Alzheimer's disease is the most common form of dementia in elderly people. It is a degenerative disease clinically characterised by the progressive decline of cognitive functions, and neuropathologically characterised by the accumulation of insoluble aggregates of β-amyloid (Aβ) and tau protein, in the cerebral cortex and in subcortical grey matter. The Aβ is deposited in the form of extracellular amyloid in the neuropile (senile plaque) and in the cerebral vessels (congophilic angiopathy), while the tau form of the protein forms anomalous intraneuronal filaments (neurofibrillary degenerations) (Love S. Neuropathological investigation of dementia: a guide for neurologists. J Neurol Neurosurg Psychiatry 76, Suppl 5:v8-14, 2005) (
In 95% of the cases, Alzheimer's disease is sporadic, while in about 5% of the cases it has a familial character and is associated with mutations of 3 genes: presenilin 1 (PSEN 1) on chromosome 14, presenilin 2 (PSEN2) on chromosome 1 and precursor of the β-amyloid (APP) on chromosome 21. In these cases, the disease often has an earlier onset than the sporadic form and is transmitted with a mechanism of autosomal dominant type with high penetration. AD's ethiopathogenesis is not yet entirely understood, but in the last decade the hypothesis has been increasingly confirmed of the “amyloid cascade” (Wilquet et al. Amyloid-beta precursor protein processing in neurodegeneration. Curr Opin Neurobiol 14:582-8, 2004; Lee et al. Perspectives on the amyloid-beta cascade hypothesis. J Alzheimers Dis 6:137-45, 2004) which attributes a central role to the Aβ both in the familial (FAD) and sporadic forms.
The Aβ derives from its βAPP precursor through a catabolic pathway called “amyloidogenic pathway” (
The amyloid cascade hypothesis is supported by multiple proofs:
Regarding the genetically determined forms, about 80% of the familial AD cases are associated with PSEN1 and PSEN2 mutations (Rocchi et al. Causative and susceptibility genes for Alzheimer's disease: a review. Brain Res Bull 61:1-24, 2003). Both presenilins are involved in the generation of Aβ, being part of the macromolecular complex of the gamma-secretase, and their mutations case an increase of the Aβ production, above all of Aβ1-42, which has a high tendency to form neurotoxic aggregates.
About 5% of the FAD are caused by mutations localised on the APP gene (Rocchi et al. Causative and susceptibility genes for Alzheimer's disease: a review. Brain Res Bull 61:1-24, 2003) (
The technical task of the present invention is that of providing products and their use for the diagnosis and/or prevention and/or care of human and/or animal pathologies characterised by the anomalous deposition of β-amyloid substance and/or amyloid-like substance in human and/or animal tissues and/or organs, and a screening method for determining the risk of such pathologies.
The technical task, as well as other objects according to the present invention, are achieved by means of that revealed in the independent claims reported below.
Other characteristics of the invention are defined by the subsequent claims.
Further characteristics and advantages of the present invention are more evident from the following description supported by the attached
The present invention refers to the recent discovery of a new punctiform mutation of the human APP gene. The mutation is characterised by the substitution of a Cytosine with a Thymidine at codon 673 of the coding sequence of the human APP gene (D8765), corresponding with the nucleotide 2212 (transition c.2212>T) of the isoform of human APP770 (NM—000484.2) according to the nomenclature of the GenBank database, accessibly on the website http://www.ncbi.nlm.nih.gov. For the purposes of this patent, by amyloid-like substances, it is intended protein aggregates of Aβ which do not have the tinctorial and/or ultrastructural characteristics of the amyloid itself. Such mutation, which induces in the protein sequence the substitution of an alanine with a valine in position 673 (Ala673Val) of APP770, corresponding with the amino acid residue 2 of Aβ, was identified in homozygosis of a patient affected with a grave form of dementia with presenile onset. The analysis of the cephalorachidian liquid of the patient showed a considerable diminution of the total tau protein and phosphorylated tau, as is observed in Alzheimer disease. On the other hand, the plasma levels of Aβ1-40 and Aβ1-42 are increased with respect to control subjects and also with respect to subjects that bear the same mutation in heterozygosis. In addition, the fibroblasts obtained from skin biopsy of the patient released, in their culture medium, higher quantities of Aβ1-40 and Aβ1-42 with respect to control fibroblasts. Overall, this data, whose details are reported in several of the examples listed below, indicates that the mutation Ala673Val, in homozygosis state, is associated with a dementia that can be described as Alzheimer's disease, and, analogous to other mutations of the APP gene, influences the processing of the APP by increasing the Aβ production.
