicle with a liposome vesicle.
Preparation of virosome vesicles may be made by any known method of the skilled person in the art such as described by Stegmann et al., EMBO J. 6, 1987, no. 9, 2651-9, or de Jonge et al., Biochim. Biophys. Acta, 1758, 2006, 527-539, incorporated herein by reference. Virosome vesicles, for example, may be reconstituted from original viral membrane lipids and viral membrane glycoproteins after solubilization of, for example, intact influenza virus with octaethyleneglycol mono-N-dodecyl ether (OEG), sedimentation of the nucleocapsid (the viral glycoproteins and lipids will remain in the supernatant), and removal of the detergent from the supernatant with a hydrophobic resin (Bio-Beads SM2) (Stegmann T, et al., EMBO J. 6, 1987 2651-9).
Virosomes may also be reconstituted from original viral membranes by solubilizing viral membranes with a short-chain phospholipid, sedimentation of the nucleocapsid (only the viral membrane glycoproteins and lipids will remain in the supernatant), and removal of the short-chain lipid in the supernatant by dialysis.
After solubilization of the virus with a detergent or short-chain phospholipid, and the removal of the nucleocapsid as described above, antigens or adjuvants, solubilized in detergent or short-chain phospholipid may be added to the supernatant prior to the removal of the detergent or short-chain lipid, leading to incorporation of the antigen or adjuvant in the virosome so formed. Likewise, lipids solubilized in detergent or short-chain phospholipid, may be added to the supernatant for inclusion in the virosomal membrane. Preparation of virosome vesicles containing fusion proteins from different viruses may be performed by mixing supernatants containing solubilized viral membranes as described above, or by adding purified fusion proteins to such supernatant, before said removal of detergent or short-chain lipid.
According to one embodiment, a virosome-like vesicle according to the invention may be obtained from a fusion of a virosome vesicle with a liposome vesicle.
Therefore, according to one embodiment, a virosome-like vesicle of the invention may comprise virosomal and liposomal lipids. According to one embodiment, a virosome-like vesicle of the invention may comprise a lipid bilayer comprising lipids chosen from cationic lipids, synthetic lipids, glycolipids, phospholipids, glycerophospholipids, glycosphingolipids like galactosylceramid, sphingolipids, cholesterol and derivatives thereof.
Phospholipids may comprise in particular phosphatidylcholine, sphingomyelin, phosphatidylethanolamine, phosphatidylserine, phosphatidylglycerol, phosphatide acid, cardiolipin and phosphatidylinositol with varying fatty acyl compositions.
Cationic lipids may be chosen from DOTMA (N-[l-(2,3-dioleylaxy)propyl]-N,N,N-trimethylammonium chloride), DOTAP (N-[l-(2,3-dioleoyloxy)propyl]-N,N,N-trimethylammonium chloride, DODAC (N,N-dioleyl-N,N,-dimethylammonium chloride), DDAB (didodecyldimethylammonium bromide) and stearylamine or other aliphatic amines and the like.
The lipids used in the invention may be formulated as small unilamellar liposomes in a mixture with DOPE (dioleoylphosphatidyl ethanolamine) that is widely used as helper lipid to facilitate disruption of the endosomal membrane.
According to another embodiment, co-emulsifying agent may be also used in order to improve the rigidity and/or the sealing of the vesicles. As an example of co-emulsifying agent, mention may be made of cholesterol and derivatives, as for example cholesterol ester charged or neutral as cholesterol sulphate; derivatives with a sterol backbone, for example derived from plants, such as phytosterol(sitosterol, sigmasterol); ceramides; and mixtures thereof.
Virosomes or their contents may be subject to hydrolysis and physical degradation upon storage. According to one embodiment, virosomes may be preserved for long-term storage by freeze-drying, and reconstituted with an aqueous solution before use. Lyoprotectants such as inulin may be added prior to lyophilization to help preserve virosome integrity during lyophilization and upon reconstitution (Wilschut, J. et al., J. Liposome Res. 17, 2007, 173-182). Preferably, spray freeze-drying is employed (Amorij, J. P. et al. Vaccine 17, 2007, 8707-17).
A virosome-like vesicle of the invention may further comprise a targeting moiety that target said vesicle to a specific cell or tissue.
According to one embodiment, a virosome-like vesicle of the invention may further comprise a targeting moiety that target said vesicle to a specific cell or tissue.
A suitable targeting moiety may be chosen from a cell-surface receptor, a chemokine, a cytokine, a growth-factor, an antibody or an antibody fragment, a peptide sequence with specificity or specific charge complementary to an adhesion molecule such as an integrin. A targeting moiety may be incorporated into, or attached to the lipid bilayer of said vesicle, by any known techniques of the skilled person in the art.
According to one embodiment, the antigen located to the external surface of virosome-like vesicle of the invention may be:
According to one embodiment, the antigen may be contained within the virosome.
Modifications of the antigen of the invention and methods for cross-linking said modified antigen to the external surface of a virosome-like vesicle may be as those described in WO 2004/078099.
According to one embodiment, the antigen may be covalently linked to the external surface of a virosome-like vesicle by cross-linking with a lipid or a phospholipid. According to another embodiment, the antigen may be covalently linked to the external surface of a virosome-like vesicle by cross-linking with a carbohydrate. According to an embodiment, a covalently linked antigen may comprise at least one C-terminally positioned cross-linking residue.
For example, cross-linking residue may be chosen from cysteine (Cys) or lysine (Lys). According to another embodiment a covalently linked antigen may further comprise at least one spacer residue between said C-terminally positioned cross-linking residues and a corresponding C-terminal antigen extremity.
