Rapid detection of antibiotic resistance in mycobacterium tuberculosis

This invention relates to the rapid detection of strains of Mycobacterium tuberculosis that are resistant to antibiotics, particularly isoniazid, rifampicin and streptomycin. More particularly, this invention relates to a method of detecting antibiotic resistance in Mycobacterium tuberculosis, e.g. either as a result of mutations in the relevant genes or by nucleic acid hybridization. This invention also relates to a nucleic acid probe and a kit for carrying out the nucleic acid hybridization. The invention further relates to the chromosomal location of the katG gene (SEQ ID NO: 45) and its nucleotide sequence.
BACKGROUND OF THE INVENTION
Despite more than a century of research since the discovery of Mycobacterium tuberculosis, the aetiological agent of tuberculosis, by Robert Koch, this disease remains one of the major causes of human morbidity and mortality. There are an estimated 3 million deaths annually attributable to tuberculosis (Snider, 1989), and although the majority of these are in developing countries, the disease is assuming renewed importance in the West due to the increasing number of homeless people and the impact of the AIDS epidemic (Chaisson et al., 1987; Snider and Roper, 1992).
Isonicotinic acid hydrazide or isoniazid (INH) has been used in the treatment of tuberculosis for the last forty years due to its exquisite potency against the members of the "tuberculosis" groups--Mycobacterium tuberculosis, M. bovis and M. africanum (Middlebrook, 1952; Youatt, 1969). Neither the precise target of the drug, nor its mode of action, are known, and INH treatment results in the perturbation of several metabolic pathways. There is substantial evidence indicating that INH may act as an antimetabolite of NAD and pyridoxal phosphate (Bekierkunst and Bricker, 1967; Sriprakash and Ramakrishnan, 1970; Winder and Collins, 1968, 1969, 1970), and other data indicating that the drug blocks the synthesis of the mycolic acids, which are responsible for the acid-fast character of mycobacterial cell walls (Winder and Collins 1970; Quemard et al., 1991). Shortly after its introduction, INH-resistant isolates of Mycobacterium tuberculosis emerged and, on characterization, were often found to have lost catalase-peroxidase activity and to show reduced virulence in guinea pigs (Middlebrook et al., 1954; Kubica et al., 1968; Sriprakash and Ramakrishnan, 1970).
Very recently, INH-resistance has acquired new significance owing to a tuberculosis epidemic in the USA due to multidrug resistant (MDR) variants of M. tuberculosis (CDC, 1990; 1991a, b) and the demonstration that such strains were responsible for extensive nosocomial infections of HIV-infected individuals and health care workers (Snider and Roper, 1992). In view of the gravity of this problem, there exists a need in the art to determine the relationship between INH-resistance and catalase-peroxidase production.
More particularly, there is a need in the art to understand the molecular mechanisms involved in drug sensitivity. In addition, there is a need in the art to develop a simple test permitting the rapid identification of INH-resistant strains. Further, there is a need in the art for reagents to carry out such a test.
Rifampicin too is a major antibiotic used for the treatment of infections by mycobacterium, particularly Mycobacterium tuberculosis and Mycobacterium leprae. Because some mycobacteria grow slowly, possible rapid and efficient tests for the testing of resistance to rifampicin or analogues thereof must be made available. Likewise the invention aims at a rapid detection of strands of Mybobacterium tuberculosis which are resistant to streptomycin. Because of the development of resistance to streptomycin, the latter antibiotic has been used together with other antibiobics, e.g. isoniazid. Thus adequat treatment of tuberculosis should be preceded by rapid and efficient detection of resistances to the three majeur antibiotics, isoniazid, rifampicin and streptomycin.
SUMMARY OF THE INVENTION
Accordingly, this invention aids in fulfilling these needs in the art by providing a process for detecting in vitro the presence of cells of a Mycobacterium tuberculosis resistant to isoniazid and other drugs, such as rifampicin or analogues thereof, and streptomycin.
By analogues of rifampicin, a particularly meant derivatives of 3-formyl-rifamycin, particularly as a result of substitution the rein for the sustituant present either in the naphtofuranonyl group or of the site chain at position 7 of the naphtofuranonyl group, or by the introduction or removal of a double band in the lateral chain.
In accordance with the invention, the detection of a resistance to isoniazid involves the detection of one or several mutations in the katG gene (SEQ ID NO:45) of Mycobacterium tuberculosis, particularly with respect to the nucleotide sequence of that same katG gene (SEQ ID NO:45) in mycobacterium tuberculosis that are not resistant to isoniazid.
Another process alternative for detecting in vitro the presence of nucleic acids of a Mycobacterium tuberculosis resistant to isoniazid, wherein the process comprises the steps of:
contacting said nucleic acids previously made accessible to a probe if required under conditions permitting hybridization;
detecting any probe that had hybridized to said nucleic acids;
wherein said probe comprises a nucleic acid sequence, which is 2.5 kb EcoRV-KpnI fragment of plasmid pYZ56 or of part thereof, and wherein said fragment contains a BamHI cleavage site, wherein said part is nonetheless sufficiently long to provide for the selectivity of the in vitro detection of a Mycobacterium tuberculosis resistant to isoniazid.
For instance, this process alternative comprises the steps of
(A) depositing and fixing nucleic acids of the cells on a solid support, so as to make the nucleic acids accessible to a probe;
(B) contacting the fixed nucleic acids from step (A) with a probe under conditions permitting hybridization;
(C) washing the filter resulting from step (B), so as to eliminate any non-hybridized probe; and then
(D) detecting any hybridized probe on the washed filter resulting from step (C).
The probe comprises a nucleic acid sequence which is present in a 2.5 kb EcoRV-EnI fragment of plasmid pYZ56, wherein said fragment contains a BamHI cleavage site. This fragment has been found to be associated with intracellular DNA of isoniazid-sensitive Mycobacterium tuberculosis and is capable of distinguishing such anti-biotic sensitive microorganisms from isoniazid-resistant Mycobacterium tuberculosis, which do not contain DNA that hybridizes with this fragment under the conditions described hereinafter.
This invention further provides nucleotide sequences, such as RNA and DNA, of isoniazid-resistant Mycobacterium tuberculosis encoding the region of the katG gene of Mycobacterium tuberculosis (SEQ ID NO:45) that imparts isoniazid sensitivity absent from isoniazid-resistant cells.
This invention also provides a probe consisting of a label, such as a radionuclide, bonded to a nucleotide sequence of the invention.
In addition, this invention provides a hybrid duplex molecule consisting essentially of a nucleotide sequence of the invention hydrogen bonded to a nucleotide sequence of complementary base sequence, such as DNA or RNA.
Also, this invention provides a process for selecting a nucleotide sequence coding for a catalase-peroxidase gene of Mycobacterium tuberculosis, or for a portion of such a nucleotide sequence, from a group of nucleotide sequences, which comprises the step of determining which of the nucleotide sequences hybridizes to a nucleotide sequence of the invention. The nucleotide sequence can be a DNA sequence or an RNA sequence. The process can include the step of detecting a label on the nucleotide sequence.
Further, this invention provides a kit for the detection of Mycobacterium tuberculosis resistant to isoniazid. The kit comprises a container means containing a probe comprising a nucleic acid sequence, which is a 2.5 kb EcoRV-KpnI fragment of plasmid pYZ56, wherein the fragment contains a BamHI cleavage site. The kit also includes a container means containing a control preparation of nucleic acid.
The invention also covers compounds obtained as products of the action of the enzyme catalase, or a similar enzyme on isoniazid. The katG gene (SEQ ID NO:45) or a derivative of this gene which retains a similar activity can be used as a source of catalase protein. The new compounds are selected by reactivity on INH-resistant-mycobacterial strains by the antibiogram method such as described in H. David et al.'s "Methodes de laboratoire pour Mycobacteriologie clinique" edited by Pasteur Institute, ISBN N.multidot.0995-2454.

BRIEF DESCRIPTION OF THE DRAWINGS
This invention will be described in greater detail by reference to the drawings in which:
FIG. 1 shows the INH-resistant M. smegmatis strain, BH1 (Gayathri et al., 1975) (a derivative of strain MC.sup.2 -155) was transformed with a pool of M. tuberculosis-H37Rv shuttle cosmids (kindly provided by Dr. W. R. Jacobs, New York) and individual clones were scored for INH-susceptibility. Cosmid pBH4 consistently conferred drug susceptibility and the transformant overproduced catalase (assayed as in Heym, 1992). The restriction map of the DNA insert from pBH4 is shown along with that of the insert from pYZ55--a plasmid containing katG of M. tuberculosis H37Rv, isolated on the basis of hybridization with an oligonucleotide probe (5'-TTCATCCGCATGGCCTGGCACGGCGCGGGCACCTACCGC-31') (SEQ ID NO:1) designed to match the amino acid sequence from a conserved region of E. coli hydroperoxidase I (HPI). Restriction sites for the following enzymes are indicated : B, BamHl C, Clal, E, EcoRV; H, HindIII, K, Kpnl; M, Smal; N, Notl; R, EcoRl; S, Sacl. Transformation of BH1 with a mycobacterial shuttle plasmid, pBAK14, Zhang et al., 1991, containing the 4.5 kb insert from pYZ55 similarly conferred INH-susceptibility. MIC's are also shown for BH1 transformed with subfragments derived from pYZ55 and inserted into pBAK14 in one (+) or other (-) orientation. The katG gene (SEQ ID NO:45) and the ability to confer INH-susceptibility both mapped to a 2.9 kb EcoRV-Kpnl fragment (pBAK-KE+).
FIGS. 2A-C shows extracts from M. tuberculosis H37Rv and from E. coli strains transformed with a variety of plasmid constructs that were prepared for activity gel analysis as described previously (Zhang et al., 1991). Non-denaturing gels containing 8% polyacrylamide were stained for catalase (FIG. A) and peroxidase (FIG. B) activities as described by Wayne and Diaz (Wayne et al., 1986). Lane 1, M. tuberculosis H37Rv; 2, E. coli UM2 (katE. katG: 3, E. coli UM2/pYZ55; 4, E. coli UM2/pYZ56 (the 2.9 kb EcoRV-Krnl.sub.-- fragment in pUC19, corresponding to pBAK-KE+ in FIG. 1); 5, E. coli UM2/pYZ57 (pYZ55 with a BamHl-Kpnl deletion, corresponding to pBAK-KB+ in FIG. 1). M. tuberculosis catalase and peroxidase activities migrated as two bands under these conditions (lane 1); the same pattern was seen for the recombinant enzyme expressed by pYZ55 (lane 3). pYZ56 (lane 4) expresses a protein of increased molecular weight due to a fusion between katG and lacZ' from the vector as shown in panel C. Panel C also shows partial sequence alignment with E. coli HPI (SEQ ID NOS:42-44).
FIG. 3 shows an E.coli strain with mutations in both katG and katE (UM2 Mulvey et al., 1988) that was transformed with pUCl9 vector alone, pYZ55 expressing M. tuberculosis katG and pYZ56 with high level expression of M. tuberculosis katG. Overnight cultures in Luria-Bertani broth supplemented with appropriate antibiotics were plated out in the presence of varying concentrations of INH and colony forming units were assessed. Results of a representative experiment are shown with error bars indicating the standard deviation observed in triplicate samples. Overexpression of M. tuberculosis katG similarly conferred susceptibility to high concentrations of INH in E.coli UM255 (katG, katE, Mulvey et al., 1988), but had no effect on catalase-positive strains such as E.coli TG1. In some experiments, high concentrations of INH had detectable inhibitory effect on growth of UM2 and UM255, alone, but in all experiments inhibition of pYZ56-transformants was at least 10-100 fold greater than that observed in the corresponding vector controls.
