Protease inhibitor combination with therapeutic proteins including antibodies

Abstract

Protease inhibitors together with protease sensitive therapeutics or diagnostics are provided, which may be ionically or covalently bound, or unbound. The protease inhibitors and/or protease sensitive moiety may be provided in monomeric, homopolymeric, heteropolymeric (for each of the protease and agent) and/or block copolymeric (combining polymers of agent and inhibitor) form. The inhibitors may be native active or e.g., protease activated. Multiple protease inhibitor peptides may be used in-frame with multiple protease cleavage signals (polymeric protease activated protease inhibitors). Combination with the protease inhibitors with the protease sensitive therapeutic enhances the intact, active molecule local-regional or targeted cell or tissue concentration, peak concentration and/or duration of the therapeutic exposure, thereby increasing its therapeutic efficacy. The protease inhibitors are particularly useful for tumor-targeted therapies and for vaccines.

Description

FIELD OF THE INVENTION

This invention is related to the field of therapeutic delivery systems, and methods for improving the delivery, stability and efficacy of protein therapeutics.

BACKGROUND OF THE INVENTION

Citation or identification of any reference herein, or any section of this application shall not be construed as an admission that such reference is available as prior art to the present application. The disclosures of each of these publications in their entireties are hereby incorporated by reference in their entirety in this application, and shall be treated as if the entirety thereof forms a part of this application.

Once a rarely used subset of medical treatments, protein therapeutics have increased dramatically in number and frequency of use since the introduction of the first recombinant protein therapeutic, human insulin, 25 years ago. Protein therapeutics already have a significant role in almost every field of medicine, but this role is still only in its infancy. (Leader et al., 2008, Protein therapeutics: a summary and pharmacological classification Nature Reviews Drug Discovery 7, 21-39).

Targeted monoclonal antibodies comprise a major form of therapeutic proteins. Targeting monoclonal antibodies to the tumor can result in the destruction of the tumor cells by antibody-dependent cellular cytotoxicity or complement-dependent cytotoxicity. Similarly, targeting cytokines or immunomodulatory molecules either by bispecific scFv or antibody-ligand fusion proteins to the tumor modulates the immune response against the tumor. In addition, antibody-ligand fusion proteins can induce apoptosis to targeted cells as well as bystander cells by, for example, presenting FasL. A more direct approach to kill the targeted cell is the conjugation of cytotoxic drugs, toxins or radionuclides to the monoclonal antibodies. The antibody-directed enzyme prodrug therapy (ADEPT) approach specifically aims at causing bystander effects by targeting enzymes to the tumor cell and delivering a prodrug that is converted to a chemotherapeutic by the targeted enzyme. (Schrama et al., 2006, Antibody targeted drugs as cancer therapeutics, Nature Reviews Drug Discovery 5, 147-159). Examples of monoclonal antibody therapeutics are shown in Table I. However, means to enhance their protease stability have not been provided, particularly for tumor-targeted antibodies.