A suitable spacer residue may be chosen, for example, from Gly (glycine), Ala (alanine), Ser (serine), Asp (aspartate), Lys (lysine), Gln (glutamine), His (histidine), He (isoleucine) and Leu (leucine) residues. From 2 to 12, in particular from 3 to 10, and more particularly from 4 to 8, spacer residues may be linked to form spacer sequences. Suitable spacer sequences may be chosen, for example, from Gly-Gly or Lys-Gly.
Cross-linking of the antigen to the surface of a virosome-like vesicle may be, for example, performed by the use of amphiphilic PEG derivatives, a phosphatidylethanolamine (PE), a phosphatidylcholine (PC), a phosphatidylserine, a cholesterol, or a mixture thereof, readily incorporated into lipids bilayer. Cross-linking of the antigen to a lipid of a virosome-like vesicle of the invention may be performed by any method known to those skilled in the art.
The cross-linking may be operated in a lipid solution and the lipid-peptide conjugate may be subsequently incorporated into a virosome-like vesicle.
According to an embodiment of the invention, the antigen may be linked to a lipid of a vesicle of the invention, for example, by a bifunctionnal succinate linker, in particular a [gamma]-maleinidobutyric acid N-hydroxysuccinimide ester or a N4gamma]-maleimidobutyryloxy-succinimide-ester.
Antigens, lipid linked antigens, phospholipids and adjuvants may be added to the supernatant formed after solubilization of a virus with a detergent or short-chain phospholipid, and the removal of the nucleocapsid as described above. Virosomes may be then formed, as previously described, by detergent removal for example using Bio-Beads SM-2 (Biorad), Amberlyte XM, or short-chain phospholipid may be removed by dialysis.
Surprinsingly, any conjugate as previously obtained does not substantially alter the structure/conformation, nor properties, nor function(s), of a polypeptide according to the invention, in particular its capacity to trimerize.
Surprisingly, when dissolved in aqueous medium, said conjugates, and thus said polypeptides, remain in dissolved state and stable. Thus, aqueous compositions comprising said conjugates being dissolved in an aqueous medium are expressly encompassed by the present invention.
According to another of its aspects, the instant invention is directed to a pharmaceutical preparation generally comprising any gp41 polypeptide according to the invention, whatever its chemical/physical form, and/or whatever the pharmaceutical adjuvants or excipients.
In a further embodiment, the pharmaceutical preparation comprises at least as active ingredient a polypeptide according to the invention, or a conjugate as described above, or an expression vector allowing the expression of the polypeptide of the invention.
Such pharmaceutical preparations possibly comprise an aqueous composition according to the invention. A variety of aqueous media may be used, for pharmaceutical purposes according to the invention, e.g., water, buffered water, 0.4% saline, 0. 3% glycine, hyaluronic acid and the like. A pharmaceutical preparation may be sterilized by conventional, well-known sterilization techniques, or may be sterile filtered.
The pharmaceutical preparations according to the invention may be packaged for use as are, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration. A pharmaceutical preparation according to the invention may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH adjusting and buffering agents, tonicity adjusting agents, wetting agents and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, among many others.
A pharmaceutical preparation of the invention may comprise a polypeptide or a trimer thereof or a conjugate thereof and an additional gp41-derived antigen in an effective amount for treating the patient in need thereof. Said additional gp41 antigen being distinct from the polypeptide of the invention. In a more specific embodiment, said additional antigen is in the form of a conjugate and even more particularly linked to a virosome.
An effective amount is that amount of polypeptide or conjugate according to the invention that alone, or together with further doses can stimulate the desired response. An effective amount depends upon a variety of factors, such as the route for administration, whether the administration is in single or multiple doses, and individual patient parameters including age, physical condition, size, weight, and the stage of the disease. These factors are well known to those of ordinary skill in the art and can be addressed with no more than routine experimentation. Therefore, according to an embodiment, a pharmaceutical preparation may comprise polypeptides or a trimer thereof or a conjugate thereof of the invention alone or in combination with at least one adjuvant, as previously described.
Said antigen is distinct/different from the one or those of rgp41 according to the invention. Said antigen is also distinct form the one or those, in particular HA, comprised in said virosomes.
An additional antigen is for instance any part of the gp41 protein, as well as the gp41 protein, distinct/different from the fragments 540-592 and 618-664, the numbering scheme being based upon the prototypic isolate HIV-1 HxB2 clade B in its whole, and analogues thereof.
Said additional antigen may originated from any HIV-1 clade, in preferred embodiments, said additional antigen originates from clade B or clade C gp41.
According to an embodiment, a gp41-derived antigen suitable as an additional antigen for the invention is devoid of fusogenic property with respect to cell membrane of target cells.
According to one embodiment, said gp41-derived antigen is covalently linked to the external surface of a virosome-like vesicle as previously described in relation to the conjugates according to the present invention comprising virosomes or virosomes-like particles.
According to an embodiment, said gp41-derived antigen is a peptide called P1. The peptide P1 corresponds to an amino acid sequence present in the HIV envelope protein ectodomain gp41 that is located at the surface of the viral particles before the virus interacts with target cells. As example, in the HIV-I HxB2 strain, this sequence is comprised from amino acid 649 to amino acid 683, the numbering scheme being based upon the prototypic isolate HIV-1 HxB2 Clade B strain
In a preferred embodiment, said P1 peptide is described in all or part by a sequence chosen from SEQ ID NO 2, SEQ ID No. 3, SEQ ID No. 6 or an analogue thereof as described in WO2007/099446, the content of which is incorporated by reference.
As example of a P1 antigen suitable for the invention, it may be envisioned that the peptide P1 sequence comprising an addition of a three amino acids L-G-C or of a L-S-C spacer at the C-terminal position, as, for example, set forth as SEQ ID NO 4 or SEQ ID No. 5.
In a particular embodiment, the pharmaceutical preparation of the present invention is used in immunotherapy, in particular prophylactic immunotherapy.