FIGS. 4A and 4B shows Southern blots prepared using genomic DNA from different M. tuberculosis strains, digested with Kpnl, that were probed with (A) katG (the 4.5 kb Kpnl fragment), (SEQ ID NO:45) and (B) the SOD gene (1.1 kb EcoRl-Kpnl fragment, Zhang et al., 1991). Labelling of probes and processing of blots was performed as described previously (Eiglmeier et al., 1991; Maniatis et al., 1989). Lane 1, H37Rv; 2, strain 12--MIC 1.6 .mu.g/ml INH; 3, B1453--MIC >50 .mu.g/ml INH (Jackett et al., 1978); 4, strain 24--MIC >50 .mu.g/ml INH; 5, 79112--INH-sensitive (Mitchison et al., 1963); 6, 12646--INH-sensitive (Mitchison et al., 1963); 7, 79665--INH-sensitive (Mitchinson et al., 1963). INH susceptibilities were confirmed by inoculation of Lowenstein-Jensen slopes containing differing concentrations of INH.
FIG. 5. Organization of the katG locus. The upper bar corresponds to a stretch of the M. tuberculosis chromosome spanning the katG region and the positions of individual cosmids used to construct the map are shown below together with the original shuttle cosmid pBH4 and pYZ55. The locations of some key restriction sites (B, BamnHI; K, KpnI) are shown together with the approximate location of the known genetic markers: fbpB encoding the alpha or 85-B antigen (Matsuo et al., 1988); katG, catalase-peroxidase; LL105, an anonymous .lambda.gtll clone kindly supplied by .ANG. Andersen; MPTR, major polymorphic tandem repeat (Hermans et al., 1992).
FIG. 6A. Nucleotide sequence of the KpnI fragment bearing katg. This sequence has been deposited in the EMBL data-library under accession number X68081. The deduced protein sequence is shown in the one letter code.
FIG 6B. Alignment of the two copies of the 700 bp direct repeat with identities shown as * and--denoting pads introduced to optimize the alignment. (SEQ ID NO:46-47) Numbering refers to the positions in FIG. 2A.
FIG. 7. Distribution of katG in mycobacteria. A. Samples of different bacterial DNAs (1.5 .mu.g) were digested with RsrII, separated by agarose gel electrophoresis and stained with ethidium bromide; lanes 1 and 7, size markers; M. leprae; lane 3, M. tuberculosis H37Rv; lane 4, M. gordonae; lane 5, M. szulaai; lane 6, M. avium. B. Hybridization of the gel in A, after Southern blotting, with a katG specific probe.
FIG. 8. Primary structure alignment of catalase-peroxidases (SEQ ID NO:48-53). The sequences are from M. tuberculosis H37RV, mtkatg (SEQ ID NO:48) ; E.coli, eckatg (SEQ ID NO:49) (Triggs-Raine et al., 1988); S. typhimurium, stkatg (SEQ ID NO:50); B. stearothermophilus, bspera (SEQ ID NO:51) (Loprasert et al., 1988) and yeast cytochrome c peroxidase (SEQ ID NO:52) (ccp; Finzel et al., 1984). The alignment was generated using PILEUP and PRETTY (Devereux et al., 1984) and . denote gaps introduced to maximize the homology. Key residues from the active site and the peroxidase motifs (Welinder, 1991), discussed in the text, are indicated below the consensus.
FIG. 9. Western blot analysis of M. tuberculosis KatG (SEQ ID NO:45) produced in different bacteria. Proteins were separated by SDS-polyacrylamide gel electrophoresis then subjected to immunoblotting, and detection with antiserum raised against BCG, as described in Zhang et al., 1991.
Lane 1, soluble extract of M. tuberculosis H37Rv; lane 2, M. smegmatis MC.sup.2 155 harboring the vector pBAK14; lane 3, MC.sup.2 155 harboring pBAR-KK (katG+); lane 4, E.coli UM2 (katE, katG), lane 5, UM2 harboring pYZ55 (katG.sup.+); lane 6, UM2 harboring pYZ56 (lacZ'::katG).
FIG. 10 represents diagrammatically the PCR strategy used for the study of different M. Leprae isolates showing the coding sequence of rpoB sequence. The sequenced regions are shown by hatched parts. The position and reference of the amplification primers used are indicated on the upper line. The sequencing primers are indicated below it.
FIG. 11 represents (A) the nucleotide sequence of a short region of rpoB (SEQ ID NO: 54) carrying mutations that confer resistance to rifampicin with an indication of the changes of bases in the corresponding alleles and (B) a comparison between the amino acid sequences of domain I of region II of the .beta.-subunit of the RNA polymerase of E.coli (SEQ ID NO: 55) and M. Leprae (SEQ ID NO: 56). The numbers of the residues and the differences in the mutated amino acids have been indicated. The mutated amino acid residues associated with rifampicin resistance as well as the frequency of its occurrences have also been represented.
FIG. 12 shows a complete sequence of the rpoB gene of M. Leprae (SEQ ID NO: 56).
FIG. 13 represents the sequence of part of the rpoB gene of M. tuberculosis (SEQ ID NOS: 59-60).
FIG. 14 represents the sequence of a part of the rpsL gene of M. tuberculosis (SEQ ID NOS: 63-64). Both the sequence of the full rpsL gene of M. Leprae and that of its expression product (SEQ ID NOS: 61-62), that is the S12 protein (whose starting amino acid is noted by 1), are indicated. The positions of the ML51 (SEQ ID NO:40) and ML52 (SEQ ID NO:41) primers, as well as sequences of part of the rpsL gene of M. tuberculosis, are provided below those of M. Leprae. Only those positions that are different and the corresponding amino acid changes are indicated.
FIG. 15 represents the wild DNA sequence of the rpsL gene (SEQ ID NO:65) fragment coding for the S12 protein of the small ribosome subunit, which is responsible for the resistance to streptomycin, as well as the corresponding amino acid sequence of the S12 protein (SEQ ID NO:66).

DETAILED DESCRIPTION OF PREFERRED EMBODIMENT
The recent emergence of large numbers of strains of M. tuberculosis showing multidrug resistance in the United States is a most alarming development given the extreme contagiousness of this organism. This danger has been strikingly illustrated by several small tuberculosis epidemics in which a single patient infected with MDR M. tuberculosis has infected both HIV-positive individuals, prison guards and healthy nursing staff (CDC 1990, 1991; Daley et al., 1992; Snider and Roper, 1992). Given the gravity of the current worldwide HIV epidemic, it is conceivable that if AIDS patients in the West, like those in Africa, were to be infected with MDR M. tuberculosis strains (rather than members of the M. avium/M. intracellulare complex) widespread dissemination of the disease would result.
Isoniazid (INH) is a bactericidal drug which is particularly potent against the tuberculosis group of mycobacteria--Mycobacterium tuberculosis, M. bovis, and M. africanum--and, in consequence, it has been particularly effective in the treatment of tuberculosis. Standard anti-tuberculosis regimens generally include INH and rifampicin, often in combination with the weaker drugs, pyrazinamide, ethambutol or streptomycin. Besides its use in therapy INH is also given to close contacts of patients as a prophylactic measure.
INH-resistant mutants of M. tuberculosis, the agent of the human disease, show two levels of resistance: low (1 to 10 .mu.g/ml) and high (10 to 100 .mu.g/ml). INH-resistance is often associated with loss of catalase activity and virulence. Recently, owing to the AIDS epidemic, increased homelessness and declining social conditions, tuberculosis has reemerged as a major public health problem in developed countries, particularly the USA. An alarming feature of the disease today is the emergence of multiple drug-resistant organisms and rapid nosocomial transmission to health care workers and HIV-infected patients. This has prompted CDC to propose new recommendations for the treatment of multiple resistant strains (at least INH and rifampicin) and the prevention of transmission. To obtain fresh insight into the problem of INH-resistance and to develop a rapid diagnostic test the following study was performed.
Clearly, it is essential to understand the mechanisms of resistance to INH and rifampicin, the main anti-tuberculosis agents, as this will allow novel chemotherapeutic strategies to be developed and facilitate the design of new compounds active against MDR strains.
This invention demonstrates that it is the catalase-peroxidase enzyme, HPI, which is the INH target, and it is suggested that this enzyme alone mediates toxicity. Compelling evidence of this conclusion was obtained by expression of the M. tuberculosis katg gene (SEQ ID NO:45) in a catalase-negative mutant of E.coli as this resulted in this bacterium becoming sensitive to INH. Moreover, the isolation of the M. tuberculosis INH-sensitivity gene, katG, (SEQ ID NO:45) is important as it will facilitate the rapid detection of INH-resistant strains by means of hybridization and PCR-based approaches. The high frequency of katG deletions in clinical strains, as shown here, should simplify this procedure.
Identification of an M. tuberculosis Gene Involved in INH-Sensitivity
A heterologous approach was employed to isolate M. tuberculosis gene(s) involved in INH-sensitivity. BH1 is a spontaneous mutant of the easily transformable M. smegmatis strain MC.sup.2 155 (Snapper et al., 1990), that is resistant to 512 .mu.g/ml of the INH and lacks catalase-peroxidase activity (Heym et al., 1992). As there is a strict correlation between INH-sensitivity and these enzyme activities, transformation of BH1 with a plasmid carrying the appropriate gene from M. tuberculosis should lead to their restoration and concomitant INH-sensitivity.
Consequently, DNA was prepared from a pool of M. tuberculosis shuttle cosmids in Escherichia coli and introduced into BH1 by electro-transformation. Over 1000 kanamycin-resistant transformants were then scored for INH-sensitivity, and four clones that failed to grow on medium containing 32 g/ml of INH, the MIC from wild type strain MC.sup.2 155, were obtained.
After re-transformation of BH1, only one of these, pBH4, consistently conferred the INH-sensitive phenotype. Restriction digests with BamHI, KpnI, NotI, ClaI and HindIII showed the M. tuberculosis chromosomal DNA carried by pBH4 to be about 30 kb in size. A map produced with the last three enzymes is presented in FIG. 1.
When pBH4 was used as a hybridization probe to detect homologous clones in the library, a further eight shuttle cosmids were isolated. On transformation into BH1, five of these (T35, T646, T673, T79, T556) restored INH-sensitivity, and showed similar restriction profiles to pBH4. In particular, a KpnI fragment of 4.5 kb was present in all cases.
Attempts to subclone individual SamHI fragments did not give rise to transformants capable of complementing the lesion in BH1 suggesting that a BamHI site might be located in the gene of interest. In contrast, pBH5, a derivative of pBH4, was constructed by deletion of EcoRI fragments and this showed that a 7 kb segment was not required for restoration of INH-sensitivity.
Transformants harboring shuttle cosmids that complemented the INH-resistant mutation of BHI were examined carefully and the MICs for several antibiotics were established. In all cases, the MIC for INH had been reduced from 512 to 8 .mu.g/ml, a value lower than that of the sensitive strain MC.sup.2 155 (32 .mu.g/ml). This hypersensitive phenotype suggested that the recombinant clones might be overproducing an enzyme capable of enhancing INH-toxicity. Enzymological studies showed that these transformants all produced about 2-fold more peroxidase and catalase than the wild type strain MC.sup.2 155, which is INH-sensitive.