TABLE I
Monoclonal antibody therapeutics approved for clinical use. From: An, 2008,
Antibody Therapeutics - a mini review. Trends in Bio/Pharmaceutical Industry 2: 24-29.
Generic Name
Trade Name	Launch	Therapy	Major		Protein		Refer-
Manufacturer	Date	Area	Indication	Target	Form/Isotype	Delivery	ence
Muromonab	1986	AIID	Transplant	CD3	Murine IgG2a	IV	(16)
Orthoclone/OKT3			rejection
Johnson & Johnson
Abciximab	1995	CV	Cardiovascular	CD41	Chimeric Fab	IV	(8)
ReoPro			disease
Eli Lilly
Rituximab	1997	Oncology	Non-Hodgkin's	CD20	Chimeric IgG1	IV	(17)
Rituxan/MabThera			Lymphoma
Genentech/Roche
Daclizumab	1997	AIID	Transplant	CD25	Humanized IgG1	IV	(9)
Zenapax			rejection
Roche
Basiliximab	1998	AIID	Transplant	CD25	Chimeric IgG1	IV	(18)
Simulect			rejection
Novartis
Infliximab	1998	AIID	Rheumatoid	TNF alpha	Chimeric IgG1	IV	(19)
Remicade			arthritis
Centocor
Palivizumab	1998	ID	Respiratory	RSV	Chimeric IgG1	IM	(20)
Synagis			syncytial virus	F-protein
MedImmune
Trastuzumab	1998	Oncology	Breast cancer	Hcr2	Humanized	IV	(21)
Herceptin					IgG1
Genentech
Gemtuzumab/ozo-	2000	Oncology	Acute myclog-	CD33	Humanized IgG4	IV	(22)
gamicin			enous leukemia		conjugated with
Mylotarg					ozogamicin
Wyeth
Alemtuzumab	2001	Oncology	Chronic	CD52	Humanized	IV	(23)
Campath			lymphocytic		IgG1
Bayer-Schering			leukemia
Ibritumomab	2002	Oncology	Non-Hodgkin's	CD20	Murine IgG1	IV	(24)
tiuxetan			Lymphoma		conjugated with
Zevalin					Yttrium 90
Biogen/Idec
Omalizumab	2003	Respiratory	Asthma	IgE	Humanized	SC	(25)
Xolair					IgG1
Genentech/Novartis
Efalizumab	2003	AIID	Psoriasis	CD11A	Humanized	SC	(26)
Raptiva					IgG1
Genentech
Tositumomab	2003	Oncology	Non-Hodgkin's	CD20	Murine IgG2a	IV	(27)
Bexxar			Lymphoma		conjugated with
GSK					Iodine-131
Adalimumab	2003	AIID	Rheumatoid	TNF alpha	Human IgG1	SC	(11)
Humira			arthritis
Abbott
Cetuximab	2003	Oncology	Colorectal	EGFR	Chimeric IgG1	IV	(28)
Erbitux			cancer
ImClone/BMS
I-131 ch-TNT	2003	Oncology	Advanced lung	Intracellular	Chimeric IgG1	IV	(29)
Shanghai Medipharm			cancer	DNA in	conjugated with
Biotech Co.				tumors	I-131
Bevacizumab	2004	Oncology	Colorectal and	VEGF	Humanized	IV	(30)
Avastin			non-small cell		IgG1
Genentech			lung cancer
Natalizumab	2004	CNS/AIID	Multiple	VLA4	humanized IgG1	IV	(31)
Tysabri			sclerosis
Biogen IDEC/Elan
Tocilizumab	2005	AIID	Castleman's	IL-6R	Humanized IgG1	IV	(32)
Actemra			disease
Roche/Chugai
Ranibizumab	2006	Ophthal-	Wet age-related	VEGF	Humanized mab	Injection	(3)
Lucentis		mology	macular		fragment of	into the
Genentech/Novartis			degeneration		Avastin	eye
Panitumumab	2006	Oncology	Colorectal	EGFR	Human IgG2	IV	(33)
Vectibix			cancer
Amgen
Certolizumab pegol	2007	AIID	Rheumatoid	TNF alpha	PEGylated	SC	(4)
Cimzia			arthritis		Fragment
UCB-Schwarz
Eculizumab	2007	Hematology	PNH (chronic	C5a	Humanized	IV	(34)
Soliris			hemolysis)		IgG2/IgG4
Alexion					hybrid

SUMMARY OF THE INVENTION

Protease inhibitors together with protease sensitive therapeutics are provided. Therefore, the localized in vivo activity of protease-sensitive drugs will be increased. Likewise, the physical region of activity for a highly protease sensitive peptide agent will be generally limited to the region in which both the protease inhibitor and peptide are present at sufficient concentrations.

The polymeric protease activated protease inhibitors can be homo- or hetero-inhibitor polymers, and/or homo- or hetero-protease cleavage site polymers. Combination with the protease inhibitors with the protease sensitive therapeutic enhances the intact, active molecule local-regional or targeted cell or tissue concentration, peak concentration and/or duration of the therapeutic exposure, thereby increasing its therapeutic efficacy. The protease inhibitors are particularly useful for tumor-targeted therapies and for vaccines.

The present invention comprises systems, compositions, and methods for using protease inhibitors together with protease sensitive therapeutics. The protease inhibitors may be ionically bound the protease sensitive therapeutic, covalently bound (e.g., connected through a covalent bond), or unbound. The protease inhibitors include monomeric protease inhibitors, and polymeric inhibitors where the inhibitors are themselves protease activated, or the protease inhibitors may be activated or activated in some other way. The protease cleavage site may be for the same protease that the peptide inactivates, and thus, the protease activates its own inhibitor. The protease inhibitor may be of a competitive or non-competitive type. The protease cleavage site may also be for a protease other than for the protease inhibitor, thus deactivating another protease. Multiple protease inhibitor peptides may be used in-frame with multiple protease cleavage signals (polymeric protease activated protease inhibitors). The polymeric protease activated protease inhibitors can be homo- or hetero-inhibitor polymers, and/or homo- or hetero-protease cleavage site polymers.