A pharmaceutical preparation of the invention comprises a polypeptide or a conjugate of the invention in an effective amount for treating the patient in need thereof.
In a further embodiment, the pharmaceutical preparation as defined above can be used in immunotherapy, in particular prohylactic immunotherapy.
According to another embodiment, a pharmaceutical preparation according to the invention may comprise an additional antigen distinct from said polypeptide or said conjugate according to the invention as a combined preparation for simultaneous, separate or sequential use in immunotherapy.
According to another of its aspects, the instant invention is also related to a use of at least one gp41 polypeptide, a conjugate or an expression vector in accordance with the instant invention for the manufacture of a medicament intended to induce an adaptative immune response and/or an innate immune response directed against a gp41 protein of a human immunodeficiency virus (HIV).
In a preferred embodiment, the gp41 used polypeptide is represented by SEQ ID No. 19 or SEQ ID No.20 are linked to a virosome.
In a further embodiment the invention is drawn to the use of one polypeptide, a trimer, an expression vector or a conjugate according according to the invention and of an additional antigen additional antigen in the form of a conjugate said conjugate being more preferably a virosome for the manufacture of a medicament intended to induce an adaptative immune response and/or an innate immune response directed against a gp41 protein of a human immunodeficency virus, said additional antigen additional antigen being more preferably described by SEQ ID No 2, SEQ ID No 3, SEQ ID No 4, SEQ ID No 5 or SEQ ID No.6
Such pharmaceutical preparations may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, antioxidants, preservatives, compatible carriers, adjuvants as described below and optionally other therapeutic agents.
Adjuvants
According to an embodiment, the immunostimulatory effect of polypeptide or of the conjugate of the invention is obtained, possibly increased by associating those polypeptide or conjugate with at least one adjuvant.
According to an embodiment, the immunostimulatory effect of virosome-like vesicles of the invention may be further increased by associating those virosome-like vesicles with at least one adjuvant.
Said adjuvant may be encapsulated inside and/or incorporated in the lipid bilayer of, and/or freely combined with said vesicle.
According to one embodiment, a virosome-like vesicle may additionally comprise at least one adjuvant enhancing and/or mediating an immune response chosen from an innate immune response and/or an adaptative immune response. Usable adjuvants may enhance the immunological response by activating antigen presenting cells (APC), macrophages and/or stimulating specific sets of lymphocytes.
An adjuvant that may convene to the instant invention may be any ligand suitable for the activation of a pathogen recognition receptor (PRR) expressed in and on dentritic cells (DCs), T-cells, B-cells or other antigen presenting cells.
Ligands activating the nucleotide-binding oligomerization domain (NOD) receptor pathway may be suited for the purpose of the invention. Adjuvants suitable for these ligands may be muramyl dipeptide derivatives. Ligands activating the Toll-like receptors (TLRs) may also convene for the purpose of the invention. Those receptors are member of the PRR family and are widely expressed on a variety of innate immune cells, including DCs, macrophages, mast cells and neutrophils.
As example of ligands activating TLR, mention may be made, for TLR4 of monophosphoryl lipid A, 3-O-deacytylated monophosphoryl lipid A, LPS from E. coli, taxol, RSV fusion protein, and host heat shock proteins 60 and 70, for TLR2 of lipopeptides such as N-palmitoyl-S-2,3(bispalmitoyloxy)-propyl-cysteinyl-seryl-(lysil)3-lysine, peptidoglycan of Staphylococcus aureus, lipoproteins from M. tuberculosis, Sacharomyces cerevisiae zymosan, and highly purified P. gingivalis LPS, for TLR3 of dsRNA, for TLR5 of flagellin, for TLR7 synthetic compounds such as imidazoquinolines or for TLR9 of certain types of CpG-rich DNA. Other useful adjuvants for the invention may be T helper epitopes.
A T helper epitope is a peptide usually derived from exogenous proteins that have undergone proteolytic degradation and processing within the endocytic pathway of antigen presenting cells (APCs). In those cells the Major Histocompatibility Complex of class II (MHC II) associates with those peptides in endosomes. This complex transported to the surface of the APCs may interact with a specific T cell receptor of T lymphocytes CD4 leading to their activation. According to the helper epitope, the T cell response may be of Th1 and/or Th2 type, as known in the art.
As an example of a Th-oriented response epitope one may mention pan DR helper T cell epitope (PADRE). This epitope is engineered to bind most common HLA-DR molecules with high affinity and to act as a powerful immunogen. The PADRE HTL epitope has been shown to augment the potency of vaccines designed to stimulate a cellular immune response (Alexander J. et al., Immunol Res. 18, 1998, 79-92).
According to an embodiment, an adjuvant that may be used with the virosome-like vesicles of the present invention may be chosen from aluminum salts, aluminum phosphate gels, mycobacteria such as BCG, M. Vaccae, or corynebacterium parvum, peptides, keyhole limpet hemocyanin, interleukin-2 (IL-2), IL-12, GM-CSF, ligands from the chemokine family, such as RANTES (Regulated upon Activation Normal T cell Expressed and Secreted), a lipoprotein of Gram bacteria, a yeast cell wall component, a double-stranded RNA, a lipopolysaccharide of Gram<“>bacteria, flagellin, a U-rich single-stranded viral RNA, a CpG containing DNA, a Suppressor 6f Cytokine Signalling small interfering RNA (SOCS siRNA), mellitin derived peptides, a pan DR epitope (PADRE) and mixtures thereof.
Such preparations may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, antioxidants, preservatives, compatible carriers, adjuvants as previously described and optionally other therapeutic agents.
In one embodiment, a polypeptide or a conjugate according to the invention may be used for the preparation of a pharmaceutical preparation to be administered in the form of a vaccine. Any immunization protocol standard in the art may be used. As such an antigenic or immunogenic composition according to the invention comprises a polypeptide, a conjugate or a trimer according to the invention.
