Claims
- 1. An isolated and purified protein with a molecular weight of 110 to 114 kilodaltons wherein said polypeptide is a product of a retinoblastoma gene.
- 2. The protein of claim 1, wherein the protein is a phosphoprotein.
- 3. The protein of claim 1 which has an amino acid sequence consisting of:
- MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPE - QDSGPEDLPLVRLEPEETEEPDFTALCQKLKIPDHVRERA - WLTWEXVSSVDGVLGGYIQKKKELWGICIFIAAVDLDEMS - PTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSRLLKK - YDVLFALPSKLERTCELIYLTQPSSSISTEINSALVLKVS - WITFLLAKGEVLQMEDDLVISFQLHLCVLDYFIKLSPPHL - LKEPYKTAVIPIHG8PRTPRRGQMRSARIAKQLENDTRII - EVLCKEHECNIDEVKNVYFKNFIPFMNSLGLVTSNGLPEV - ENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDSFETQ - RTPRKSNLDEEVNVIPPHTPVRTVMVTIQQLMMILHSASD - QPSEHLISYFNNCTVNPKESILKRVKDIGYIFKEKPAKAV - CQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFS - KLLNDNIPHMSLLACALEVVMATYSRSTSQNLDSGTDLSF - PWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCZ - HRIMESLAWLSDSPLFDLIXQSKDREGPTDHLESACPLHL - PLQNNHTAADMYLSPVRSPKKKGSTTRVNSTANAETQATS - AFQTQKPLKSTSLSLPYKKVYRLAYLRLNTLCERLLSEHP - ELEHIIWTLPQHTLQNEYELMRDRHLDQIHMCSHYGICKV - KNIDLKPKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIV - PYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKPPS - SPLRIPGGHIYISPLKSPYKISEGLPTPTKMTPRSRILVS - IGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKK - LRFDIEGSDEADGSKHLPGESKPQQKLAEMTSTRTRMQKQ - KMHDSMDTSNKEEK.
- 4. A fission protein comprising a polypeptide with a molecular weight of 1110 to 114 kilodaltons which is a product of a retinoblastoma gene.
- 5. The phosphoprotein of claim 2 which is isolated primarily from a cell nucleus.
- 6. An isolated protein which is the product of a retinoblastoma gene isolated by a process comprising the following steps:
- (a) reacting a composition containing a protein which is a product of the retinoblastoma gene with an anti-retinoblastoma protein antibody;
- (b) isolating an antibody-retinoblastoma protein complex from the composition; and,
- (c) isolating the retinoblastoma protein from the antibody.
- 7. The isolated protein of claim 6, wherein the antibody is a polyclonal antibody.
- 8. An isolated protein which is the product of a retinoblastoma gene isolated by a process comprising the following steps:
- (a) reacting a composition containing a protein which is a product of the retinoblastoma gene with a DNA;
- (d) isolating the DNA-retinoblastoma protein complex from the composition; and,
- (e) isolating the retinoblastoma protein from the DNA.
- 9. The isolated protein of claim 8, wherein the DNA is coupled to a solid surface.
- 10. The isolated protein of claim 9, wherein the solid surface is selected from the group consisting of Sepharose and a filter.
Parent Case Info
This application is a continuation of application Ser. No. 08/225,099, filed Apr. 8, 1994 issued as U.S. Pat. No. 5,578,701, Nov. 26, 1996; which is a continuation of application Ser. No. 08/079,207 filed Jun. 17, 1993 now abandoned; which is a continuation of application Ser. No. 07/914,039 filed Jul. 14, 1992 now abandoned; which is continuation of application Ser. No. 07/550,877 filed Jul. 11, 1990 now abandoned; which is a divisional of application Ser. No. 07/098,612 filed Sep. 17, 1987 (U.S. Pat. No. 4,942,123 Jul. 17, 1990).
Government Interests
This invention was made with Government support under grant No.: EY 05758 with the National Institute of Health and the University of California. The Government has certain rights in this invention.
Non-Patent Literature Citations (16)
Entry |
Angier, N., Discover Mar.:85-96 (1987). |
Benedict et al., Cancer Genet. and Cytogenet. 10:311-333 (1983). |
Benedict et al., Science 219:973-975 (1983). |
Cavenee et al., Am. J. Hum. Genet. 36:10-24 (1984). |
Cavenee et al., Nature 305:779-784 (1983). |
Dryja et al., Proc. Natl. Acad. Sci. USA 83:7391-7394 (1986). |
Friend et al., Nature 323:643-646 (1986). |
Fung et al., Science 236:1657-1661 (1987). |
Harris, Henry, Nature 323:582-583 (1986). |
Lee et al., Proc. Natl. Acad. Sci. USA 83:6337-6341 (1986). |
Lee et al., Proc. Natl. Acad. Sci. USA 83:6790-6794 (1986). |
Lee et al., Science 235:1394-1399 (1987). |
Murphree et al., Science 223:1028-1033 (1984). |
Strong et al., Science 213:1501-1503 (1981). |
Lee et al., Nature 329:642-645, Oct. 15, 1987. |
Friend et al., Proc. Natl. Acad. Sci. USA 84:9059-9063, Dec. 1987. |
Divisions (1)
|
Number |
Date |
Country |
Parent |
098612 |
Sep 1987 |
|
Continuations (4)
|
Number |
Date |
Country |
Parent |
225099 |
Apr 1994 |
|
Parent |
079207 |
Jun 1993 |
|
Parent |
914039 |
Jul 1992 |
|
Parent |
550877 |
Jul 1990 |
|