Combination of a protease inhibitor with a protease sensitive therapeutic may enhance the intact, active molecule local-regional or targeted cell or tissue concentration, peak concentration and/or duration of the therapeutic exposure, thereby increasing its therapeutic efficacy.

The protease inhibitors are particularly useful for tumor-targeted therapies, which for example include the protease sensitive therapeutic.

The compositions comprising a protease inhibitor and protease-sensitive agent may be administered in traditional manner through oral, transcutaneous, transmucosal, intravenous, intramuscular, intraperitoneal, intrathecal manner, or in situ administration in a solid or liquid form, encapsulated in a polymer or liposome, or employing known administration technologies. On the other hand, the protease inhibitor and/or protease sensitive agent may be produced by a genetically engineered cell or colony of cells, such as prokaryotic cells, e.g., Salmonella, E. coli, or mycoplasma sp., or eukaryotic cells, such as autologous human cells in the case of a human therapy or diagnostic aid.

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1 shows a polymeric protease-activated protease inhibitor.

FIG. 2 shows chimeric antibody coupled to polymeric protease-activated protease inhibitors.

DETAILED DESCRIPTION OF THE INVENTION

The present invention provides, according to various embodiments, improved protein therapeutics with increased circulation (enhanced pharmacokinetics), longer half-lives and decreased degradation. In a preferred embodiment, the protein therapeutic is an antitumor antibody.

Protease Sensitivity

Therapeutic proteins are typically inherently sensitive to extracellular proteases. Proteases may be classified by several different systems, for example, into six groups: serine proteases, threonine proteases, cysteine proteases, aspartate proteases, metalloproteases and glutamic acid proteases. Alternatively, proteases may be classified by the optimal pH in which they are active: acid proteases, neutral proteases, and basic proteases (or alkaline proteases). Many proteases are over-expressed within tumors (Edwards et al. (eds) 2008, The Cancer Degradome: Proteases and Cancer Biology, Springer, 926 pp.) including tissue plasminogen activator, activated protein C, factor Xa, granzyme (A, B, M), cathepsins (e.g., cathepsin B and S), thrombin, plasmin, urokinase, matrix metaloproteaes (types 1-26) membrane matrix metalloproteases (types 1-4), prostate specific antigens (PSA; kallikrein 3-related peptidase), kallikrein 2, elastin, trypsin, chymotrypsin.

A variety of protease assays are known to those skilled in the art. Many protease assays are commercially available, such as the QuantiCleave Fluorescent Protease Assay Kit, and QuantiCleave Protease Assay Kit II (Thermo/Fisher, Rockford, Ill.), Protease Assay Kit (G Biosciences, Maryland Heights, Mo.), PepTag Protease Assay (Promega, Madison, Wis.; 1993 Promega Notes Magazine 44: 2), Viral Protease Assay Kits (AnaSpec, Fremont, Calif.), Protease Assay Kit from Calbiochem (Calbiochem, San Diego, Calif.).

Standard laboratory techniques to measure protease activity, and thus the reduced activity of protease inhibitors, include densitometric, spectrophotometric, colorimetric and fluorometric assays, sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis (PAGE), two dimensional SDS-PAGE, high pressure liquid chromatography (HPLC) and mass spectroscopy (mass-spec). Examples of proteases and their cleavage signals are shown in Table 2.

Protease cleavage sites are defined in the MEROPS database (Rawlings et al., 2010, MEROPS: The Peptidase Database, Nucleic Acids Res. 2010 (Database issue):D227-33. It will be understood to those skilled in the arts that many proteases do not have strict sequence recognition sites, but rather have sequence preferences and/or frequencies. The MEROPS site depicts the preferences with a weighted pictogram and a table which lists frequencies of occurrence within a cleavage sequence. The table a non-limiting list proteases of tumors, the MEROPS sequence specification, and a simplified representative of an amino acid one letter code recognition sequence (where X is any amino acid) and the cleavage signal is given by a downward arrow) is presented in Table 2.