Pharmaceutical preparations according to the invention comprising thereof may be administered systematically by injection or topically by a mucosal route, or a combination thereof.
Injection route may be, for example, intraperitoneal, intradermal, subcutaneous intravascular or intramuscular route.
Any mucosal route may be used, such as genito-urinary route as for example vaginal route, gastro-intestinal route, anorectal route, respiratory route, upper mucosal tissue, mouth-nasal route and mixtures thereof.
In one embodiment, a pharmaceutical preparation of the invention is provided as oral dosage forms, such as tablets, capsules (each including timed release and sustained release formulations), pills, powders, granules, elixirs, tinctures, solutions, suspensions, syrups and emulsions.
All of these forms are well known to those of ordinary skill in the pharmaceutical art.
According to an embodiment, an object of the invention is to induce with a polypeptide according to the invention, or a conjugate thereof a human systemic IgA and IgG immune response and/or mucosal IgA and IgG immune response against the HIV virus. Mucosal IgA may be a mixed between systemic IgA and secretory IgA response. According to another embodiment, an object of the invention is to inhibit or reduce HIV transcytosis, in particular at musosal level such as the genito-urinary tract, the gastro-intestinal tract, the anorectal route, the respiratory tract, upper mucosal tissues, mouth-nasal route, and combinations thereof.
Within the meaning of the invention, the expression “adaptative immune response” is intended to refer to an immune response relying upon the activation of the immune system component, implying specificity and memory with respect to an antigen or a pathogen.
Such a response may be highly specific toward an antigen or a pathogen and is more effective on second and subsequent encounter, with the antigen or pathogen. Such adaptative immune response may rely on the activation of lymphocytes, such as T-cells or B-cells.
Within the meaning of the invention, the expression “innate immune response” is intended to refer to a response relying upon the non-specific recognition system and does not alter upon subsequent encounter with the antigen or pathogen.
Such system may rely upon immune cells such as, for example, monocytes macrophages or natural killer (NK) or natural killer T (NKT) cells.
According to an embodiment, polypeptides or conjugates according to the invention may be used for the preparation of a medicament intended to induce an adaptative immune response and/or an innate immune response directed against a gp41 protein of a human immunodeficiency virus.
According to another of its aspects, the instant invention is also directed to a method of treatment and/or prophylaxis against a HIV infection comprising at least a step of administration to an individual in need thereof of an effective amount of a gp41 polypeptide of the present invention, a trimer or a conjugate thereof, or an aqueous composition as previously defined, all in accordance with the present invention.
According to one embodiment of the method of treatment and/or prophylaxis of a HIV infection, the polypeptide or conjugate in accordance with the invention is administered by injection and/or topically by the mucosal route, or a combination thereof as previously indicated.
Said mucosal route is chosen from genito-urinary tract, gastro-intestinal tract, anorectal route, respiratory tract, upper mucosal tissue, mouth-nasal route and combinations thereof.
In a more specific aspect, within the method of the invention, the polypeptide is administered in combination with an additional antigen distinct from said gp41-derived antigen as described above. As such, the preferred method comprises at least the step of administering at least a first gp41-derived antigen as described by SEQ ID No.19 or SEQ ID No.20 or an analogue thereof, and a second gp41-derived antigen as described by SEQ ID No.4 or SEQ ID No.5 or an analogue thereof.
According to another aspect, the instant invention also relates to a kit for inducing an immune response against a gp41 protein of a human immunodeficiency virus comprising at least a first gp41-derived antigen in the form of a conjugate said conjugate being more preferably a virosome virosome like vesicle of the invention and at least a second gp41 dervied antigen in the form of a conjugate said conjugate being more preferably a virosome virosome like vesicle of the invention, said first and second gp41-derived antigens being different from each other. According to a preferred embodiment the first gp41-derived antigen is a peptide described by SEQ ID No.19 or SEQ ID No.20 or an analogue thereof, the second gp41-derived antigen is a peptide described by SEQ ID No.4 or SEQ ID No.5 or an analogue thereof.
The instant invention will be further understood with the following examples which are presented for illustrating purposes and should not be interpreted as limiting the scope of the instant invention.
Panel B: Viremia in monkeys vaccinated with virosomes gp41-derived antigens from clade B (Group 3 of example 6) and challenged with SHIV clade C, with strain SHIV1157ipd3N4. Eighteen months after the fourth vaccination, animals received a boost and five week later they were challenged intravaginally 10 times with 10-20 TCID50. The plasma viral load is indicated by the lines for individual animals; note the detection limit is 103 copies per mL.
a) First Step: Construction of gp41-dloop (SEQ ID No.27)
The gp41-delta loop was constructed by PCR.
The oligonucleotide primer gp41-Nde (SEQ ID No.22.) and the oligonucleotide primer gp41-Bam1 (SEQ ID No.23) were used to amplify the N-helix and introduce the hydrophilic linker). These oligonucleotide primers were designed to respectively introduce the sites for restriction enzymes NdeI and BamHI. The oligonucleotide primer gp41-Bam1 was also designed to introduce the oligopeptide linker SGGRGGS (SEQ ID No.16) to replace the deleted portion of loop.
The oligonucleotide primer gp41-Bam2 (SEQ ID No.24) and the oligonucleotide primer gp41-XhoI (SEQ ID No.25) were used to amplify the C-helix of gp41 by PCR. Those oligonucleotide primers were designed to introduce the BamHI and the Xho1 enzyme restrictions sites, respectively.