In addition to INH, many MDR-strains of M. tuberculosis are no longer sensitive to rifampicin, streptomycin, ethambutol and pyrazinamide. To examine the possibility that there might be a relationship between resistance to INH and these compounds, the MICs of several drugs for various M. smegmatis strains and their pBH4 transformants were determined, but no differences were found.
Cloning the M. tuberculosis Catalase Gene
A 45-mer oligonucleotide probe was designed based on the primary sequences of highly conserved regions in the catalase-peroxidase enzymes, HPI, of E.coli (Triggs-Raine et al., 1989), and Bacillus stearothermophilus (Loprasert et al., 1988). When genomic blots of M. tuberculosis DNA were probed with this oligonucleotide, specific bands were detected in most cases. As KpnI generated a unique fragment of 4.5 kb that hybridized strongly, this enzyme was used to produce a size selected library in pUC19.
Upon screening with the oligonucleotide probe, an appropriate clone, pYZ55, was obtained. A restriction map of the insert DNA is presented in FIG. 1 where it can be seen that this corresponds exactly to part of pBH4. Independent confirmation was also obtained by cross-hybridization.
By means of various subcloning experiments the smallest fragment expressing M. tuberculosis catalase-peroxidase activity in E.coli was found to be a 2.5 kb EcoRV-KpnI fragment which, as expected, contained a cleavage site for BamHI. Partial DNA sequence analysis showed that the katG gene carried by pYZ56 encodes a catalase-peroxidase enzyme that is highly homologous to the HPI enzymes of E. coli and B. stearothermophilus: M. tuberculosis APLNSWPDNASLDKARRLLWPSKMKYGKKLSWADLIV (SEQ ID NO:12) E. coli *********V***********I*Q***Q*I*****FI (SEQ ID NO:3) B. stearothermophilus**********N******C*GR**RNT*T*--*LGPICS (SEQ ID NO:4) (FIG. 2; Triggs-Raine et al., 1988); (Loprasert et al., 1988). Identical residues are indicated by *. HPI activity was detected in both E.coli and M. smegmatis by staining (see below).
Catalase-peroxidase Involvement in INH-Sensitivity
Having cloned the M. tuberculosis katG gene, (SEQ ID NO:45) it was of immediate interest to investigate the genetic basis of the association between catalase-negativity and isoniazid resistance. A series of constructs was established in the shuttle vector pBAK14 and used to transform the INH-resistant M. smegmatis mutant BH1. Only those plasmids carrying a complete katG gene produced HPI and restored INH-sensitivity. The smallest of these, pBAK14, carried a 2.5 kb EcoRV-KnI fragment thus demonstrating that the 2 kb region upstream of katG was not involved, and that catalase-peroxidase activity alone was sufficient to render mycobacteria susceptible to INH.
Cell-free extracts were separated by non-denaturating polyacrylamide gel electrophoresis and stained for peroxidase and catalase activity. Under these conditions, the M. tuberculosis enzyme gave two bands of peroxidase activity (lane 1) which comigrated with catalase activity (Heym et al., 1992).
When introduced into E.coli, the katG gene (SEQ ID NO:45) directed the synthesis of the same proteins, whereas pYZ56 produced proteins slightly larger in size. This is due to the construction of an in-frame lacZ::katG gene fusion. Activity stains were also performed with cell extracts of M. smegmatis. The presence of the katG gene (SEQ ID NO:45) from the M. tuberculosis in BH1 led to the production of catalase-peroxidase enzyme, which displayed the same electrophoretic mobility as the enzyme made in M. tuberculosis, or in E.coli, and the native HPI of M. smegmatis.
Basis of INH-resistance in M. tuberculosis
It has been known for many years that a subset of INH-resistant strains, particularly those resistant to the highest drug concentrations, are of lower virulence in the guinea pig and devoid of catalase activity. Genomic DNA was prepared from several clinical isolates of M. tuberculosis and analyzed by Southern blotting using the 4.5 kb KpnI fragment (SEQ ID NO:45) as a probe. In two highly resistant strains, B1453 and 24, the catalase gene has been deleted from the chromosome whereas in others (FIG. 3), such as strain 12, showing low level resistance it is still present but not expressed. Additional studies showed that the region immediately prior to katG was highly prone to rearrangements.
M. tuberculosis HPI Renders E.coli Sensitive to INH
To determine whether the HPI enzyme of M. tuberculosis could confer INH sensitivity on E.coli, a series of catalase mutants was transformed with pYZ56 and the MICs determined. Wild type strains were not susceptible to INH, but mutants lacking both endogenous catalase activities, but harboring pYZ56, showed growth inhibition when high levels of INH (500 .mu.g/ml) were present, whereas untransformed strains were insensitive.
For purposes of this invention, a plasmid containing the restriction endonuclease map shown in FIG. 1 was deposited in strain with the National Collection of Cultures of Microorganisms (C.N.C.M.) of the Institut Pasteur, in Paris, France on May 18, 1992, under culture collection accession No. I-1209. This plasmid contains the nucleic acid sequence of the invention, namely, the 4.5 kb KpnI-KpnI fragment (SEQ ID NO:45) of plasmid pYZ56 having the BamHI cleavage site in the fragment.
In general, the invention features a method of detecting the presence of isoniazid-resistant Mycobacterium tuberculosis in a sample including providing at least one DNA or RNA probe capable of selectively hybridizing to isoniazid-sensitive Mycobacterium tuberculosis DNA to form detectable complexes. Detection is carried out with a sample under conditions which allow the probe to hybridize to isoniazid-sensitive Mycobacterium tuberculosis DNA present in the sample to form hybrid complexes and detecting the hybrid complexes as an indication of the presence of isoniazid-sensitive Mycobacterium tuberculosis in the sample. (The term "selectively hybridizing", as used herein, refers to a DNA or RNA probe which hybridizes only to isoniazid-sensitive Mycobacterium tuberculosis and not to isoniazid-insensitive Mycobacterium tuberculosis.) The sample can be comprised of the Mycobacterium tuberculosis cells or a portion of the cells or cell contents enriched in Mycobacterium tuberculosis nucleic acids, especially DNA. Hybridization can be carried out using conventional hybridization reagents. The particular hybridization conditions have not been found to be critical to the invention.
More particularly, DNA sequences from Mycobacterium tuberculosis can be analyzed by Southern blotting and hybridization. The techniques used for the present invention are described in Maniatis et al. (1989). DNA fragments can be separated on agarose gels and denatured in situ. The fragments can then be transferred from the gel to a water insoluble solid, porous support, such as a nitrocellulose filter, a nylon membrane, or an activated cellulose paper, where they are immobilized for example, the Hybond.RTM. membrane commercialized by Amersham can be used. After prehybridization to reduce non-specific hybridization with the probe, the solid support is hybridized to the nucleic acid probe of the invention. The solid support is washed to remove unbound and weakly binding probe, and the resulting hybrid duplex molecule is examined. A convenient alternative approach is to hybridize oligonucleotides to the DNA denatured in the gel.
The amount of labeled probe which is present in the hybridization solution will vary widely, depending upon the nature of the label, the amount of the labeled probe which can reasonably bind to the filter, and the stringency of the hybridization. Generally, substantial excesses of the probe over stoichiometric will be employed to enhance the rate of binding of the probe to the fixed DNA.
Various degrees of stringency of hybridization can be employed. The more severe the conditions, the greater the complementarity that is required for hybridization between the probe and the polynucleotide for duplex formation. Severity can be controlled by temperature, probe concentration, probe length, ionic strength, time, and the like. Conveniently, the stringency of hybridization is varied by changing the polarity of the reactant solution. Temperatures to be employed can be empirically determined or determined from well known formulas developed for this purpose.
Unlike Southern hybridization where DNA fragments are transferred from an agarose gel to a solid support, the method of the invention can also be carried out by oligonucleotide hybridization in dried agarose gels. In this procedure, the agarose gel is dried and hybridization is carried out in situ using an oligonucleotide probe of the invention. This procedure is preferred where speed of detection and sensitivity may be desirable. The procedure can be carried out on agarose gels containing genomic or cloned DNA of Mycobacterium tuberculosis.
In addition, the method of this invention can be carried out by transfer of Mycobacterium tuberculosis DNA from polyacrylamide gels to nylon filters by electroblotting. Electroblotting may be desirable where time is of the essence, because electroblotting is typically faster than capillary blotting developed to transfer DNA from agarose gels. This method can be carried out in conjunction with UV-crosslinking. The polyacrylamide gel containing the samples to be tested is placed in contact with an appropriately prepared nylon filter. These are then sandwiched into an electro-blotting apparatus and the DNA is transferred from the gel onto the filter using electric current. After a buffer rinse, the filter is ready to be prehybridized and hybridized or UV-crosslinked.
The method of the invention can be carried out using the nucleic acid probe of the invention for detecting Mycobacterium tuberculosis resistant to isoniazid. The probe can be detected using conventional techniques. The method of the invention can also detect point mutations in the KatG gene, (SEQ ID NO:45) as well as a partial deletion of that gene.
The nucleotides of the invention can be used as probes for the detection of a nucleotide sequence in a biological sample of M. tuberculosis. The polynucleotide probe can be labeled with an atom or inorganic radical, most commonly using a radionuclide, but also perhaps with a heavy metal. Radioactive labels include .sup.32 p, .sup.3 H, .sup.14 C, or the like. Any radioactive label can be employed, which provides for an adequate signal and has sufficient half-life. Other labels include ligands that can serve as a specific binding member to a labeled antibody, fluorescers, chemiluminescers, enzymes, antibodies which can serve as a specific binding pair member for a labeled ligand, and the like. The choice of the label will be governed by the effect of the label on the rate of hybridization and binding of the probe to the DNA or RNA. It will be necessary that the label provide sufficient sensitivity to detect the amount of DNA or RNA available for hybridization.
In preferred embodiments of the invention, the probe is labeled with a radioactive isotope, e.g., .sup.32 p or 125I, which can be incorporated into the probe, e.g., by nick-translation.
In other preferred embodiments, the probe is labeled with biotin, which reacts with avidin to which is bonded a chemical entity which, when the avidin is bonded to the biotin, renders the hybrid DNA complex capable of being detected, e.g., a fluorophore, which renders the hybrid DNA complex detectable fluorometrically; an electron-dense compound capable of rendering the hybrid DNA complexes detectable by an electron microscope; an antibody capable of rendering the hybrid DNA complexes immunologically detectable; or one of a catalyst/substrate pair capable of rendering the hybrid DNA complexes enzymatically detectable. Prior to contacting the bacteria with the probe, the M. tuberculosis bacteria can be lysed to release their DNA, which is then denatured and immobilized on an appropriate solid, DNA-binding support, such as a nitrocellulose membrane.
Another detection method, which does not require the labeling of the probe, is the so-called sandwich hybridization technique. In this assay, an unlabeled probe, contained in a single-stranded vector, hybridizes to isoniazid-sensitive Mycobacterium tuberculosis DNA, and a labeled, single-stranded vector, not containing the probe, hybridizes to the probe-containing vector, labeling the whole hybrid complex.
The sequences of the invention were derived by dideoxynucleotide sequencing. The base sequences of the nucleotides are written in the 5'.fwdarw.3' direction. Each of the letters shown is a conventional designation for the following nucleotides:
A Adenine
G Guanine
T Thymine
C Cytosine.
The nucleotides of the invention can be prepared by the formation of 3'.fwdarw.5' phosphate linkages between nucleoside units using conventional chemical synthesis techniques. For example, the well-known phosphodiester, phosphotriester, and phosphite triester techniques, as well as known modifications of these approaches, can be employed. Deoxyribonucleotides can be prepared with automatic synthesis machines, such as those based on the phosphoramidite approach. Oligo- and polyribonucleotides can also be obtained with the aid of RNA ligase using conventional techniques.