TABLE 2
Examples of protease cleavage sequences.
	MEROPS Sequence	Simplified Representative
Protease	Designation	Sequence Designation
Factor Xa	ia/e/Gfp/R+sti/vfs/—/g	(IEGR↓SV)
		SEQ ID NO: 30
Furin	R/—/Kr/R+s/—/—/—	(RXKR↓SX)
		SEQ ID NO: 31
Plasminogen	—/—/—/R+R/iv/N/—	(XXR↓RIN)
activator		SEQ ID NO: 32
Urokinase	—/sg/Gs/Rk+—/r/—/—	(XSGR↓XR)
		SEQ ID NO: 33
MMP1	—/pa/—/g+li/—/—/—	(GPXG↓LXG)
		SEQ ID NO: 34
MMP8	g/Pas/—/g+l/—/g/—	(GPQG↓LRG)
		SEQ ID NO: 35
MMP 13	g/P/—/g+l/—/ga/—	(GPPG↓LXG)
		SEQ ID NO: 36
Membrane	—/p/—/—+l/—/—/—	(LPAG↓LVLX)
matrix		SEQ ID NO: 37
metalloprotease
1
PSA	si/sq/—/yq+s/s/—/—	(SSQY↓SSN)
		SEQ ID NO: 38
Kallikrein 2	g/—/—/R+—/—/—/gs	(GGLR↓SGGG)
		SEQ ID NO: 39
Granzyme A	t/—/—/RK+sa/—/—/—	(TXXPR↓SX)
		SEQ ID NO: 40
Granzyme B	v/—/—/D+—/—/—/—	(VEXD↓SX)
		SEQ ID NO: 41
Granzyme M	Ka/vaye/Pa/LM+—/—/—/—	(KVPL↓X)
		SEQ ID NO: 42
Cathepsin B	—/—/l/r+—/—/g/—	(XLR↓XXGG)
		SEQ ID NO: 43
Cathepsin S	—/—/flv/r+—/—/—/—	(SGFR↓SXG)
		SEQ ID NO: 44
Thrombin	—/—/pla/R+sag/—/—/—	(AGPR↓SLX)
		SEQ ID NO: 45
Plasmin	—/—/—/KR+—/—/—/—	(AXLK↓SX)
		SEQ ID NO: 46
Plasminogen	/—/—/KR+—/—/—/—	(AXLK↓SX)
		SEQ ID NO: 47

The MEROPS database can be used to identify which proteases to inhibit, by analysis of a particular effector protein and the cleavage sites it contains. Comparison with the target tissue, eg Edwards et al. (eds) 2008, The Cancer Degradome: Proteases and Cancer Biology, Springer, 926 pp is also used to inform the choice. Alternatively, 2-dimentional gel electrophoresis and protein sequencing of radiolabled peptides incubated with the target tumor can be used to identify which amino acids are being cleaved in a therapeutic protein, and therefore which protease inhibitors to use.

Protease Inhibitors

Protease inhibitors usable in accordance herewith are preferably based on known polypeptide inhibitors. The inhibitors include both synthetic peptides and naturally occurring, endogenous peptides. Classes of protease inhibitors include: cysteine protease inhibitors, serine protease inhibitors (serpins), trypsin inhibitors, Kunitz STI protease inhibitor, threonine protease inhibitors, aspartic protease inhibitors, metalloprotease inhibitors. Protease inhibitors can also be classified by mechanism of action as suicide inhibitors, transition state inhibitors, protein protease inhibitor (see serpins) and chelating agents. The protease inhibitors are typically protein or polypeptide inhibitors that are activated by protease cleavage, resulting in a time-released “depot” effect.

The C-terminal sequences may provide a free protease inhibitor. The cleavage site may be for the same protease that the peptide inactivates. Thus, the protease activates its own inhibitor. The protease cleavage site may also be for a protease other than for the protease inhibitor, thus deactivating another protease. Multiple protease inhibitor peptides may be used in-frame with multiple protease cleavage signals (polymeric protease activated protease inhibitors), where the inhibitors alternate with cleavage sites. The polymeric protease activated protease inhibitors can be homo- or hetero-inhibitor polymers (i.e., have inhibitors for the same or different proteases, respectively), and/or homo- or hetero-protease cleavage polymers (i.e., have the same or different protease cleavage sites). Examples of proteases upregulated within tumors include: tissue plasminogen activator, activated protein C, factor Xa, granzyme (A, B, M), cathepsin, thrombin, plasmin, urokinase, matrix metalloproteases, prostate specific antigen (PSA) and kallikrein 2 (e.g., Edwards et al. (eds) 2008, The Cancer Degradome: Proteases and Cancer Biology, Springer, 926 pp.), as well as proteases of lysosomes and the gut.