The gp41dloop polynucleotide was amplified from the gp41 matrix (SEQ ID No.26) by PCR using the above-described oligonucleotide primers. Plasmid was used at 0. 5 μg/μl primers were used at 10 μM each, and dNTP were used at 10 mM each. The amplification was conducted using the DNA polymerase DyNazyme from Finnzymes. The amplification was initiated with a denaturing step of 5 minutes at 94° C., following by 30 cycles, each comprising a one minute step at 94° C. (denaturing step), a one minute step at 60° C. (hybridization), and a one minute step at 72° C. (elongation), and the amplification was terminated by a last step of 10 minutes at 72° C. The purified PCR products were digested by NdeI (Ozyme, R0111S) and XhoI (Ozyme, R0146S) for insertion in pET21b. The pET21b vector (Novagen) digested by NdeI and XhoI and the PCR products were extracted and purified. Ligation was made using Quick ligation kit (New England Biolabs) according to the manufacturer prescription resulting in pET21b-gp41dloop.
pET21b-gp41dloop products were transformed in DH5-alpha (Invitrogen).
b) Second Step: Construction of M0gp41C-dloop Clade B (SEQ ID No.28) Encoding M0 Polypeptide (rgp41 According to the Invention)
Two PCRs were performed on the matrix GP41dloop (SEQ ID No.27) to obtain the M0gp41C_CladeB construct using the Phusion polymerase (Finnzymes). The first reaction was carried out with the primers: GP41B-C-D1 (SEQ ID No. 29) and GP41B-C-R2 (SEQ ID No. 30)
The second reaction was performed with the primers: GP41B-C-D1 (SEQ ID No. 29) and GP41B-C-R1 (SEQ ID No. 31).
The positive PCR products were digested using NdeI (Ozyme, R0111S) and XhoI (Ozyme, R0146S) restriction enzymes for the insertion of the Gp41C_CladeB encoding gene into pET30b (VWR, 69910-3). The pET30b vector was digested using NdeI and XhoI restriction enzymes (Ozyme). The DNA fragments corresponding to Gp41C_CladeB gene and pET30b were extracted and purified (using extraction kit from Macherey-Nagel, 740 609 250). Ligation of these two fragments was done using the Quick ligation kit (New Englands Biolabs Inc, M2200S). 1 μl of the ligation mixture was used to transform E. coli DH5-alpha (Invitrogen, 12297-016). Transformants were isolated on LB Agar plates with 30 μg/mL kanamycin. Isolated colonies were inoculated in 4 mL of LB medium supplemented with 30 μg/mL kanamycin. Cultures were performed overnight at 37° C. and 180 rpm. DNA extraction from the corresponding pellets was performed according to the protocol given in the Nucleospin Plasmid extraction kit from Macherey-Nagel, Ref. 740588-250. They were analyzed by restriction enzyme digestion and the inserts were sequenced using T7prom (SEQ ID No.32) and T7term (SEQ ID No.33) primers.
The complete nucleotide sequence of M0gp41dloop-C CladeB was determined and is represented by SEQ ID No. 28
c) Third Step: Construction of M1gp41C-dloop Clade B (SEQ ID No. 21) Encoding M1 Polypeptide (rgp41 According to the Invention)
The M1gp41C-dloop clade B was constructed by PCR. Two PCRs were performed on the matrix Gp41dloopC_CladeB (SEQID No. 28) to obtain M1gp41C-dloop clade B. using the Phusion polymerase (Finnzymes).
The first reaction was done with the primers: GP41B-C-D1 (SEQ ID No. 29) and GP41-C3-R1 (SEQ ID No. 34).
Before the second PCR reaction, purification was done using the nucleospin extract kit (Macherey Nagel, 740609250) with the following primers: GP41B-C-D1 (SEQ ID No. 29) and GP41-C3-R2 (SEQ ID No.35).
The positive PCR products were digested using NdeI (Ozyme, R0111 S) and XhoI (Ozyme, R0146S) restriction enzymes for the insertion of the M1gp41dloop-C CladeB encoding gene into pET30b (VWR, 69910-3). The pET30b vector was digested using NdeI and XhoI restriction enzymes (Ozyme). The DNA fragments corresponding to M1gp41dloop-C CladeB gene and pET30b were extracted and purified (using extraction kit from Macherey-Nagel, 740 609 250). Ligation of these two fragments was done using Quick ligation kit (New Englands Biolabs Inc, M2200S). 1 μl of the ligation mixture was used to transform E. coli DH5-alpha (Invitrogen, 12297-016). Transformants were isolated on LB Agar plates with 30 μg/mL kanamycin. Isolated colonies were inoculated in 4 mL of LB medium supplemented with 30 μg/mL kanamycin. Cultures were performed overnight at 37° C. and 180 rpm. DNA extraction from the corresponding pellets was performed according to the protocol given in the Nucleospin Plasmid extraction kit from Macherey-Nagel, Ref. 740588-250. They were analyzed by restriction enzyme digestion and the inserts were sequenced using T7prom (SEQ ID No.32) and T7term (SEQ ID No.33) primers.
The complete nucleotide sequence of M1gp41dloop-C CladeB was determined and is represented by SEQ ID No.21.
pET30b-M0gp41dloop-C Clade B or pET30b-M1gp41dloop-C Clade B plasmid was transformed in the expression E. coli strain BLR (DE3). The expression of M1gp41dloop-C and M0gp41dloop-C Clade B was driven by a T7 promoter.
b) Expression tests Six cultures of E. coli strain BLR (DE3) carrying the pET30b-M1gp41dloop-C CladeB or pET30b-M0gp41dloop-C Clade B plasmid were grown at 37° C. in Luria Broth with 30 mg/ml kanamycin until the optical density at 600 nm reached 0.6 (spectrophotometer Jasco V-530). The modified polypeptide was induced with 1 mM IPTG (isopropyl BD-thiogalactoside), and the culture continued for further 2 hours at 37° C. Expression of proteins was checked by separation on SDS-4-12% PAGE.