The genetic study of different family members demonstrated the presence of another familiar carrier of the Ala673Val mutation in homozygosis. This relative, younger than the patient, was subjected to neuropsychological evaluation, which detected initial signs of compromise of different cognitive functions. Genetic analysis permitted, moreover, identifying numerous carrier subjects of the same mutation in heterozygosis which, surprisingly, had developed no neurological development, even if some of them were advanced in age (IX decade of life) (
In order to investigate the molecular bases of this phenomenon, we have synthesised 2 Aβ1-40 peptides, one wild-type (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAHGLMVGGVV), the other containing a valine in place of the alanine in position 2 (DVEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV).
The two peptides were subjected to chemical-physical and morphological analysis aimed to evaluate their secondary structure, the aggregation kinetics, and the morphology and nature of the aggregates. These investigations showed that the mutated peptide had a propensity to form amyloid fibrils that were much larger than the wild-type. Quite surprisingly, the mixture composed of equimolar quantities of the two peptides not only aggregates less than the mutated peptide but also less than the wild type peptide on its own. This “inhibitory” effect on the amyloidogenesis coincides with the clinical observation that the disease is exclusively manifested in the homozygote subjects for the Ala673Val mutation while the heterozygotes, which co-express both the peptides at the cellular level (wild-type and mutated), do not fall ill. On the basis of this data, it can even be assumed that the heterozygote individuals can be protected from Alzheimer's disease due to the small fibrillogenic tendency of the mutated Aβ peptide in the presence of its corresponding wild-type.
In order to verify the hypothesis that the N-terminal region of Aβ, which houses the mutation, plays an important rule in the aggregation and that the Ala673Val mutation has an inhibitory effect, two peptides were synthesised corresponding with the first six amino acids of Aβ, one with the wild-type sequence (DAEFRH) and the other containing a valine in place of the alanine in position 2 (DVEFRH). The two hexapeptides were then co-incubated with the Aβ1-40 wild-type and examined at subsequent times. The study demonstrated that both the hexapeptides inhibit the spontaneous tendency for the fibrillogenesis of Aβ1-40 and that the effect of the mutated hexapeptide is greater than that of the corresponding wild-type.
This data opens new possibilities in the scope of therapeutic strategies for AD, and more in general of the diseases characterised by protein accumulation in the form of insoluble and toxic aggregates in the central nervous system or in other tissues.
A first application of our invention consists of the production, according to methods known by those skilled in the art, of a vector containing the cDNA of the human APP with Ala673Val, and the use of said vector in order to transfect cell lines usable for pathogenesis studies and therapy.
A second application consists of the use of the construct according to the previous application as vector for the production, according to methods known by those skilled in the art, of transgenic non-human mammals capable of expressing human APP with Ala673Val mutation, as single form of APP (homozygote animals) or in combination with wild type human APP or containing another mutation (double transgenic). Such animals can be used as models for the study of pathogenesis, diagnosis, prevention and care of human and/or animal pathologies, characterised by the anomalous formation and deposition of β-amyloid and/or amyloid-like substance in organs and tissues. In the current embodiment, the preferred animal is the mouse, and in particular the knockout murine strain C57BL6 for the endogenous APP, and the preferred pathology is AD.