Protease inhibitors have been reviewed by Laskowski and Kato, 1980, (Annual Review of Biochemistry 49: 593-626), expressly incorporated by reference herein. Serine proteases inhibitors, the largest group, include 1) bovine pancreatic trypsin inhibitor (Kunitz) family, 2) pancreatic secretory trypsin inhibitor (Kazal) family, 3) Streptomyces subtilisin inhibitor family, 4) soybean trypsin inhibitor (Kunitz) family, 5) soybean proteinase inhibitor (Bowman-Birk) family 6) potato I inhibitor family, 7) potato II inhibitor family, 8) Ascaris trypsin inhibitor family, and 9) others. Protease inhibitors have also been grouped within the MEROPS peptidase database (Rawlings et al., 2008 Nucleic Acids Res. 36 Database issue, D320-325).

Specific examples of protease inhibitors that may be expressed as complete proteins or peptide fragments corresponding to the active inhibitory site include but are not limited to aprotinin, cathepsin inhibitor peptide sc-3130, Neisseria protease inhibitor, lymphocyte protease inhibitor, maspin, matrix metalloprotease inhibitors, macroglobulins, antithrombin, equistatin, Bowman-Birk inhbitor family, ovomucoid, ovoinhibitor-proteinase inhibitors from avian serum, dog submandibular inhibitors, inter-a-trypsin inhibitors from mammalian serum, chelonianin from turtle egg white, soybean trypsin inhibitor (Kunitz), secretory trypsin inhibitors (Kazal) ai-proteinase inhibitor, Streptomyces subtilisin inhibitor, plasminostreptin, plasmin inhibitor, factor Xa inhibitor, coelenterate protease inhibitors, protease inhibitor anticoagulants, ixolaris, human Serpins (SerpinA1(alpha 1-antitrypsin), SerpinA2, SerpinA3, SerpinA4, SerpinA5, SerpinA6, SerpinA7, SerpinA8, SerpinA9, SerpinA10, SerpinA11, SerpinA12, SerpinA13, SerpinB1, SerpinB2, SerpinB3, SerpinB4, SerpinB5, SerpinB6, SerpinB7, SerpinB8, SerpinC1 (antithrombin), SerpinD1, SerpinE1, SerpinE2, SerpinF1, SerpinF2, SerpinG1, SerpinNI1, SerpinNI2), cowpea trypsin inhibitor, onion trypsin inhibitor, alpha 1-antitrypsin, Ascaris trypsin and pepsin inhibitors, lipocalins, CI inhibitor, plasminogen-activator inhibitor, collagenase inhibitor, Acp62F from Drosophila, bombina trypsin inhibitor, bombyx subtilisin inhibitor, von Willebrand factor, leukocyte secretory protease inhibitor. Short peptide inhibitors of protease are preferred. Many protease inhibitors have one or more disulfide bonds. Fusion to thioredoxin (trxA) is known to improve protease inhibitor activity (e.g., Furuki et al., 2007, Fukuoka University Science Reports 37: 37-44). Fusion to glutathione-S transferase (GST) and co-expression with disulfide bond isomerase (DsbA) or nusA (Harrison 2000, Expression of soluble heterologous proteins via fusion with NusA protein. inNovations 11: 4-7) are also known to improve solubility. Examples of the peptide sequences of short peptide inhibitors is shown in Table 3.