1) Culture One liter of culture of BL21 (DE3)/pET30b-M1gp41dloop-C CladeB or (DE3)/pET30b-M0gp41dloop-C CladeB was grown in Luria Broth at 37° C. until the optical density at 600 nm reached the value of 6.0. The expression of gp41-engineered loop was induced by 1 mM IPTG, and the culture continued for a further 2 hours at 37° C. The culture was centrifuged (Centrifuge Beckman Coulter Avanti J20XP with rotor JLA 8-1000, 4000×g, 30 min, 4° C.) and the pellet was stored at −80° C.
2) Extraction of M0 or M1 rgp41 Modified Polypeptides
The pellet was resuspended with a sonication buffer (40 mL of Tris-HCl 50 mM pH8, NaCl 300 mM). Bacteria were disrupted by a 15 min sonication step on ice/ethanol (disintegrator UP200S amplitude 80%, coefficient 0.5). Then the suspension was centrifuged at 40 000×g during 30 min at 4° C. to separate the soluble proteins (supernatant) from the insoluble proteins (pellet) (Centrifuge Beckman Coulter Avanti J20XP with rotor JA20).
d) Purification of M1 rgp41 Modified Polypeptide
A first step of purification of M1 (encoded by M1gp41dloop-C CladeB, SEQ ID No. 21) was performed by affinity chromatography on Ni Sepharose™ 6 Fast Flow media packed into a XK16/20 column (GE Healthcare) with a column volume of 1 mL of medium per 1 L of culture in flasks. The specific spacer peptide S allowed the use of an affinity chromatography step as capture step to recover the soluble fraction of M0 or M1. This was relevant because of the low productivity of the protein. The column was equilibrated with a buffer Na-Phosphate 50 mM pH7.5, NaCl 300 mM, β-mercaptoethanol 5 mM. Clarified samples of M1 polypeptide in Na-Phosphate 50 mM pH7.5, NaCl 300 mM, β-mercaptoethanol 5 mM, MgCl2 2 mM, Leupeptine and Pepstatine 0.1 mM was loaded onto the column at 2 ml/min. The column was then washed with equilibration buffer and elution steps at 25 mM, 50 mM and 150 mM Imidazole. M1 gp41 was eluted with a buffer Na-Phosphate 50 mM pH7.5, NaCl 300 mM, β-mercaptoethanol 5 mM, Imidazole 300 mM at 4 mL/min. Tween®20 at a final concentration of 0.05% was added on pooled fraction affinity chromatography and a dialysis was performed overnight at 4° C. under slow magnetic agitation against buffer Na-Phosphate 50 mM pH7.5, NaCl 300 mM, TCEP 1 mM, Tween20 0.05%. Samples were then concentrated 3 times by centrifugation on an Amicon 10 kDa concentration unit (Millipore).
2) Size Exclusion ChromatographyA second purification step of M1 was performed by Size Exclusion Chromatography using Superdex™ 200 Prep grade media packed into a XK26/60 column (GE Healthcare) with a column volume of 320 ml. The column was equilibrated with a buffer Na-Phosphate 50 mM pH7.5, NaCl 300 mM, TCEP 1 mM, Tween20 0.05%. M1 in Na-Phosphate 50 mM pH7.5, NaCl 300 mM, TCEP 1 mM, Tween20 0.05% was loaded onto the column at 1.5 ml/min and eluted with the equilibration buffer at 2.5 mL/min. According to the calibration curve the protein was eluted as soluble trimers. Therefore, the presence of the spacer comprising the cysteine residue at the C-terminal part of M1 or M0 does not modify the conformational state of the protein.
Four proteins were spotted on a nitrocellulose membrane: wt gp41-HA (the native gp41 fused to an HA tag (GenBank AF348176) in Tris 50 mM pH 8, NaCl 200 mM, Triton X-100 0.1%, 0.1 mg/ml, Gp41-delta loop (SEQ ID No. 38) which differs from the native gp41 fragment of
The membrane was incubated at 37° C., and then put in 20 ml of PBS Tween 0.3%, 5% milk for one additional hour under agitation. The 98.6 D (an anti-GP41 human monoclonal antibody from NIBSC, UK) and AF-202 (an anti-human-IL-2 antibody from R & D systems) antibodies were added at a final concentration of 0.05 μg/ml or 0.5 μg/ml respectively, in 20 ml of PBS/Tween 20 0.3% -5% milk for one hour with agitation. An appropriate concentration of anti-IgG peroxidase coupled antibody was added in 20 ml of PBS Tween 0.3%, milk 5% with agitation for one hour, and the blot was washed three times for 15 minutes each in PBS Tween 0.3%. The two peroxidase activity was then revealed with with a commercial enhanced chemiluminescence kit (Amersham) and a Kodak film was exposed to the blot, as known in the art.
As shown in
Cultures of E. coli expressing the gp41 polypeptide according to the invention were centrifuged at 4 000 g at 4° C. during 15 min. Pellets were suspended in a volume of lysis buffer: phosphate 50 mM pH 7.5, NaCl 300 mM, MgCl2 2 mM, beta-mercaptoethanol 5 mM, benzonase 1 microM, pepstatine 1 microM, leupeptine 1 microM to reach OD 600 nm=10. The solution was incubated at 4° C. for 30 minutes. Cell lysis was performed by three cycles of freezing/thawing. Soluble and insoluble proteins were separated by a 30 min centrifugation at 21 000 g at 4° C. Ten microliters of proteins were analyzed to determine the expression and solubility level by SDS-PAGE 4-12% electrophoresis followed by Coomassie blue staining. The rgp41 polypeptide was found to be present in the supernatant. Therefore, the protein is soluble.