Considering the potential capacity of the mutated peptide to interfere with the aggregation and the fibrillogenesis of Aβ, another possible application of our invention is represented by the generation of a construct containing APP with Ala673Val mutation in the in vivo gene therapy (the DNA is transferred directly in the cells or tissues of the patient) or ex vivo gene therapy (the DNA is first transferred in cells isolated from the organism and laboratory-grown, which, thus modified, can be re-introduced in the patient) of pathologies characterised by anomalous deposition of β-amyloid substance in tissues and organs. The transfer of the construct into the target cells can be achieved by means of vectors of viral type, such as for example (a) retroviruses which have the capacity to integrate their DNA inside the proliferation cell chromosomes, (b) lentiviruses which allow transferring genetic material also in cells which do not proliferate, (c) adeno-associated viruses which do not integrate their DNA in the chromosomes of the cell but can be used only for genes of small size, (d) adenoviruses which can transport genes of large size but nevertheless ensure their expression for limited time periods, or (e) herpex simplex virus which only infects several types of cells, in particular the neurons. Alternatively, it is possible to use non-viral vectors like the liposomes. The introduction of APP with Ala673Val mutation in organisms affected by pathologies with abnormal accumulations of Aβ could provide a source of mutated β-protein capable of inhibiting the accumulation of β-amyloid substances in the tissues.
Another possible application is represented by the use of negative-sense mRNA, containing the present mutation, for inhibiting the translation of the messenger in homozygote subjects for the Ala673Val mutation, according to methods known to those skilled in the art (RNA interference, RNAi). The inhibition of the translation has the object of causing a block of the production of the mutated peptides, which have the strong tendency towards aggregation. The experiments based on RNAi technology applied to our invention can also be useful in the study of the pathogenesis of diseases characterised by anomalous formation and deposition of β-amyloid and/or amyloid-like substances in the tissues and organs. Another application of our invention provides for the use of the human APP with Ala673Val mutation and natural or synthesis peptides containing the mutation itself for the diagnosis, prevention and care of human and/or animal pathologies, characterised by anomalous formation and deposition of β-amyloid and/or amyloid-like substances in the tissues and organs.
Our preferred embodiment provides for the use of low molecular weight peptides, like the hexapeptide DVEFRH, suitably formulated for the oral and/or parenteral administration, including the intrathecal administration. The preferred pathology is AD. The treatment provides for the administration of single peptides or the association of several peptides, used as single treatment or in association with other drugs.
A further application of our invention provides for the production, by means of techniques known to those skilled in the art, of antibodies towards the proteins and/or peptides pursuant to the previous application, to be used in the diagnosis, prevention and/or care of the of human and/or animal pathologies, characterised by anomalous formation and deposition of β-amyloid and/or amyloid-like substances in the tissues and organs.
Our preferred embodiment provides for a monoclonal antibody capable of recognising the Ala673Val mutation in the human APP and in peptides derived therefrom and containing such mutation. Such antibody can be used for diagnostic purposes in order to recognise the APP with Ala673Val mutation or, suitably formulated, for the treatment of amyloidosis characterised by the presence of this mutated APP. The preferred amyloidosis is AD.
The applications described above are reported as an example, and are not in any manner limiting of the developments of our invention.
The identification of the mutation was conducted by means of the extraction of the genome DNA from the patient lymphocytes, amplification of the exons 16 and 17 of the gene APP by means of polymerase chain reaction (PCR), using the primers 5′-GTTTTGGGTAGCCTTTG-3 and 5′-GGCAAGACAAAACAGTAGTGG-3′ and sequencing of the amplification product (
Since the mutation eliminates a specific cutting site for the restriction enzyme HpYCH4V inside the exon 16, the presence of Ala673Val is also shown by means of amplification of the exon 16 through PCR (primers: 5′-GGCAAGACAAAACAGTAGTGG-3′ and 5′-TACTTTAATTATGATGTAATA-3′), digestion of the PCR product with HpYCH4V, and separation of the fragments on 2.5% agarose gel. In the wild type allele, the digestion with HpYCH4 produces two fragments of 91 and 78 base pairs (bp), while the mutated allele generates a single fragment of 169 bp (
The Ala673Val mutation was identified in homozygosis in a patient without familiality for dementia, affected by an evolutive psycho-organic syndrome with onset at age 36, with ingravescent memory deficits, planning difficulties and behavioural disturbances (
The genetic study of the family allowed identifying a second homozygote subject for the Ala673Val mutation (
It should be underlined that the same codon of the APP gene houses an Ala673Thr polymorphism. This polymorphism was encountered in heterozygosis in a subject without clinical signs or neuropathological alterations suggestive of AD (Peacock et al. Novel polymorphism in the A4 region of the amyloid precursor protein gene in a patient without Alzheimer's disease. Neurology 43:1254-56, 1993).