The nucleotides of the invention are in a purified form. For instance, the nucleotides are free of human blood-derived proteins, human serum proteins, viral proteins, nucleotide sequences encoding these proteins, human tissue, and human tissue components. In addition, it is preferred that the nucleotides are free of other nucleic acids, extraneous proteins and lipids, and adventitious microorganisms, such as bacteria and viruses. This invention of course includes variants of the nucleotide sequences of the invention or serotypic variants of the probes of the invention exhibiting the same selective hybridization properties as the probes identical herein.
The nucleotide sequences of the present invention can be employed in a DNA amplification process known as the polymerase chain reaction (PCR). See. e.g., Kwok et al. (1987). PCR is advantageous because this technique is rapid.
DNA primer pairs of known sequence positioned 10-300 base pairs apart that are complementary to the plus and minus strands of the DNA to be amplified can be prepared by well known techniques for the synthesis of oligonucleotides. One end of each primer can be extended and modified to create restriction endonuclease sites when the primer is annealed to the PBMC DNA. The PCR reaction mixture can contain the PBMC DNA, the DNA primer pairs, four deoxyribonucleoside triphosphates, MgCl.sub.2, DNA polymerase, and conventional buffers. The DNA can be amplified for a number of cycles. It is generally possible to increase the sensitivity of detection by using a multiplicity of cycles, each cycle consisting of a short period of denaturation of the PBMC DNA at an elevated temperature, cooling of the reaction mixture, and polymerization with the DNA polymerase.
Amplified sequences can be detected by the use of a technique termed oligomer restriction (OR). Single-strand conformation polymorphism (SSCP) analysis can be used to detect DNA polymorphisms and point mutations in a variety of positions in DNA fragments. See, Saiki et al. (1985); Orita et al. (1989). For example, after amplification, a portion of the PCR reaction mixture can be separated and subjected to hybridization with an end-labeled nucleotide probe, such as a .sup.32 p labelled adenosine triphosphate end-labeled. probe. In OR, an end-labeled oligonucleotide probe hybridizes in solution to a region of the amplified sequence and, in the process, reconstitutes a specific endonuclease site. Thus, hybridization of the labeled probe with the amplified katG sequence yields a double-stranded DNA form that is sensitive to selective restriction enzyme digestion. After restriction with an endonuclease, the resulting samples can be analyzed on a polyacrylamide gel, and autoradiograms of the portion of the gel with the diagnostic labeled fragment can be obtained. The appearance of a diagnostic fragment (e.g., 10-15 bases in length) in the autoradiogram indicates the presence of katG sequences (SEQ ID NO:45) in the PBMCS.
Since it may be possible to increase the sensitivity of detection by using RNA instead of chromosomal DNA as the original template, this invention contemplates using RNA sequences that are complementary to the DNA sequences described herein. The RNA can be converted to complementary DNA with reverse transcriptase and then subjected to DNA amplification.
EXPERIMENTAL PROCEDURES
Bacterial strains and plasmids
Table 1 outlines the properties of the bacterial strains and plasmids used in this invention.
TABLE 1______________________________________Bacterial Strains And Plasmids Characteristics______________________________________Strains/plasmidsE. coli NM554E. coli TG1 supE hsd5 thi delta (lac-proAB) [traD36 proAB+ lacI.sup.g lacZ delta M15]E. coli UM2 KatEE. coli UM255 KatEM. tuberculosis H37Rv Virulent strain originally isolated from tuberculosis patientM. tuberculosis 12 Clinical isolate resistant to low levels of INH (1-2 .mu.g/ml)M. tuberculosis B1453 Clinical isolate resistant to high levels of INH (>50 .mu.g/ml)M. tuberculosis 24 Clinical isolate resistant to high levels of INH (>50 .mu.g/ml)M. tuberculosis 79112 Clinical isolate sensitive to INHM. tuberculosis 12646 Clinical isolate sensitive to INHM. tuberculosis 79665 Clinical isolate sensitive to INHM. smegmatis MC.sup.2 155 MC.sup.2 6 hetM. smegmatis BH1 MC.sup.2 155 het katGPlasmidspBH4 Shuttle cosmid, katG+, based on pYUB18pBH5 Deleted version of pBH4, katG+, (7 kb- EcoRI)pYZ55 pUC19 derivative with 4.5 kb KpnI frag- ment, kat+pYZ56 pUC19 derivative with 2.5 kb EcoRV-KpnI fragment (kat+)pYZ57 pUC19 derivative with 3.1 kb KpnI- BamHI fragment, kat-pBAK14 Mycobacterial shuttle vector (Zhang et al., 1991)pBAK15 Mycobacterial shuttle vector carrying 4.5 kb KpnI fragment (kat+)pBAK16 Mycobacterial shuttle vector carrying 2.5 kb EcoRV-KpnI fragment (kat.sup.+)pBAK17 Mycobacterial shuttle vector carrying 3.1 kb KpnI-BamHI fragment (kat-)______________________________________
The M. tuberculosis H37 RV genomic library was constructed in the shuttle cosmid pYUB18 (Snapper et al., 1988) and kindly supplied by Dr. W. R. Jacobs. Other shuttle vectors employed were pYUB12 (Snapper et al., 1988) and pBAK14 (Zhang et al., 1991).
Microbiological Techniques and Enzymology
Details of antibiotics used, growth conditions, enzymology and MIC determinations can be found in Heym et al., (1992).
Nucleic Acid Techniques
Standard protocols were used for subcloning, Southern blotting, DNA sequencing, oligonucleotide biosynthesis, etc. (Maniatis et al., 1989; Eiglmeier et al., 1991).
Activity Staining
The preparation of cell-free extracts of E.coli and mycobacteria has been described (Heym et al., 1992; Zhang et al., 1991). Native protein samples were separated by polyacrylamide gel electrophoresis as described by Laemmli (1970) except that SDS was omitted from all buffers, samples were not boiled and betamercaptoethanol was not included in the sample buffer. After electrophoresis of 50-100 .mu.g protein samples on 7.5% polyacrylamide gels, catalase activity was detected by soaking the gel in 3mM H.sub.2 O.sub.2 for 20 minutes with gentle shaking. An equal volume of 2% ferric chloride and 2% potassium ferricyanide was added and clear bands of catalase activity revealed by illumination with light. Peroxidase activity was detected as brown bands after soaking gels in a solution containing 0.2-0.5 mg/ml diaminobenzidine and 1.5 mM H.sub.2 O.sub.2 for 30-120 minutes.
To generate a highly toxic compound it seems most likely that the M. tuberculosis HPI enzyme peroxidatively activates INH (Youatt, 1969; Gayathri-Devi et al., 1975). Now that the katG gene (SEQ ID NO:45) has been isolated and characterized, it should be possible to make new derivatives of INH, which can be activated in a similar manner.
EXAMPLE 1
Point Mutations in the katG Gene Associated with the Isoniazid-Resistance of M. tuberculosis
It has been shown in a recent study that the catalase-peroxidase of Mycobacterium tuberculosis, encoded by the katG gene, is involved in mediating the toxicity of the potent anti-tuberculosis drug isoniazid or INH. Mutants resistant to clinical levels of INH show reduced catalase-peroxidase activity and, in some cases, this results from the deletion of the katG gene (SEQ ID NO:45) from the chromosome. Transformation of INH-resistant strains of Mycobacterium smegmatis and M. tuberculosis with the cloned katG gene leads to restoration of drug-sensitivity. Expression of katG (SEQ ID NO:45) in some strains of Escherichia coli renders this naturally resistant organism susceptible to high concentrations of INH.
As some INH-resistant clinical isolates of M. tuberculosis have retained an intact katG gene, the molecular basis of their resistance was investigated. This study was facilitated by the availability of the nucleotide sequence of a 4.7 kb KpnI fragment from the katG region (SEQ ID NO:45) of the chromosome as this allowed primers suitable for PCR analysis to be designed. Eleven pairs of oligonucleotide primers were synthesized (SEQ ID NOS:5-26) (see Table 2) and used to generate PCR-products, of around 280 bp, that covered the complete katG gene (SEQ ID NO:45) and some of the flanking sequences. In control experiments all experiments all eleven primer pairs generated PCR products of the expected size, highly suitable for SSCP-analysis, so a panel of 36 INH-resistant strains of M. tuberculosis, of Dutch or French origin, was examined. Many of these strains are multidrug resistant and were isolated from patients who were HIV-seropositive.
Table 2__________________________________________________________________________Sequences of primer pairs used for PCR-SSCP analysis of the katG gene(SEQ ID NO:45) of M.tuberculosis__________________________________________________________________________Primer Pair # 1 5' 3' Length G+C(%) Tm ProductionOLIGO1: GCGGGGTTATCGCCGATG (SEQ ID NO:5) 1765 1782 18 288 61.8OLIGO2: GCCCTCGACGGGGTATTTC (SEQ ID NO:6) 2052 19034 61.9Primer Pair # 2OLIGO1: AACGGCTGTCCCGTCGTG (SEQ ID NO:7) 2008 18025 300 61.9OLIGO2: GTCGTGGATGCGGTAGGTG (SEQ ID NO:8) 2307 19289 61.9Primer Pair # 3OLIGO1: TCGACTTGACGCCCTGACG (SEQ ID NO:9) 2169 19187 280 61.9OLIGO2: CAGGTCCGCCCATGACAG (SEQ ID NO:10) 2448 18431 61.9Primer Pair # 4OLIGO1: CCACAACGCCAGCTTCGAC (SEQ ID NO:11) 2364 19382 284 61.9OLIGO2: GGTTCACGTAGATCAGCCCC (SEQ ID NO:12) 2647 20628 61.9Primer Pair # 5OLIGO1: GCAGATGGGGCTGATCTACG (SEQ ID NO:13) 2622 20641 288 51.9OLIGO2: ACCTCGATGCCGCTGGTG (SEQ ID NO:14) 2909 18892 51.9Primer Pair # 6OLIGO1: GCTGGAGCAGATGGGCTTG (SEQ ID NO:15) 2829 19847 286 61.9OLIGO2: ATCCACCCGCAGCGAGAG (SEQ ID NO:16) 3114 18097 61.9Primer Pair # 7OLIGO1: GCCACTGACCTCTCGCTG (SEQ ID NO:17) 3088 18105 297 61.9OLIGO2: CGCCCATGCGGTCGAAAC (SEQ ID NO:18) 3384 18367 61.9Primer Pair # 8OLIGO1: GCGAAGCAGATTGCCAGCC (SEQ ID NO:19) 3304 19322 285 61.9OLIGO2: ACAGCCACCGAGCACGAC (SEQ ID NO:20) 3588 18571 61.9Primer Pair # 9OLIGO1: CAAACTGTCCTTCGCCGACC (SEQ ID NO:21) 3549 20568 281 61.9OLIGO2: CACCTACCAGCACCGTCATC (SEQ ID NO:22) 3829 20810 61.9Primer Pair # 10OLIGO1: TGCTCGACAACGCGAACCTG (SEQ ID NO:23) 3770 20789 280 61.9OLIGQ2: TCCGAGTTGGACCCGAAGAC (SEQ ID NO:24) 4049 20030 61.9Primer Pair # 11OLIGO1: TACCAGGGCAAGGATGGCAG (SEQ ID NO:25) 3973 20992 280 61.9OLIGO2: GCAAACACCAGCACCCCG (SEQ ID NO:26) 4252 18235 61.9{#courier10}__________________________________________________________________________
Two of them gave no PCR fragment, with any of the primers used, indicating that katG (SEQ ID NO:45) had been deleted. The remaining 34 strains all yielded the expected PCR products and these were analyzed on SSCP gels so that possible point mutations could be detected. In 20 cases, abnormal strand mobility was observed, compared to that of katG (SEQ ID NO:45) from drug-sensitive M. tuberculosis, suggesting that mutational events had indeed occurred. The approximate locations of the mutations, as delimited by the PCR primers, are shown in Table 3.