Virosome-like vesicles were prepared essentially as as described in WO 2007/099387. Briefly, influenza A/Singapore/6/86 virus was grown in embryonated eggs and inactivated with beta-propiolacton as known in the art. The virus was dissolved in 100 mM of octaethyleneglycolmonodecylether (OEG) in phosphate buffered saline (PBS), and the viral nucleocapsid removed by ultracentrifugation. The solubilized membranes, containing 4 mg of hemagglutinin, were mixed with 32 mg egg phosphatidylcholine (PC) and 8 mg of phosphatidylethanolamine (PE) dissolved in 2 ml of PBS containing 100 mM OEG. The phospholipids and the hemagglutinin containing solution as described above were mixed and sonicated for 1 min. This solution was centrifuged for 1 hour at 100 000 g and the viral membrane preparation/lipid mixture was sterilized by filtration.
A polypeptide of the present invention, comprising a spacer and a cysteine residue at the C-terminal position (SEQ ID NO 19) was conjugated through a maleimido-succinimide linker at the N-terminus to a regioisomer of phosphatidylethanolamine (PE) as follows.
Phosphatidylethanolamine (PE) was dissolved in methanol and 0.1% (v/v) triethylamine was added. The solution was then mixed with the heterobifunctional cross-linker N-[gamma]-maleimidobutyryloxy-succinimide-ester (GMBS), (Pierce Chemical Company, Rockford, Ill.) (ratio PE: GMBS=5:1) which was previously dissolved in dimethylsulfoxide (DMSO) (20 μl). After incubation for 30 minutes at room temperature, the solvents were evaporated for 1 h under vacuum in a speedvac centrifuge. The GMBS-PE was then dissolved in 1 ml of PBS containing 100 mM octaethyleneglycol (OEG) (Fluka Chemicals, Switzerland), (PBS-OEG) and the polypeptide of the present invention comprising segment S with a cysteine residue at the C-terminal position (SEQ ID NO 19), was added (ratio PE-GMBS:polypeptide=5:1). At this step, the maleimide of the phosphatidylethanolamine-GMBS reacts with the sulfhydryl of the free C-terminal cystein of the gp41 polypeptide. After in incubation time of 30 minutes, excess free cystein was added, in order to quench any remaining free GMBS (ratio Cystein:GMBS=10:1).
The lipid-conjugated polypeptide was added to the hemaggglutinin-containing viral membrane preparation/lipid mixture as described above at a ratio of 1 mg of rgp41 per mg of hemagglutinin, and rgp41-virosomes were formed by detergent removal on SM-2 BioBeads (BioRad, Glattbrugg, Switzerland).
Likewise, the lipid-linked synthetic peptide P1 which aminoacid sequence corresponds to SEQ ID No. 5 (SQTQQGKNEQELLELDKWASLWNWFDITNWLWYIKLSC (carboxymethyl(1,3-dipalmityol-glycero-2-phophatidylethanolamino))-O H was synthesized as the TFA salt SQTQQGKNEQELLELDKWASLWNWFDITNWLWYIKLS-hydroxylcysteine by solid-phase Fmoc chemistry as known in the art, and linked to phosphatidylethanolamine via its C-terminal hydroxylcysteine using bromoacetyl-phosphoshatidylethanolamine. After purification by preparative HPLC, and ion exchange to produce its acetate salt, the peptide was lyophilized, dissolved in PBS-OEG was mixed with the viral membrane preparation/lipid mixture, at a ratio of 5 mg P1 per mg of viral hemagglutinin, and P1-virosomes were formed by detergent removal.
Immunization of macaques with a vaccine composition comprising virosome-like vesicles with rgp41 polypeptide as described above as well as virosome-like vesicles with gp41 derived antigen peptide P1 located at the external surface was carried out as follows.
Three groups of 5 female macaques with an average age of about 5 years were used. Four weeks before the first administration of vaccine, all macaques received intramuscular injections of beta-propiolacton inactivated influenza A Singapore 6/86 (100 μl, 0,01 mg/ml). Thereafter, macaque vaccinations with virosome-like vesicles in aqueous solution (40 μg of P1-virosome and 40 μg of rgp41-virosome, 100 μl) were carried out in week 0, 7, 15 and 24. Group 1 (monkeys G1.1 to G 1.6) received influenza virosomes without gp41 antigens (placebo). Group 2 (G2.1-2.6) received four intramuscular vaccinations with both P1-virosomes and gp41-virosomes at every vaccination, and group 3 (G3.1-3.6) two intramuscular vaccinations (week 0 and 7) followed by two intranasal vaccinations (week 15 and 24), administered as a spray, each time with both P1-virosomes and gp41-virosomes. One animal in group 3 (3.2) died for reasons unrelated to vaccination.
Serum samples were taken at each vaccination time point.
The level of total IgG and IgA antibodies in serum was determined according to the following ELISA protocol. Peptide P1 (SEQ ID NO 5) 100 ng/100 μl/wells, or rgp41 of the invention (SEQ ID No. 19, 100 ng/100 μl/well) in a bicarbonate buffer 50 mM, pH 9.6 was used to coat ELISA plates (Nunc) overnight at 4° C. Plates were saturated with BSA 2% PBS Tween 0.1% for 1 hour 37° C., then washed with PBS-Tween 0.1% buffer. Serums diluted 1/300 for IgA or 1/200 for IgG with PBS Tween 0.1% were incubated overnight at 4° C. Plates were thereafter rinsed with PBS-Tween 0.1% buffer. For detection of macaque IgG, an anti-macaque IgG goat antibody couple to biotin (Rockland) (1/15 000) was used followed with an incubation with streptavidine-HRP (Immunotech) diluted 1/50 000.
For the detection of macaque IgA, an anti-macaque IgA goat antibody coupled to biotin (Rockland) 1/15 000) was used followed with an incubation with streptavidine-HRP (immunotech) diluted 1/50 000.