The laboratory and instrument research carried out on the patient showed:
The alterations described are entirely similar to those observed in Alzheimer's disease.
In order to ascertain the effects of the Ala673Val mutation and verify its role in the pathogenesis of AD, we synthesised 2 Aβ3-40 peptides, one with the wild-type (DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV) sequence and the other containing alanine>valine in position 2 (DVEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV). The peptides were produced by means of solid phase synthesis by using a synthesiser 433A (Applied Biosystems). The peptides bonded to the resin were then derivatised at the N-terminal with a lipophile probe (4-dodecylaminocarbonylfluorene-9-ylmethylsuccinimidyl carbonate) according to the method described by Ball et al. (Int J Pept Prot Res 40:370-9, 1992) with the modifications introduced by Bonetto et al. (J Biol Chem 277: 31327-34, 2002). After separation from the resin, the peptides were purified by means of HPLC, by using a reverse phase column C4 (Waters), obtaining a purity >95%. The identity of the peptides was determined by means of MALDI-TOF spectrometry (Reflex III Brucker Model).
For the physical-chemical studies reported below (unless otherwise specified), the peptides wild-type Aβ1-40, mutated Aβ1-40 and samples containing equimolar mixtures of the two were dissolved in 10 mM NaOH and subsequently diluted in 50 mM Tris HCl, pH 7.0, at the final concentration of 0.25 and 0.125 mM. The samples were then incubated at 37° C. for 1, 4, 8, 24 hours and 3, 5, 10, 15 and 20 days. For each time, aliquots of the samples were analysed in order to determine the secondary structure, the aggregation, the ultrastructure and the optical-tinctorial properties of the aggregate.
Secondary Structure
The variations induced by the mutation of the secondary structure of Aβ were investigated by means of Circular Dichroism according to the technique described by Clippingdale et al. (J Pept Sci 5:227-49, 2001). The peptides were diluted in 150 mM phosphate buffer, pH 7.4, to the final concentration of 100 μM, and the measurements were conducted with a Jasco-810 spectropolarimeter at a constant 37° C. temperature. The spectra were acquired by using a 1 mm test tube and a scanning speed of 20 nm/min. After having obtained the spectrum of the buffer solution, the noise was reduced, when required, by using the moving average method.
The analysis demonstrates that the mutated peptide had a strong tendency to assume a secondary conformation abounding in β-sheets. At all examined times, the β-sheet content was much higher not only with respect to that of the wild-type peptide but also with respect to that of the equimolar mixture constituted by mutated wild-type peptides (
This indicates that the Ala673Val mutation conditions the folding of Aβ, causing a considerable increase of the secondary β-sheet structure.
Aggregation
The aggregation of wild-type Aβ1-40, mutated Aβ1-40 and their equimolar mixture was evaluated by determining the quantity of peptide that could be sedimented with centrifugation. At the different incubation times, 30 μl aliquots of the samples were centrifuged at 15,000 g for 15 minutes at 4° C. The pellet was solubilised in 25 μl of pure formic acid, and the solution was injected in HPLC provided with PRLP-S 100 Å column, 4.6×150 mm (Labservice Analytica, Polymer Laboratories). The elution was made by using as movable phase an eluent A composed of 0.1% TFA in water and an eluent B constituted by 0.08% TFA in acetonitrile, at a flow speed of 0.7 ml/min, applying a 15-60% linear gradient of the eluent B in 20 min. The peak corresponding to the peptide was modified by measuring the absorbance of the eluate at 214 nm.