TABLE 3__________________________________________________________________________Preliminary results of PCT-SSCP analysis of katG from M. tuberculosisstrainsx denotes altered mobility; del denotes deletion 1 2 3 4 5 6 7 MIC 1765- 2008- 2169- 2364- 2622- 2829- 3088N.degree. Strain (INH) 2034 2289 2431 2628 2892 3097 3367__________________________________________________________________________ 1/37 9488 1 x2 9577 13 9112 104 9247 15 9200 1 x6 9116 1 7/31 9106 1 x x8 9291 1 x 9/10 9412 1 x11/12 9435 113 9428 1 x14 9441 1 x x15/16 9444 1 x x17/18 9445 119/20 9330 0,2 x21/22 9420 0,223 9262 0,224/38 9523 1 x25 9592 10 x26 9553 1027 9485 10 x28 9181 1 x x29 9363 1 x30 9465 1 x32 9178 0,233 9468 0,234 9218 0,233 9468 0,234 9218 0,235 9503 0,239 9582 1 x41 H37Rv --42 Ass --43 Mou --44 13632 >20 del del del del del del del45 13549 >5 del del del del del del del46 13749 >2047 14006 10 x48 13711 >549 13681 >5 x50 14252 >5__________________________________________________________________________
On examination of a 200 bp segment of the katG gene from five independent strains (9188, 9106, 9441, 9444, 9363), a single base difference was found. This was the same in all cases, a G to T transversion at position 3360, resulting in the substitution of Arg-461 by Leu. Thus, in addition to inactivation of katG, INH-resistance can stem from mis-sense mutations that result in an altered catalase peroxidase. This mutation may define a site of interaction between the drug and the enzyme. The results of DNA sequence studies with the remaining mutants are eagerly awaited.
Another conclusion that can be drawn from this study concerns the molecular basis of the multidrug resistance associated with various M. tuberculosis strains. The same mutations are found irrespective of whether a given patient is seropositive or seronegative for HIV. For example, strain 9291, isolated from an HIV-seropositive tuberculosis patient, harbors mutations conferring resistance to INH, rifampin and streptomycin in the katG (R461L), rpoB (S425L) and rpsL (K42R) genes, respectively. The same mutations have been found separately, or in combination, in strains from HIV-seronegative individuals. This means that, for the set of strains studied, there is no novel, single mechanism conferring resistance to several drugs, but rather, multidrug resistance results from the accumulation of mutations in the genes for distinct drug targets.
EXAMPLE 2
Nucleotide Sequence and Chromosomal Location of the katG Locus of M. tuberculosis
Bacterial strains, plasmids and growth conditions. The following bacterial strains from our laboratory collections were used in this study: M. tuberculosis H37Rv: M. smegmatis MC.sup.2 155 (Snapper et al., 1990); E.coli K-12 UM2 (katE katG; Mulvey et al., 1988). The recombinant plasmids, pYZ55 (pUCl9, katG.sup.+), pYZ56 (pUCl9, lacZ'::katG) and the shuttle clones, pBH4 (pYUB18, katG.sup.+) and PBAK-KK- (pBAK14, katG.sup.+) have been described recently (Zhang et al. 1992, Nature) and the katG locus of M. tuberculosis is schematized in FIG. 5. Mycobacteria were grown at 37.degree. C. in Middlebrook 7H9 medium, while E.coli strains were cultivated in L-broth, with appropriate enrichments and antibiotics.
Nucleic acid techniques. Standard techniques were employed for the preparation, labelling and hybridization of DNA (Eiglmeier et al. 1991; Zhang et al. 1992, Infect. Immun.; Zhang et al. 1992, Nature). A shotgun library of random fragments of pYZ55 was prepared in M13mp18 as described previously (Garnier et al., 1986) and sequenced using the modified dideoxy technique (Biggin et al. 1983). Sequences were compiled and assembled into contigs using SAP, and analyzed with NIP, SIP and PIP (Staden 1987) running on a Vax 3100 workstation. Gap closure was obtained by using synthetic oligonucleotide primers, synthesized on an ABI 381 apparatus, and T7 DNA polymerase (Pharmacia) to obtain sequences directly from pYZ55. To search for related sequences in the GenBank database (release 73.1) the FASTA (Pearson et al. 1988) and BLAST (Altschul et al. 1990) programs were used. The PROSITE (Bairoch 1992) catalog was screened to detect possible motifs present in protein sequences and alignments were done with the PILEUP and PRETTY modules of the GCG sequence analysis package (Devereux et al. 1984).
Western blotting and catalase-peroxidase activity staining. Immunoblotting of polypeptides resolved by SDS-polyacrylamide gel electrophoresis and detection with polyclonal antibodies (purchased from DAKO) raised against M. bovis BCG, were as described (Zhang et al. 1992, Infect. Immun., Nature, Mol. Microbiol.). Procedures for detecting catalase and peroxidase activities have been outlined recently (Heym et al. 1992; Zhang et al. 1992, Nature).
RESULTS
Nucleotide Sequence of the katG Locus (SEQ ID NO:45) of M. tuberculosis.
In previous studies, the complete katG gene (SEQ ID NO:45) was cloned independently in E.coli on a shuttle cosmid, pBH4, and on a 4.5 kb KpnI restriction fragment thus giving rise to pYZ55 (FIG. 5; Zhang et al. 1992, Nature). The structural gene for catalase-peroxidase was subsequently localized to a 2.5 kb EcORV-KpnI fragment by sub-cloning. To deduce the primary structure of this important enzyme and thereby gain some insight into its putative role in the conversion of INH into a potent anti-tuberculous derivative, the nucleotide sequence of the complete insert from pYZ55 was determined. This was achieved by the modified dideoxy-shotgun cloning procedure (Biggin et al. 1993) and gaps between the contigs were closed by using specific primers.
On inspection of the resultant sequence which is shown in FIG. 6A, the 4.5 kb fragment (SEQ ID NO:45) was found to contain 4795 nucleotides with an overall dG+dC content of 64.4%. When this was analyzed for the presence of open reading frames, with high coding-probability values, a single candidate was detected and, from its size, composition and location, this was identified as katG (SEQ ID NO:45). The absence of any additional open reading frames, on either strand of the KIn fragment, ruled out the possibility that genes other than katG were involved in conferring INH-susceptibility.
Further analysis of the sequence showed katG (SEQ ID NO:45) to be preceded by two copies of a 700 bp direct repeat which were 68% identical, with the longest stretch of identity comprising 58 bp (FIG. 6B) (SEQ ID NO:46-47). When the databases were screened with this sequence no significant homologies were detected. To test the possibility that it could correspond to a new repetitive element in M. tuberculosis, a 336 bp probe, encompassing the 58 bp repeat, was used to probe a partially-ordered cosmid library. Positive hybridization signals were only obtained from clones that were known to carry katG. Likewise, a single restriction fragment was detected in Southern blots of M. tuberculosis DNA digested with restriction enzymes BamHI, kpnI and RsrII thereby indicating that this repetitive sequence is not dispersed.
Chromosomal location of katG (SEQ ID NO:45). As part of the M. tuberculosis genome project, most of the genes for which probes are available have been positioned on the contig map. From the series of overlapping cosmids shown in FIG. 5 it can be seen that the markers linked to katG are LL105 and fbpB encoding an anonymous antigen and the putative fibronectin binding protein, or alpha antigen (Matsuo et al. 1988), respectively. None of the known insertion sequences IS6110 and IS1081 (Collins et al. 1991; McAdam et al. 1990; Thierry et al. 1990, J. Clin. Microbiol.; Thierry et al. 1990, Nucleic Acids Res.), map to this area of the chromosome although the region upstream of katG (SEQ ID NO:45) is densely populated with copies of the major polymorphic tandem repeat, MPTR (Hermans et al. 1992; Zhang and Young 1993).
Presence of katG (SEQ ID NO:45) homologues in other mycobacteria. INH is exquisitely potent against members of the tuberculosis complex yet shows little, if any, activity against other mycobacteria. To determine whether genes homologous to katG (SEQ ID NO:45) were present in other mycobacteria Southern blots of DNA digested with RsrII were hybridized with a probe prepared from a 2.5 kb EcoRV-KpnI restriction fragment carrying katG (SEQ ID NO:45) from M. tuberculosis. Under conditions of high stringency good signals were obtained from M. leprae and M. avium (FIG. 7) while barely discernible hybridization was observed with M. gordonae and M. szulgai. It has been shown recently that katG homologues are also present in M. Smegmatis and M. aurum (Heym et al. 1992).
Predicted properties of catalase-peroxidase from M. tuberculosis. The primary structure of catalase-peroxidase, deduced from the nucleotide sequence of katG (SEQ ID NO:45), is shown in FIG. 6 (SEQ ID NO:49). The enzyme is predicted to contain 735 amino acids, and to display a molecular weight of 80,029 daltons. A protein of this size has been observed in M. tuberculosis (SEQ ID NO:48), and both recombinant M. smegmatis and E.coli (SEQ ID NO:49) (see below).
Primary structures are available for several other bacterial catalase-peroxidases including those from E.coli, salmonella tylhimurium (SEQ ID NO:50) and Bacillus stearothermohilus (SEQ ID NO:51) (Loewen et al. 1990; Loprasert et al. 1988; Triggs-Raine et al. 1988) and these have been shown to be distantly related to yeast cytochrome c peroxidase (SEQ ID NO:52) (Welinder 1991). As the crystal structure of the latter has been determined (Finzel et al. 1984) this can be used to interpret the sequences of the bacterial enzymes. The M. tuberculosis enzyme (SEQ ID NO:48) shows 53.3% conservation with the enterobacterial HPI enzymes, and shares 45.7% identity with the protein from B. stearothermophilus(SEQ ID NO:51). An alignment of the sequences of these four enzymes is shown in FIG. 8 (SEQ ID NOS:48-51), along with that of yeast cytochrome c peroxidase (SEQ ID NO:52) (Welinder 1991). It is apparent that the NH.sub.2 terminus, which has no counterpart in the yeast enzyme, is the most divergent part suggesting that this domain of the protein can tolerate extensive deviation and is not required for catalysis. Experimental support for this interpretation is provided in the form of a LacZ-KatG fusion protein which contains an additional 40 amino acid residues (FIG. 9, lane 6; Zhang et al. 1992, Nature). Addition of this NH.sub.2 -terminal segment does not noticeably interfere with either the catalase or peroxidase reactions effected by KatG (SEQ ID NO:48) as judged by activity staining (Zhang et al. 1992, Nature). Bacterial catalase-peroxidases are believed to have evolved by means of a gene duplication event and consist of two modules, both showing homology to the yeast enzyme, fused to a unique NH.sub.2 -terminal sequence of about 50 amino acid residues (Welinder 1991). The M. tuberculosis enzyme (SEQ ID NO:48) conforms to this pattern and when searched for internal homology using SIP (Staden 1987) it was clear that the region between residues 55-422 was related to the carboxy terminal domain, consisting of amino acids 423-735. Only one of the two active site motifs typical of peroxidases, present in the PROSITE catalog (Bairoch 1992) was found when the M. tuberculosis catalase-peroxidase. primary structure (SEQ ID NO:48) was screened as there are two deviations from the consensus around His.sup.269 where the second motif should be. (Consensus pattern for peroxidase 1: [DET]-[LIVMT]-x(2)-[LIVM]-[LIVMSTAG]-[SAG]-[LIVMSTAG]-H-[STA]-[LIVMFY](SEQ ID NO:27); consensus pattern for peroxidase 2: [SGAT]-x(3)-[LIVMA]-R-[LIVMA]-x-[FW]-H-x-[SAC](SEQ ID NO:28); (Bairoch 1992). In addition, a possible ATP-binding motif (G-x-x-x-x-G-K-T) was detected (Balroch 1992) but as this partially overlaps the active site its presence may be purely fortuitous (FIG. 8).