TABLE 3
Sequences of short peptide protease inhibitors
Protease	Protease(s)	Protein/Peptide Name
Inhibitor	inhibited	and/or Peptide Sequence
Leupeptin	calpain, plasmin,	Leupeptin
	trypsin, papain,
	and cathepsin B
Aprotinin	Trypsin	RPDFC LEPPY TGPCK ARIIR YFYNA KAGLC QTFVY
	Plasmin	GGCRA KRNNF KSAED CMRTC GGA
	Tissue kallikrein	SEQ ID NO: 001
Aprotinin	Variable	Brinkmann et al, 1991 Eur J. Biochem 202: 95-99
homologues
Protease	Trypsin	Synthetic peptide: CFPGVTSNYLYWFK SEQ ID NO: 002,
Inhibitor 15		corresponding to amino acids 245-258 of human protease
		inhibitor.
Tissue	Serine protease	DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCF
protease	inhibitor, Kazal	ENRKRQTSILIQKSGPC
inhibitor	type 1, mature	SEQ ID NO: 003
Furin	Furin	PAAATVTKKVAKSPKKAKAAKPKKAAKSAAKAVKPK
inhibitors		SEQ ID NO: 004
		TKKVAKRPRAKRAA SEQ ID NO: 005
		TKKVAKRPRAKRDL SEQ ID NO: 006
		GKRPRAKRA SEQ ID NO: 007
		CKRPRAKRDL SEQ ID NO: 008
		CVAKRPRAKRDL SEQ ID NO: 009
		CKKVAKRPRAKRDL SEQ ID NO: 010
		RRRRRR L6R (hexa-L-arginine) SEQ ID NO: 011
Kallikrein	Kallikrein 2	SRFKVWWAAG SEQ ID NO: 012
Inhibitors		AARRPFPAPS SEQ ID NO: 013
		PARRPFPVTA SEQ ID NO: 014
Pepsinogen	Pepsin	LVKVPLVRKKSLRQNL SEQ ID NO: 015
1-16		Dunn et al., 1983 Biochem J 209: 355-362
Pepsinogen	Pepsin	LVKVPLVRKKSL SEQ ID NO: 016
1-12		Dunn et al., 1983 Biochem J 209: 355-362
Pepsinogen	Pepsin	LVKGGLVRKKSL (II) [Gly4,5] SEQ ID NO: 017
1-12 4-7		LVKVPGGRKKSL (III) [Gly6,7] SEQ ID NO: 018
substitution		LVKGGGGRKKSL (IV) [Gly4-7] SEQ ID NO: 019
		Dunn et al., 1983 Biochem J 209: 355-362
Sunflower	Trypsin	GRCTKSIPPICFPD SEQ ID NO: 020
trysin
inhibitor
SFTI-1
Odorrana	Trypsin	AVNIPFKVHFRCKAAFC SEQ ID NO: 021
trypsin
inhibitor
Ascaris	Chymtrypsin	GQESCGPNEV WTECTGCEMK CGPDENTPCP
chymotrypsin	Elastase	LMCRRPSCEC SPGRGMRRTN DGKCIPASQCP
elastase		SEQ ID NO: 022
inhibitor
Ascaris	Trypsin	EAEKCBZZPG WTKGGCETCG CAQKIVPCTR
trypsin		ETKPNPQCPR KQCCIASAGF VRDAQGNCIK FEDCPK
inhibitor		SEQ ID NO: 023
Ascaris	Trypsin	EAEKCTKPNE QWTKCGGCEG TCAQKIVPCT
trypsin		RECKPPRCEC IASAGFVRDA QGNCIKFEDC PK
inhibitor		SEQ ID NO: 024
Onion trypsin	Trypsin	MKAALVIFLL IAMLGVLAAE AYPNLRQVVV
inhibitor		TGDEEEGGCC DSCGSCDRRA PDLARCECRD
		VVTSCGPGCK
		RCEEADLDLN PPRYVCKDMS FHSCQTRCSI L
		SEQ ID NO: 025
Barley	Chymotrypsin	MSSMEKKPEGVNIGAGDRQNQKTEWPELVGKSVEEAKK
chymotrypsin		VILQDK
inhibitor 2		PAAQIIVLPVGTIVTMEYRIDRVRLFVDRLDNIAQVPRVG
		SEQ ID NO: 026
Thrombin	Thrombin	IQPR SEQ ID NO: 027
inhibitors		GSAVPR SEQ ID NO: 028
		Feng et al., (WO 2004/076484) PEPTIDE INHIBITORS OF
		THROMBIN AS POTENT ANTICOAGULANTS)
Proteosome	Proteosome
inhibitors	subunit 3
Chymostatin	‘chymotryptic-
Clasto-	like’ (beta5),
tactastatin	‘tryptic-like’
	(beta2) and
	‘peptidyl-
	glutamyl peptide
	hydrolyzing’
	(beta1).
Urokinase,	Urokinase,	Markowska et al., 2008, Effect of tripeptides on the amindolytic
thrombin,	thrombin,	activities of urokinase, thrombin, plasmin and trypsin. Int. J.
plasmin and	plasmin and	Peptide Research and Therapeutics 14: 215-218.
trypsin	trypsin
inhibitors

Therapeutic Proteins

Leader et al., 2008 (Nature Reviews Drug Discovery 7: 21-39, incorporated by reference in its entirety) divided protein therapeutics in to functional categories:

Group I: protein therapeutics with enzymatic or regulatory activity

• • Ia: Replacing a protein that is deficient or abnormal.
  • Ib: Augmenting an existing pathway.
  • Ic: Providing a novel function or activity.

Group II: protein therapeutics with special targeting activity

• • IIa: Interfering with a molecule or organism.
  • IIb: Delivering other compounds or proteins.

Group III: protein vaccines

• • IIIa: Protecting against a deleterious foreign agent.
  • IIIb: Treating an autoimmune disease.
  • IIIc: Treating cancer.

Group IV: protein diagnostics.