The quantity of peptide that can be sedimented was calculated as percentage of the total quantity of peptide present in the initial solution.
These experiments demonstrated that the mutated peptide aggregated much more and much more quickly than the wild-type peptide and that, surprisingly, the mixture formed by the two peptides sediments less than the mutated peptide as well as the wild-type peptide (
Ultrastructure and Tinctorial Properties of the Aggregates
The ultrastructural characteristics and optical-tinctorial properties of the aggregates were respectively studied by means of electronic microscope and polarised light microscope after coloration with Congo Red.
For the ultrastructural investigation, 5 μl of suspension of wild-type Aβ1-40, mutated Aβ1-40 and their equimolar mixture were drawn at incubation times in the range of 1 hour-20 days, deposited on nickel screen covered with Formvar-Carbon for 5 minutes, negatively coloured with an over-saturated solution of uranyl and observed under electronic microscope (EM109 Zeiss). On the twentieth day of incubation, aliquots of the samples were centrifuged at 15,000 g for 15 minutes. The pellets thus obtained were fixed in 2.5% glutaraldehyde in phosphate buffer, pH 7.4, post-fixed in 1% osmium tetroxide, dehydrated in acetone and included in epoxy rein (Spurr, Electron Microscopy Sciences). Ultrafine sections (500 Å) were collected on copper screens, coloured with uranyl acetate and lead citrate and observed under the electronic microscope.
In order to verify if and in what measure the aggregates were constituted by amyloid, 5 μl of solution of each sample, for the different incubation times, was collected on polylysinated slides (Bio-Optical), coloured with Congo Red and examined with polarised light microscope (Nikon Eclipse E-800).
The ultrastructural analysis showed that in the first two days of incubation, the wild-type Aβ1-40 peptide forms amorphous aggregates, oligomers and rare filamentous structures. After 48 hours, a short fibril material appears, not ramified, irregular (protofibril), and only after 72 hours of incubation are long rectilinear fibrils observed, of about 8 nm diameters, interposed with amorphous and protofibril material. Subsequently, the density of the fibrils increases and the quantity of amorphous and protofibril material is proportionally increased. Only after 15 days of incubation is most of the material composed of dense fibril networks.
On the other hand, the aggregation kinetics of the mutated peptide Aβ1-40 were very fast. Indeed, starting from 24 hours of incubation, long, regular fibrils lacking ramifications were present (
Surprising, the equimolar mixture of the two peptides forms less fibrils not only with respect to the mutated peptide, but also with respect to the wild-type, and after 20 days of incubation most of the aggregates were composed of amorphous material (
The observation in polarised light of the preparations coloured with Congo Red showed that the mutated peptide Aβ1-40 is much more amyloidogenic than wild-type Aβ1-40 and that the mixture of the two peptides has a low tendency to form amyloid. In fact, small aggregates of birefringent material were already present after 24 hours of incubation (
This data confirms the results of the aggregation studies, demonstrating that (i) the mutated peptide Aβ1-40 is much more amyloidogenic than the wild-type, and (ii) the mixture of the two peptides has a low tendency to form amyloid fibrils.
Since the physical-chemical study of the mixture of the mutated Aβ1-40 and wild-type Aβ1-40 peptides suggested that the Ala673Val mutation could have an inhibitory effect on the aggregation of Aβ, we verified this hypothesis by using two synthetic peptides corresponding to the first six amino acids of Aβ, one with the wild-type sequence (DAEFRH) and the other containing a valine in place of the alanine in position 2 (DVEFRH). The two hexapeptides were co-incubated with wild-type Aβ1-40 at equimolar concentration or in excess (hexapeptide:Aβ1-40=5:1). The mixtures were prepared for the ultrastructural and histochemical study as described in example 2. The study has shown that both the hexapeptides (both the mutated and the wild-type) inhibit the fibrillogenesis of Aβ1-40, indicating that the N-terminal region of Aβ, site of the mutation, plays an important role in the aggregation (
By means of genetic engineering methods (Tesco et al. APP substitutions V715F and L720P alter PS1 conformation and differentially affect Aβ and AICD generation. J Neurochem 95: 446-56, 2005; Sudhir et al. Release of Amino-terminal Fragments from Amyloid Precursor Protein Reporter and Mutated Derivatives in Cultured Cell. J Biol Chem 267:25602-08, 1992) two vectors were generated respectively containing the cDNA of wild-type human APP751 and the cDNA of human APP751 with the Ala>Val mutation in position 2 of Aβ. With these vectors, two cell lines were transfected (COS7 and CHO), on which Aβ metering was carried out in the medium with ELISA method.