By analogy with yeast cytochrome c peroxidase (SEQ ID NO:52) (Welinder 1991), it was possible to predict a number of structurally and catalytically important residues all of which are located in the NH.sub.2 -terminal repeat. His.sup.269 should serve as the fifth ligand of the heme-iron while Asp.sup.380 should be its hydrogen-bonded partner. Other residues predicted to be involved in active site modulation and H.sub.2.sub.2 O.sub.2 binding are Arg.sup.104, Trp.sup.107, His.sup.108, Asn.sup.138, Thr.sup.274 and His.sup.275 (FIG. 4). According to Welinder's predictions (Welinder 1991), Trp.sup.320 should be a key residue and be required for forming the protein-radical site (Sivaraja et al. 1989).
Antibody response to M. tuberculosis KatG (SEQ ID NO:48). To evaluate the possible value of KatG (SEQ ID NO:48) as an immunogen, Western blots were probed with anti-serum raised against M. bovis BCG in rabbits. As shown in FIG. 9, the 80 kD catalase-peroxidase is one of the prominent antigens recognized in cell-free extracts of M. tuberculosis, and M. smegatis expressing the cloned katG gene (SEQ ID NO:45) (lanes 1, 3). Likewise, on introduction of the gene into E.coli significant levels of catalase-peroxidase were produced a striking increase in expression was obtained from the lacZ'-katG gene fusion which directed the synthesis of an 85 kD fusion protein (FIG. 9, lane 6).
The aim of the present study was to determine the nucleotide sequence of the katG gene (SEQ ID NO:45) and to use the information obtained to try and understand how its product (SEQ ID NO:48) mediates the INH-susceptibility of M. tuberculosis and, possibly, to explain the apparent instability of the katg region of the genome (SEQ ID NO:45). Repetitive DNA is often a source of chromosomal rearrangements and analysis of the DNA sequence upstream of katG (SEQ ID NO:45) revealed two copies of a 700 bp direct repeat (SEQ ID NO:46-47). Since this element appears to be confined to this locus it is unlikely to serve as a target for an event, such as homologous recombination, which could lead to the deletion of the gene that is observed so frequently (Zhang et al. 1992, Nature; Zhang and Young 1993). Likewise, as a 70 kb stretch of the chromosome of M. tuberculosis H37Rv, encompassing katG (SEQ ID NO:45), is devoid of copies of IS6110 and IS1081, these insertion sequences do not appear to be likely sources of instability. Rather, the presence of a cluster of major polymorphic tandem repeats, MPTR (FIG. 5; Hermans et al. 1992) situated upstream of katG (SEQ ID NO:45), suggests that this might act as a recombinational hotspot. It may remove both the MPTR cluster and katg (SEQ ID NO:45) (Zhang and Young 1993). The availability of the sequence of the katG (SEQ ID NO:45) region will allow primers suitable for the polymerase chain reaction to be designed and thus facilitate studies aimed at both rapid detection of INH-resistance and understanding the molecular basis of chromosomal instability.
Perhaps the most intriguing feature of the M. tuberculosis catalase-peroxidase (SEQ ID NO:48) is its ability to mediate INH-susceptibility. In our current working hypothesis, the drug interacts with the enzyme and is converted by the peroxidase activity into a toxic derivative which acts at a second, as yet unknown, site (Zhang et al. 1992, Nature). Although horse radish peroxidase can effect this reaction (Pearson et al. 1988; Shoeb et al. 1985), and produce hydroxyl and organic free radicals, very few bacteria, including other mycobacteria, are sensitive to INH. This is intriguing as they contain genes homologous to katG (SEQ ID NO:45) (FIG. 7). One explanation for this could be provided by the fact that most bacterial contain two catalases, one of which is a broad spectrum enzyme endowed with peroxidase activity, and that the second catalase, by preferentially removing H.sub.2 O.sub.2, limits the ability of the catalase-peroxidase to oxidize INH. As M. tuberculosis lacks the latter activity its KatG enzyme (SEQ ID NO:48) can convert INH to the lethal form without competition for the electron acceptor.
Alternatively, there may be some unique features of the M. tuberculosis enzyme which promote toxicity or favor the interaction with the drug. Examination of the primary structures of the bacterial catalase-peroxidases was not instructive in this respect as they all share extensive sequence identities and contain two motifs characteristic of the active sites of peroxidases. Furthermore, it has been shown recently that expression of the E.coli katG gene (SEQ ID NO:49) can partially restore INH-susceptibility to drug-resistant mutants of M. tuberculosis suggesting that the endogenous enzyme may not possess any drug-specific properties (Zhang et al. 1993). Sequence comparison with the cytochrome c peroxidase (SEQ ID NO:52) from yeast has provided important information about the structural and functional organization of the KatG protein (SEQ ID NO:48) and led to the identification of the putatively-important catalytic residues (FIG. 8).
Now that the complete sequence of katg (SEQ ID NO:48) is available it will be possible to test some of these hypotheses by site-directed mutagenesis and to overproduce the enzyme so that detailed analysis of the enzymatic reaction, and its products, can be performed in vitro. Likewise, it should be a relatively simple matter to isolate mutants that have retained enzymatic activity but are unable to bind or oxidize INH. Of particular interest is the repetitive structure of the enzyme and the prediction that the NH.sub.2 -terminal repeat contains the active site for peroxidases. This raises the possibility that katG (SEQ ID NO:45) genes, mutated, or truncated at the 3'-end, could arise. It is conceivable that their products, lacking the normal COOH-terminus which may be required for subunit-subunit interactions (Welinder 1991), would be unstable but still retain low enzyme activity. They would thus confer an intermediate level of INH-susceptibility, between that of katG.sup.+ strains and mutants completely lacking the gene, as is often observed in clinical settings.
The invention may of course make use of a part of the above described 2.5 kb EcoRV-KpnI fragment, said part being nonetheless sufficiently long to provide for the selectivity of the in vitro detection of a Mycobacterium tuberculosis resistant to isoniazid. The invention also relates to a kit for detecting multidrug resistant variants of M. tuberculosis wherein the kit comprises:
(a) a container means containing a probe for the gene encoding drug resistance; and
(b) a container means containing a control preparation of nucleic acid.
Needless to say that use can be made of any detection method alternative bringing into play the nucleodic sequence specific of nucleic acids of a Mycobacterium resistant to isoniazid, e.g. a method using an amplification technique and primers, whereby said primers may either be contained within said specific nucleotidic sequence, in order to provide for amplification fragments containing at least a part of the nucleotide sequence of the above mentioned probe, nonetheless sufficiently long to provide for the selectivity of the in vitro detection of a Mycobacterium tuberculosis resistant to isoniazid, and finally detecting a possible mutation in any of the amplified sequences.
A preferred process alternative (oligotyping) for the detection of resistance to the selected antibiotic comprises:
fragmenting the relevant gene or part thereof likely to carry the mutation into a plurality of fragments, such as by digestion of said relevant gene by selected restriction enzymes,
hybridizing these fragments to complementary oligonucleotide probes, preferably a series of labelled probes recognizing under stringent conditions, all of the parts of the relevant gene of a corresponding control DNA of a strain non-resistant to the corresponding antibiotic,
and relating the absence of hybridization of at least one of said oligonucleotide probes to any of the DNA fragments of the relevant gene of the mycobacterium under study as evidence of the presence of a mutation and, possibly, of a resistance to the corresponding antibiotic, particularly as compared to the runing of the test under the same conditions with the same oligonucleotides on the relevant gene(s) obtained from a strain (strains) not resistant to said antibiotic.
Another process alternative (SSCP analysis, i.e. analysis of Single Stranded Conformation Polymorphisms) comprises:
digesting the DNA to be analyzed, particularly of the relevant gene,
amplifying the fragments obtained, e.g. by PCR,
recovering the amplified fragments, and
separating them from one another according to sizes, e.g. by causing them to migrate, for instance on an electrophoretic gel,
comparing the sizes of the different fragments with those obtained from the DNA(S) of one or several control strains not resistant to the antibiotic, which had been subjected to a similar assay, and
relating the polymorphism possibly detected to the existence of a mutation in the relevant gene, accordingly to a possible resistance to the corresponding antibiotic of the strain from which the DNA under study had been obtained.
Needless to say that any other method, including classical sequencing techniques, can resorted to for the achievement of the same purpose.
This method includes that known under the expression "oligotyping" for the detection of polymorphisms, reference is advantageously made to the method discloses by Orita et al. (reference was already made thereto herebefore) for the detection of polymorphisms based on the conformation of single strands.
The relevant gene in the case of resistance to isoniazid is of course the katG (SEQ ID NO:45) gene or a fragment thereof.
In the case of resistance to rifampicin, the relevant gene happens to be the rpoB, gene (SEQ ID NO:59) which codes for the .beta.sub-unit of the RNA polymerases of said mycobacteria, or when only part of that gene is being used, preferably that part which includes the codons 400 to 450 of that rpoB gene.
Finally, in the case of resistance to steptomycin, the relevant gene contemplated is that of the rpsL gene (SEQ ID NO:63) that codes for the S12 protein of the small ribosome sub-unit or, when only part of said fragment is being used, preferably that part which includes the codon at the 43 position.
A preferred procedure, particularly in relation to the process alternative making use of PCR amplification is disclosed hereafter.
DNA is obtained from a biological sample (e.g. blood or sputum) after removal of the cellular debris and lysis of the bacterial cells with an appropriate lysis buffer. PCR application can be carried out by classical methods, using a pair of primers, whose sequences are respectively complementary to fragments of each of the strands of the DNA to be amplified.
The procedure may be run further as follows:
the amplification products (comprising e.g. from 100 to 300 nucleotides) are digested by means of suitable restriction endonuclease,
the ADN strands obtained from the amplification medium are subjected to denaturation,
the monostranded DNA strands are deposited on a neutral 5% polyacrylamid gel,
the monostranded DNA strands are caused to migrate on said gel by means of electrophoresis,
the DNA fragments that migrated on the polyacrilamid gel are transferred onto a nylon membrane according to a usual electrophoretic blotting technique and hybridized to labelled probes, for instance .sup.32 p labelled probes, and
the migration distances of the DNA fragments subjected to analysis are compared to those obtained from controls obtained under the same conditions of amplification, digestion, denaturation electrophoresis and transfer onto a nylon membrane, whereby said DNA had been obtained from an identical bacterial strain yet sensitive to the antibiotic under study.