Although other protein therapeutics previously dominated and have had well-established production protocols (e.g., Smales, C M and James, D. C (eds) 2005, Therapeutic Proteins: Methods and Protocols, Human Press), antibody therapeutics have been the most actively developed over the past 10 years. Antibody production is well known to those skilled in the arts (e.g., Dimitrov, A. S. 2009, Therapeutic antibodies: Methods and protocols, Humana Press; Dubel, S, (ed) 2010 Handbook of therapeutic antibodies: technologies, emerging developments and approved therapeutics, Wiley-Blackwell).

Co-Administration

The protease inhibitors may be mixtures with the therapeutics, and be ionically coupled, or uncoupled to the therapeutic. Methods of preparing such mixtures are known to those skilled in the arts (Singh, M., (ed) 2007, Vaccine adjuvants and delivery systems, Wiley.

Bioconjugated Protease Inhibitors

In a preferred embodiment, the inhibitor is covalently coupled to the therapeutic. Methods of covalently linking to therapeutic proteins are known to those skilled in the arts (e.g., Bioconjugate techniques, 2nd Ed. Greg T Hermanson Academic Press, Amsterdam, 2008; Bioconjugation Protocols; Strategies and Methods. Christof M. Niemeyer, (ed), Methods in Molecular Biology 283. Humana Press, Totowa, N.J., 2010;

Genetic Fusions

In the production of therapeutic proteins, genetic constructs can be used to generate fusion proteins. The fusion proteins are generally produced as N-terminal or C-terminal fusions by the addition of DNA, in-frame, that codes for the fusion peptide. For example, the genes encoding monoclonal antibodies can be genetically engineered to be produced as peptide fusions, where the peptides are protease inhibitor peptides. The protease inhibitor peptides can be monomeric or polymeric, and may be activated through cleavage by the protease they inhibit or by other proteases. Methods of generating antibody protein fusions are well known to those skilled in the arts (e.g., Chamow, S. M and Ashkenazi, A. (eds) Antibody Fustion Proteins Wiley-Liss, New York; Kontermann, R. and Dubel, S. Antibody Engineering, Second Edition, 2010., Springer Verlag, Berlin; kreitman and Pastan, Making).

Example

A cancer therapeutic antibody coupled to a polymeric protease activated protease inhibitor.

FIG. 1 shows a polymeric protease activated protease inhibitor. Multiple protease inhibitor peptides may be used in-frame with multiple protease cleavage signals (polymeric protease activated protease inhibitors), where the inhibitors alternate with cleavage sites. The polymeric protease activated protease inhibitors can be homo- or hetero-inhibitor polymers (i.e., have multiple inhibitors for the same or different proteases, respectively), and/or homo- or hetero-protease cleavage polymers (i.e., have multiple of the same or different protease cleavage sites). Thus, protease inhibitors 1, 2 and 3 can be the same protease inhibitor or different protease inhibitors, and the protease cleavage sites (downward arrows) can be the same protease cleavage side or different protease cleavage sites.

The protease inhibitors are those known inhibitors for proteases overexpressed in tumors, such as those from Table 2. A therapeutic antibody, such as Herceptin, is coupled to a polymeric protease-activated protease inhibitor. The polymeric protease inhibitor, such as a furin-activated furin inhibitor, in frame with the Herceptin antibody with the amino acid sequence (furin inhibitor IN CAPS; furin cleavage in lower case) TKKVAKRPRAKRAArxkr↓sxTKKVAKRPRAKRAArxkr↓sxTKKVAKRPRAKRAA, SEQ ID NO: 029, is genetically fused or covalently bound using methods known to those skilled in the arts (e.g., Bioconjugate techniques, 2nd Ed. Greg T Hermanson, Academic Press, Amsterdam, 2008; Bioconjugation Protocols; Strategies and Methods. Christof M. Niemeyer, (ed), Methods in Molecular Biology 283. Humana Press, Totowa, N.J., 2010; Chamow, S. M and Ashkenazi, A. (eds) Antibody Fusion Proteins Wiley-Liss, New York; Kontermann, R. and Dubel, S. Antibody Engineering, Second Edition, 2010, Springer Verlag, Berlin) to result in an antibody with a polymeric protease inhibitor as shown (FIG. 2). The purified conjugate is then used for the treatment of cancer by injection of an effective amount. Animal models (Teicher, B. ed.) Tumor models in Cancer Research, Humana Press, 2002) may be used to guide human clinical evaluation where dose escalation is used, often beginning with low doses calculated from animal studies.

FIG. 2 shows an antibody (IgG type) conjugated with a polymeric protease activated protease inhibitor. On the left, a homopolymer of protease inhibitor is shown. On the right, a heteropolymer of protease inhibitor is shown. The antibody may be monoclonal or polyclonal, and may act as a targeting therapeutic, catalytic antibody, or diagnostic agent.