A 2F5-IgA monoclonal antibody was used as positive control, followed with an incubation with an anti-human IgA biotin-labelled goat Fab′2, (0.14 μg/ml final) (Caltag H 14015) and revealed with streptavidine-HRP (1/50,000). A 2F5-IgG monoclonal antibody was used as positive control, followed with a biotinylated anti-human IgG goat Fab′2 (0.1 μg/ml final) (Rockland 609106123) and revealed with streptavidine-HRP (1/50,000).The antibodies were incubated for 1 hour at 37° C. Colorimetric reaction was triggered by addition of the substrate TMB, and stopped by addition of H2PO4 1 M. The optical density (OD) was read at 450 nm.
The results are illustrated in
To investigate whether vaccination had induced mucosal immunity, cervico-vaginal samples were obtained from all the vaccinated animals of example 6 at week 24, by introducing 3 ml of PBS containing antibiotics and protease inhibitors. The samples were centrifuged to remove debris, aliquoted, immediately snap-frozen and stored at −80° C. Mucosal P1 antibodies were determined by the ELISA as described above, while clade B anti-gp41 antibodies were determined according to Tudor et al., 2009, Mucosal Immunol. 2, 412-426. The results were expressed as the number of animals having antibody concentrations two times the standard deviation, and compared to the results of serum antibody determinations, expressed in a similar fashion (table I). The serum from monkey 3.2 was excluded from analysis.
Additionally, it was observed that the IgA and IgG antibodies were also induced in the genital tract, while IgA was detected in the intestinal compartiments, even after vaccination by intramuscular injection in the absence of mucosal adjuvant.
The monkeys of example 6 were challenged with live virus as follows: Four weeks after the last vaccination, animals were challenged intra-vaginally 13 times, every 4 to 7 days, with low doses (20-30 TCID50) of SHIVSF162P3, as shown in
As shown in
To investigate whether vaccination had induced mucosal immunity, cervico-vaginal samples obtained as described in Example 6, were analyzed by HIV-1 transcytosis inhibtion assays, performed as previously described (Bomsel et al., 1997. Nat. Med. 3: 42-47). HIV-I transcytosis across epithelial cells and the neutralization of transcytosis by antibodies were investigated on the intestinal cell line HT 29 grown as a tight, polarized monolayer for 7 days on a permeable filter support (0.45 μm pore size) forming the interface between two independent chambers, the upper one bathing the apical (luminal) surface of the epithelial monolayer and the lower one bathing the basolateral surface. Prior to transcytosis experiments, epithelial cells were washed, and further incubated in RPMI 1640, glutamine, 10% FCS. Cervico-Vaginal Secretion (CVS) samples (1/12 and 1/6 dilution) from Group 1 (placebo) or Group 3 (W24; i.m.+i.n.—see example 7 above) were pre-incubated with HIV-1 infected cells (1×106 HIV-1 93BR029 virus (HIV1 clade B) or with 92BR025 virus (HIV1 clade C)+PBMCs (Day 7 post infection of activated PBMCs from healthy individuals with infected with either JRCSF or primary viruses) for 20 min. at RT. Then, HIV-1 infected cells pre-incubated were added to the apical chamber. Contact between HIV-1 infected cells and the epithelial cell monolayer resulted in rapid budding of the HIV-1-virions, followed by HIV particle internalization and transcytosis from the apical to the basolateral side of the epithelial cell monolayer. After 2 h, inhibition of transcytosis by CVS was determined by detection of p24 in the basolateral medium by commercial ELISA (Coulter, Villepinte, France). During the 2 hrs of infected cell contact with epithelial cells, the barrier function of the epithelial monolayer remains intact, precluding penetration of HIV-1 infected cells in the monolayer or translocation of HIV infected cells in the basolateral chamber (1). The HIV-1 transcytosis results are shown in
Samples of the cervico-vaginal secretions harvested from the animals as described in example 8, were depleted of IgA by incubation with biotinylated-anti macaque IgA antibodies, as follows. Biotinylated anti-human IgA (Caltag, france) was bound to streptavidin-agarose (Pierde, France) in a 1:3 weight ratio, and the coupled beads were washed to remove unbound biotinylated anti-IgA. 30 μl of beads were rotated overnight at 4° C. with CVS (1:6 dilution), and centrifuged for 10 min at 1000 g. The resulting supernatant was collected and assayed followed by an incubation with streptavidin-agarose beads,(Pierde, France) and a centrifugation to remove the beads. These IgA-depleted samples were then tested in a transcytosis assay using clade B 93BR029 virus, as described in example 8, and compared to samples without IgA depletion. As shown in
Since in vitro cross-clade transcytosis inhibition was observed in assays, as indicated above, it was decided to challenge the monkeys from group 3, example 6 (intranasal and intramuscular vaccination with clade B based virosomes) with a clade C virus. One year after their last vaccination with the virosomes, the monkeys were still seronegative. They were revaccinated once by intramuscular injection as described in Example 6, and five weeks after vaccination they were challenged 10 times, at 4-7 day intervals, with 10-20 TCID50 of SHIV1157ipd3N4 (Clade C, tropism R5, kindly provided by Dr. Ruth Ruprecht, Dana Farber Cancer Institute, USA), At each vaccination time point, blood samples were taken to determine viremia. Blood samples were taken every 4-7 days for 60 days thereafter (
These surprising data provide clear evidence for cross-clade protection in vivo.
| Filing Document | Filing Date | Country | Kind | 371c Date |
|---|---|---|---|---|
| PCT/EP10/51522 | 2/8/2010 | WO | 00 | 8/19/2011 |
| Number | Date | Country | |
|---|---|---|---|
| 61202215 | Feb 2009 | US |