For the production of the PCR primers as well as of the polygonucleotides probes used in the above disclosed "oligotyping" procedures, use is advantageously made of those complementary to the rpoB gene (SEQ ID NO:59) of wild M. tuberculosis inserted in a plasmid deposited under number I-12167 at the CNCM on Sep. 15, 1992.
The invention also relates more particularly to the nucleotidic sequence of a fragment of rpsL gene (SEQ ID NO:63) of Mycobacterium tuberculosis coding for the S12 protein of the small ribosome sub-unit, as well as to the nucleotidic sequence of a mutated rpsL gene fragment deemed responsible of the resistance to streptomycin.
By amplification of that nucleotidic sequence, the nucleotide sequence of the full rpsL gene can be obtained.
Example
The sensitivity to rifampicin has been determined in mice as disclosed by Grosset et al. (and Int. J. Lepr. 57:607-614). The cells of M. Leprae were obtained from mouse paws according to classic procedures. All resistant strains were able to grow in mice which received daily doses of 20 mg/Kg of rifampicin, whereas sensitive strains were killed at low rifampicin concentrations, less than 2 mg/Kg.
Relevant regions of the rpoB gene of extracted DNA was initiated upon using two pairs of biotinylated primers, whose sequences appear in the following table 4.
Table 4______________________________________Primer Sequence______________________________________Brpo22 CAGGACGTCGAGGCGATCAC (SEQ ID NO:30) rpo23 AACGACGACGTGGCCAGCGT (SEQ ID NO:31)Brpo24 CAGACGGTGTTTATGGGCGA (SEQ ID NO:32) rpo25 TCGGAGAAACCGAAACGCTC (SEQ ID NO:33) rpo32 TCCTCGTCAGCGGTCAAGTA (SEQ ID NO:34) rpo33 CTTCCCTATGATGACTG (SEQ ID NO:35) rpo34 GGTGATCTGCTCACTGG (SEQ ID NO:36) rpo35 GCCGCAGACGCTGATCA (SEQ ID NO:37) rpo36 TTGACCGCTGACGAGGA (SEQ ID NO:38) rpo37 GCCAGCGTCGATGGCCG (SEQ ID NO:39)______________________________________
Upon using conventional techniques, amplification products comprising 310 and 710 bp were respectively obtained as shown in FIG. 1. The localization of the sequences of the different primers used in the table is also indicated on FIG. 10.
The DNAs obtained have been sequenced on the basis of the rpoB sequence of isolates sensitive to rifampicin (SEQ ID NO:59). A plasmid containing the sequence of that gene has been deposited at CNCM on Sep. 15, 1992 under number I-1266. Biotinylated PCR products were concentrated from the PCR reaction mixtures by contacting with streptavidin coated beads under agitation. The biotinylated strands attached to the beads were then recovered and sequenced. The sequences obtained were compared to the sequence of the rpoB gene of a wild type (SEQ ID NO:59) stain. Significant results were obtained as a result of sequencing of the wild gene (SEQ ID NO:59) (of a mycobacterium sensitive to rifampicin) and of corresponding sequences of the B-sub-unit of four mutant strains resistant to rifampicin (FIG. 11).
Results were obtained starting from 102 strands obtained from patients infected with M. tuberculosis. Among this 102 strands 53 were sensitive to rifampicin and 49 resistant to rifampicin. The mutation was localized in the region 400-450 in 43 of the mutants and among the latter, the mutation occured in the region of .sup.425 Ser into leu.
Example of Detection of the Resistance of Mycobacteria to Streptomycin
The culture of M. tuberculosis strains and the test of their sensitivity to streptomycin have been carried out by the method of proportions on a Lowenstein-Ierva medium (Laboratory Method for Clinical Mycobacteriology--Hugo David --Veronique Levy Frebault, M. F. Thorel, published by Institut Pasteur).
The nucleotide sequence of the rpsL gene (SEQ ID NO:61) of M. Leprae led, by sequence analogy, to the construction of two primers, ML51 (CCCACCATTCAGCAGCTGGT) (SEQ ID NO:40) et ML52 (GTCGAGCGAACCGCGAATGA) (SEQ ID NO:41) surounding regions including putative mutation sites liable of being responsible for the streptomycin resistance and suitable for the PCR reaction. The DNA of the used M. tuberculosis used as a matrix has enabled one to obtain a rpsL fragment of 306 pb (SEQ ID NO:63). The nucleotide sequence of the sequenced fragments exhibited 28 differences with that of M. Leprae.
The rpsL genes or 43 strands of M. tuberculosis, among which 28 were resistant, have been amplified both by PCR and the SSCP technique.
DNA was extracted from 200 .mu.l aliquots of M. tuberculosis samples (in average 10.sup.4 to 10.sup.5 bacteria) covered by 100.mu.l of mineral oil by a congelation-decongelation technique (Woods and Cole, 1989 FEBS. Microbiol. Lett,65:305-308).
After electrophoresis of the DNA strands tested a mutation was shown in 16 of the mutants. In order to establish the nature of the mutation in the 16 strands under consideration, the corresponding rpsL gene fragments were amplified by PCR using the ML51 (SEQ ID NO:40) and the ML52 (SEQ ID NO:41) primers and their respective nucleotide sequences were determined.
The sequences obtained were compared to the sequence of the wild type rpsL gene (SEQ ID NO:65). The single difference was found with the wild sequence ; codon 43, AAG, was mutated into AGG and, consequently, the lys-42 aminoacid was replaced by Arg.
The invention relates also to the "mutated" DNA fragments. They can in turn be used as hybridization probes for use for the dectection in suitable hybridization procedures and for the detection of similar mutation in DNA extracted from a M. tuberbulosis strain suspected to include resistance to any one of the above illustrated antibiotics.
The invention further relates to kits for the resistance of mycobacteriae to isoniazid, rifampicin or analogues thereof, and streptomycin.
The invention further relates to a kit for the in vitro diagnostic of the resistance of a bacteria of a mycobacterium genus to isoniazid, characterized in that it comprises: means for carrying out for a genic amplification of the DNA of the katG gene (SEQ ID NO:45) or of a fragment thereof,
means to bring into evidence one or several mutations on the amplification products so obtained,
a preparation of control DNA of a katG gene (SEQ ID NO:45) of a strain of said bacteria sensitive to isoniazid or of a fragment thereof,
optionally, a control preparation of a DNA of the katG gene (SEQ ID NO:45) of an isoniazid-resistant mycobacterium strain.
The invention further relates to a kit for the in vitro diagnostic of the resistance of a bacteria of a mycobacterium genus to rifampicin or its analogues, characterized in that it comprises:
means for carrying out for a genic amplification of the DNA of the rpoB gene (SEQ ID NO:59) or of the .beta.-sub-unit of the RNA polymerase (SEQ ID NO:60) of said mycobacteria, or of a fragment thereof,
means to bring into evidence one or several mutations on the amplification products so obtained,
a preparation of control DNA of a rpoB gene coding for the .beta.-sub-unit of the RNA polymerase of a strain of said bacteria sensitive to rifampicin or of a fragment thereof,
optionally, a control preparation of a DNA of the rpoB gene (SEQ ID NO:59) of an isoniazid-resistant mycobacterium strain.
Similarly, the invention pertains to a kit for the in vitro diagnostics of the resistance of the M. tuberculosis to streptomycin, characterized in that it includes:
means for carrying out a genic amplification of the rpsL gene (SEQ ID NO:63) coding for the S12 protein of the small ribosome subunit, or fragment thereof,
means which enable the bringing to evidence of one or several mutations on the amplification products obtained,
a control preparation of a DNA sequence of the rose gene (SEQ ID NO:65) coding for the S12 protein of the small sub-unit of the ribosome (SEQ ID NO:66) of a M. tuberculosis strain sensitive to streptomycin, and
optionally, a control preparation of a DNA sequence of a rpsL gene (SEQ ID NO:63) coding for the S12 protein of the small sub-unit of the ribosome (SEQ ID NO:64) of a strain of M. tuberculosis resistant to streptomycin.
REFERENCES CITED IN THE SPECIFICATION
Altschul, S., Gish, W., Miller, W., Myers, E., and Lipman, D. (1990). A basic local alignment search tool. Proc. Natl. Acad. Sci. USA 215:403-410.
Bekierkunst, A. & Bricker, A. (1967). Studies on the mode of action of isoniazid on mycobacteria. Arch. Biochem. Biophys. 122:385-392.
Biggin, M. D., Gibson T. J., and Hong G. F. (1983). Buffer gradient gels and .sup.35 S-label as an aid to rapid DNA sequence determination. Proc. Natl. Acad. Sci. USA 80:3963-3965.
Bairoch, A., (1992). Prosite: a dictionary of sites and patterns in proteins. Nucleic Acids Res. 20:2013-2018.
C.D.C. Outbreak of multidrug-resistant tuberculosis--Texas, California, and Pennsylvania. MMWR 1990, 39:369-372.
C.D.C. Nosocomial transmission of multidrug-resistant tuberculosis among HIV-infected persons--Florida and New York 1988-1991. MMWR 1991(a) 40:585-591.
C.D.C. Transmission of multidrug-resistant tuberculosis from an HIV-positive client in a residential substance abuse treatment facility. Michigan. MMWR 1991(b), 40:129-131.
Chaisson, R. E., Schecter, G. F., Theuer, C. P., Rutherford, G. W., Echenberg, D. F., Hopewell, P. C. (1987). Tuberculosis in patients with the acquired immunodeficiency syndrome. Am. Rev. Respir. Dis., 23:56-74.
Collins, D. M., and Stephens, D. M. (1991). Identification of an insertion sequence, 1S1081, in Mycobacterium bovis. FEMS Microbiol. Lett. 83:11-16.
Daley, C. L., Small, P. M., Schecter, G. F., Schoolnik, G. K., McAdam, R. A., Jacobs, W. R., and Hopewell, P. C. (1992). An outbreak of tuberculosis with accelerated progression among persons infected with the human immunodeficiency virus. An analysis using restriction-fragment-length-polymorphism. N. Encl. J. Med., 326:231-235.
Devereux, J., Haeberli, P. and Smithies, 0. (1984) A comprehensive set of sequence analysis programs for the VAX. Nucl. Acids Res. 12:387-395.
Eiglmeier, K., Honore, N., and Cole, S. T. (1991). Towards the integration of foreign DNA into the chromosome of Mycobacterium leprae. Research in Microbiology, 142:617-622.
Finzel, B. C., Poulos, T. L. and Kraut, J. (1984). Crystal structure of yeast cytochrome C peroxidase at 1.7 .ANG. resolution. J. Biol. Chem. 259:13027-13036.
Garnier, T., and Cole, S. T., (1986). Characterization of a bacteriocinogenic plasmid from Clostridium perfringens and molecular genetic analysis of the bacteriocin-encoding gene. J. Bacteriol., 168:1189-1196.
Gayathri Devi, B., Shaila, M. S., Ramakrishnan, T., and Gopinathan, K. P. (1975). The purification and properties of peroxidase in Mycobacterium tuberculosis H37RV and its possible role in the mechanism of action of isonicotinic acid hydrazide. Biochem. J., 149:187-197.
Hermans, P. W. M., van Soolingen, D. and van Embden, J. D. A. (1992). Characterization of a major polymorphic tandem repeat in Mycobacterium tuberculosis and its potential use in the epidemiology of Mycobacterium kansasii and Mycobacterium Agordonae. J. Bacteriol. 174:4157-4165.
Heym, B. and Cole, S. T. (1992). Isolation and characterization of isoniazid-resistant mutants of Mycobacterium smegmatis and M. aurum. Res. Microbiol., submitted.