Claims

1. A method, comprising: administering a protease-activated polymeric peptide protease inhibitor comprising a protease-sensitive therapeutic agent linked through a protease cleavage site to a plurality of polypeptide protease inhibitors alternating with a plurality of protease cleavage sites in sequence to an organism;activating a protease inhibitory activity of a peptide sequence of the protease-activated polymeric peptide protease inhibitor with a first organism protease; andinhibiting a second organism protease with the protease inhibitory activity of the peptide sequence of the protease-activated polymeric peptide protease inhibitor.

2. The method according to claim 1, wherein the first organism protease is of the same type of protease as the second organism protease.

3. The method according to claim 1, wherein the first organism protease is of a different type of protease than the second organism protease.

4. The method according to claim 1, wherein the protease-activated polymeric peptide protease inhibitor comprises a homopolymer of identical peptide protease inhibitors.

5. The method according to claim 1, wherein the protease-activated polymeric peptide protease inhibitor comprises a heteropolymer of different peptide protease inhibitors.

6. The method according to claim 1, wherein the first organism protease cleaves the protease cleavage site which binds the protease-sensitive therapeutic agent to the plurality of polypeptide protease inhibitors alternating with a plurality of protease cleavage sites in sequence.

7. The method according to claim 1, wherein the protease-sensitive therapeutic agent is a protease-sensitive antibody.

8. The method according to claim 1, wherein the protease-activated polymeric peptide protease inhibitor comprises a plurality of identical polypeptide protease inhibitors, wherein the protease-activated polymeric peptide protease inhibitor is purified.

9. The method according to claim 8, wherein the plurality of protease cleavage sites are subject to cleavage by the second organism protease.

10. The method according to claim 8, wherein at least one protease cleavage site is subject to cleavage by a different protease from the second organism protease.

11. The method according to claim 1, wherein the plurality of polypeptide protease inhibitors comprise a plurality of different types of polypeptide protease inhibitors, wherein the protease-activated polymeric peptide protease inhibitor is purified.

12. The method according to claim 11, wherein the plurality of protease cleavage sites comprise a plurality of different protease cleavage sites which are respectively cleaved by a plurality of different organism proteases, subject to inhibition by the plurality of different types of polypeptide protease inhibitors.

13. The method according to claim 11, wherein the plurality of protease cleavage sites comprise a protease cleavage site cleavable by at least one protease which is not inhibited by the plurality of different types of polypeptide protease inhibitors.

14. The method according to claim 11, wherein the plurality of different polypeptide protease inhibitors are configured to inhibit a plurality of different classes of proteases.

15. The method according to claim 1, wherein the protease-sensitive therapeutic agent protease comprises a cleavage site cleavable by the second organism protease, whereby degradation of the protease-sensitive therapeutic agent by the second organism protease is delayed.

16. The method according to claim 1, wherein the protease-sensitive therapeutic agent has at least one furin cleavage site wherein cleavage of the furin cleavage site of the protease-sensitive therapeutic agent leads to inactivation of the protease-sensitive therapeutic agent, and the plurality of polypeptide protease inhibitors in sequence comprise a plurality of furin inhibitor peptide sequences linked through respective furin cleavage sites.

17. A method, comprising: administering to an organism a polypeptide, comprising a protease-activated polymeric peptide protease inhibitor having a plurality of protease inhibitor domains which, after activation, inhibit a protease of the organism, separated by a plurality of protease cleavage sites cleavable by the protease of the organism, in conjunction with a protease-sensitive agent degradable by the protease of the organism;cleaving the plurality of protease cleavage sites with the protease of the organism, to thereby activate the protease inhibitor domains; andinhibiting the protease of the organism with the activated protease inhibitor domains, to thereby inhibit degradation of the protease-sensitive agent.

18. A method, comprising: administering an inactive protease-activated polymeric peptide protease inhibitor to an organism in conjunction with a protease-sensitive therapeutic agent for treating a neoplastic disease of the organism, the protease-sensitive therapeutic agent being subject to proteolytic degradation by the organism, to thereby treat the neoplastic disease;activating the inactive protease-activated polymeric peptide protease inhibitor with at least one protease in the organism to cleave at least one protease cleavage site to produce at least one active protease inhibitor domain from the inactive protease-activated polymeric peptide protease inhibitor; andinhibiting the proteolytic degradation by the organism of the protease-sensitive therapeutic agent, with the at least one active protease inhibitor domain.