The Ala>Val mutation in position 2 of Aβ was inserted in the cDNA of human APP751 by means of site-specific mutagenesis (QuikChange® XL Site-Directed Mutagenesis Kit, Stratagene) using the oligonucleotides 5′-GATCTCTGAAGTGAAGATGGATGTAGAATTCC-3 and 5′-GTCATGTCGGAATTCTACATCCATCTTCACTT 3′. Both the wild-type and mutated form of APP were then amplified by means of PCT, by using the primers 5′-CCCGGATATCGCCACCATGCTGCCCGGTTTGGCAC-3′ and 5′-ACCGAAGCTTTGTGGCGGGGGTCTAGTTC-3′ (the first containing a site recognised by the restriction enzyme EcoRV, the second with site for the enzyme HindIII), and cloned in the vector pcDNA 3.1, at the restriction sites EcoRV and HindIII. The constructs thus produced were further amplified by means of transformation of Top Ten One Shot (Invitrogen) cells, purified by means of the kit Endofree Plasmid Maxi Kit (Qiagen), and used for transfecting COS7 and CHO cells by means of electroporation. The efficiency of the transfections was evaluated through the quantification of APP on cell lysates by means of Western blot, using the antibody 22C11 (Chemicon International Inc.) directed against the N-terminal region of the protein (residues 61-88). The APP expression level was used for comparing the levels of Aβ production by cells transfected with two constructs. On the culture medium of the COS7 and the CHO expressing wild-type and mutated human APP, the metering was then carried out of peptides Aβ1-40, Aβ1-42 and truncated forms at the N-terminal with ELISA (Immuno-Biological Laboratories Gunma).
The study demonstrated:
This date indicates that the Ala>Val mutation in position 2 of Aβ modifies the processing of APP, favouring the amyloidogenic pathway, with increase of production of Aβ1-40, Aβ1-42 and truncated forms at the N-terminal.
We made a construct carrying human APP with Ala>Val mutation in position 2 of Aβ, for the generation of transgenic mice on which behavioural, neurophysiological, neuroradiological, neuropathological, biochemical and molecular tests were conducted in order to define the phenotype characteristics of the disease associated with this genetic defect, and to conduct pathogenesis and therapy studies.
The cDNA of wild-type APP751 was cloned in the vector pTSC21, containing the promoter murine Thy 1.2 (restriction sites HindIII and EcoRV) (
6 founders (3 male and 3 female) positive for the transgene were obtained, which gave life to three lines which over-express human APP with Ala>Val mutation in position 2 of Aβ in the central nervous system. The two best lines will be crossed with a line of C57Bl/6 knock-out mice for endogenous APP—line already available—in order to obtain animals expressing mutated human APP in the absence of murine APP (huAPPmut/moAPP0/0, FIG. 19). Finally, these will be crossed with transgenic mice for wild-type human APP in order to obtain heterozygote animals (huAPPmut/huAPPwt).
The mice expressing human APP with mutation 2 of Aβ in homozygosis and heterozygosis will be used for pathogenesis studies, diagnosis, prevention and care of Alzheimer's disease and, more in general, of human and/or animal diseases characterised by an anomalous deposition of amyloid and/or amyloid-like substance in organs and tissues.
Number | Date | Country | Kind |
---|---|---|---|
MI2007A001975 | Oct 2007 | IT | national |
Filing Document | Filing Date | Country | Kind | 371c Date |
---|---|---|---|---|
PCT/EP2008/008595 | 10/10/2008 | WO | 00 | 4/9/2010 |