Jackett, P. S., Aber, V. and Lowrie, D. (1978). J. Gen Microbiol., 104:37-45.
Kubica, G. P., Jones Jr., W. D., Abbott, V. D., Beam, R. E., Kilburn, J. O., and Cater Jr., J. C. (1966). Differential identification of mycobacteria. I. Tests on catalase activity. Am. Rev. Resp. Dis., 94:400-405.
Kwok et al., S., J. Virol. 61:1690-1694 (1987). Multidrug resistance results from the accumulation of mutations in the genes for distinct drug targets.
Laemmli, U.K., (1970). Cleavage of structural proteins during the assembly of the head of bacteriophage-T4. Nature (London) 227:680-685.
Loewen, P. C., and Stauffer, G. V. (1990). Nucleotide sequence of katG of Salmonella typhimurium LT2 and characterization of its product, hydroperoxidase I. Mol. Gen. Genet. 224:147-151.
Loprasert, S., Negoro, S. and Okada, H. (1988). Thermostable peroxidase from Bacillus stearothermorhilus. J. Gen. Microbiol., 134:1971-1976.
Loprasert, S., Negoro, S., and Okada, H. (1989). Cloning, nucleotide sequence, and expression in Escherichia coli of the Bacillus stearotherrmophilus peroxidase gene (perA). J. Bacteriol., 171:4871-4875.
Maniatis, T., Sambrook, J., and Fritsch, E. F. (1989). Molecular cloning. A laboratory manual. Second Edition 1989. Cold Spring Harbor Laboratory Press.
Matsuo, K., Yamaguchi, R., Yamazaki, R. A., Tasaka, H. and Yamada, T. (1988). Cloning and expression of the Mycobacterium bovis BCG gene for extracellular .alpha. antigen. J. Bacteriol., 170:3847-3854.
Middlebrook, G. (1954). Isoniazid-resistance and catalase activity of tubercle bacilli. Am. Rev. Tuberc., 69:471-472.
Middlebrook, G., Cohn, M. L., and Schaefer, W. B. (1954).--Studies on isoniazid and tubercle bacilli. III. The isolation, drug-susceptibility, and catalase-testing of tubercle bacilli from isoniazid-treated patients. Am. Rev.
Tuberc., 70:852-872.
Mitchison, D. A., Selkon, J. B. and Lloyd, S. (1963). J. Path. Bact. 86:377-386.
Mulvey, M. R., Sorby PA, Triggs-Raine BL and Loewen PC. Gene 73:337-345 (1988).
Orita, M., Iwahana, I., Kanazawa, H., Itayashi, K., and Sekiya, J. (1989). PNAS 86:2766-2770.
Pearson, W., and Lipman, D. (1988). Improved tools for biological sequence comparisons. Proc. Natl. Acad. Sic. USA. 85:2444-2448.
Quemard, A., Lacave, C., and Laneelle, G. (1991). Isoniazid inhibition of mycolic acid synthesis by cell extracts of sensitive and resistant strains of Mycobacterium aurum. Antimicrob. Ac. Chem., 35:1035-1039.
Saiki et al., R. K., Bio/Technology 3:1008-1012 (1985).
Shoeb, H. A., Bowman B. U. J., Ottolenghi, A. C., and Merola, A. J. (1985). Peroxidase-mediated oxidation of isoniazid. Antimicrobial Agents and Chemotherapy, 27:399-403.
Shoeb, H. A., Bowman, B. U. J., Ottolenghi, A. C., and Merola, A. S. (1985). Evidence for the generation of active oxygen by isoniazid treatment of extracts of Mycobacterium tuberculosis H37Ra. Antimicrobial Agents and Chemotherapy, 27:404-407.
Sivaraja, M., Goodin, D. B., Smith, M., and Hoffman, B. M., (1989). Identification by ENDOR of Trp.sup.191 as the free-radical site in cytochrome c peroxidase Compound Es. Science, 245:738-740.
Snapper, S. B., Lugosi, L., Jekkel, A., Melton, R. E., Kieser, T., Bloom, B. R., and Jacobs, W. R. (1988). Lysogeny and transformation in mycobacteria: stable expression of foreign genes. Proc. Natl. Acad. Sci. USA, 85:6987-6991.
Snapper, S. B., Melton, R. E., Mustafa, S., Kieser, T., and Jacobs, W. R. (1990). Isolation and characterization of efficient plasmid transformation mutants of Mycobacterium smegmatis. Mol. Microbiol., 4:1911-1919.
Snider, D. (1989). Rev. Inf. Dis., S335.
Snider Jr., D. E. and Roper, W. L. (1992). The new tuberculosis. The New England Journal of Medicine, 326:703-705.
Sriprakash, K. S. and Ramakrishnan, T. (1970). Isoniazid-resistant mutants of Mycobacterium tuberculosis H37Rv: Uptake of isoniazid and the properties of NADase inhibitor. J. Gen. Microbiol., 60:125-132.
Staden, R. (1987). Computer handling of sequence projects. In Nucleic acid and protein sequence analysis: A practical approach. Bishop, M. J. and Rawlings, C. J. (eds.) Oxford: IRL Press, pp. 173-217.
Thierry, D., Brisson-Noel, A., Vincent-Levy-Frebault, V., Nguyen, S., Guesdon, J., and Gicquel, B. (1990). Characterization of a Mycobacterium tuberculosis insertion sequence, IS6110, and its application in diagnosis. S. Clin. Microbiol., 28:2668-2673.
Thierry, D., Cave, M. D., Eisenach, K. D., Crawford, S. T., Bates, S. H., Gicquel, B., and Guesdon, J. L. (1990). IS6110, an IS-like element of Mycobacterium tuberculosis complex. Nucleic Acids Res., 18:188.
Triggs-Raine, B. L., Doble, B. W., Mulvey, M. R., Sorby, P. A., and Loewen, P. C. (1988). Nucleotide sequence of kaqG, encoding catalase HPI of Escherichia coli. J. Bacteriol., 170:4415-4419.
Wayne, L. G. and Diaz, G. A. (1986). Analyt. Biochem. 157:89-92.
Welinder, K. G. (1991). Bacterial catalase-peroxidases are gene duplicated members of the plant peroxidase superfamily. Biochim. Biophys. Acta 1080:215-220.
Winder, F. and Collins, P. (1968). The effect of isoniazid on nicotinamide nucleotide levels in Mycobacterium bovis, strain BCG. Amer. Rev. Respir. Dis., 97:719-720.
Winder, F. and Collins, P. (1969). The effect of isoniazid on nicotinamide nucleotide concentrations in tubercle bacilli. Amer. Rev. Respir. Dis., 100:101-103.
Winder, F. and Collins, P. (1968). Inhibition by isoniazid of synthesis of mycolic acids in Mycobacterium tuberculosis, J. Gen. Microbiol., 63:41-48.
Youatt, J. (1969). A review of the action of isoniazid. Am. Rev. Respir. Dis., 99:729-749.
Zhang, Y., Garbe, T., and Young, D. (1993). Transformation with katG restores isoniazid-sensitivity in Mycobacterium tuberculosis isolates resistant to a range of drug concentrations. Mol. Microbiol., submitted.
Zhang, Y., and Young, D. B. (1993) Characterization of a variable genetic element from the katG region of Mycobacterium tuberculosis--in preparation.
Zhang, Y., Lathigra, R., Garbe, T., Catty, D., and Young, D. (1991) Genetic analysis of superoxide dismutase, the 23 kilodalton antigen of Mycobacterium tuberculosis. Mol. Microbiol., 5:381-391.
Zhang, Y., Heym, B., Allen, B., Young, D., and Cole, S. T. (1992). The catalase-peroxidase gene and isoniazid resistance of Mycobacterium tuberculosis. Nature. 358:591-593.
Zhang, Y., Garcia, M. J., Lathigra, R., Allen, B., Moreno, C., van Embden, D. A., and Young, D. (1992). Alterations in the superoxide dismutase gene of an isoniazid-resistant strain of Mycobacterium tuberculosis. Infect. Immun., 60:2160-2165.
__________________________________________________________________________# SEQUENCE LISTING- (1) GENERAL INFORMATION:- (iii) NUMBER OF SEQUENCES: 66- (2) INFORMATION FOR SEQ ID NO:1:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 39 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:1:# 39 GGCA CGGCGCGGGC ACCTACCGC- (2) INFORMATION FOR SEQ ID NO:2:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 37 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:2:- Ala Pro Leu Asn Ser Trp Pro Asp Asn Ala Se - #r Leu Asp Lys Ala Arg# 15- Arg Leu Leu Trp Pro Ser Lys Lys Lys Tyr Gl - #y Lys Lys Leu Ser Trp# 30- Ala Asp Leu Ile Val 35- (2) INFORMATION FOR SEQ ID NO:3:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 37 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:3:- Ala Pro Leu Asn Ser Trp Pro Asp Asn Val Se - #r Leu Asp Lys Ala Arg# 15- Arg Leu Leu Trp Pro Ile Lys Gln Lys Tyr Gl - #y Gln Lys Ile Ser Trp# 30- Ala Asp Leu Phe Ile 35- (2) INFORMATION FOR SEQ ID NO:4:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 36 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:4:- Ala Pro Leu Asn Ser Trp Pro Asp Asn Ala As - #n Leu Asp Lys Ala Arg# 15- Arg Cys Leu Gly Arg Ser Lys Arg Asn Thr Gl - #y Thr Lys Ser Leu Gly# 30- Pro Ile Cys Ser 35- (2) INFORMATION FOR SEQ ID NO:5:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 18 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:5:# 18 TG- (2) INFORMATION FOR SEQ ID NO:6:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 19 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:6:# 19 TTC- (2) INFORMATION FOR SEQ ID NO:7:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 18 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:7:# 18 TG- (2) INFORMATION FOR SEQ ID NO:8:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 19 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:8:# 19 GTG- (2) INFORMATION FOR SEQ ID NO:9:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 19 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:9:# 19 ACG- (2) INFORMATION FOR SEQ ID NO:10:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 18 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:10:# 18 AG- (2) INFORMATION FOR SEQ ID NO:11:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 19 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:11:# 19 GAC- (2) INFORMATION FOR SEQ ID NO:12:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:12:# 20 CCCC- (2) INFORMATION FOR SEQ ID NO:13:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:13:# 20 TACG- (2) INFORMATION FOR SEQ ID NO:14:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 18 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:14:# 18 TG- (2) INFORMATION FOR SEQ ID NO:15:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 19 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:15:# 19 TTG- (2) INFORMATION FOR SEQ ID NO:16:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 18 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:16:# 18 AG- (2) INFORMATION FOR SEQ ID NO:17:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 18 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:17:# 18 TG- (2) INFORMATION FOR SEQ ID NO:18:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 18 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:18:# 18 AC- (2) INFORMATION FOR SEQ ID NO:19:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 19 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:19:# 19 GCC- (2) INFORMATION FOR SEQ ID NO:20:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 18 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:20:# 18 AC- (2) INFORMATION FOR SEQ ID NO:21:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:21:# 20 GACC- (2) INFORMATION FOR SEQ ID NO:22:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:22:# 20 CATC- (2) INFORMATION FOR SEQ ID NO:23:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:23:# 20 CCTG- (2) INFORMATION FOR SEQ ID NO:24:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:24:# 20 AGAC- (2) INFORMATION FOR SEQ ID NO:25:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:25:# 20 GCAG- (2) INFORMATION FOR SEQ ID NO:26:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 18 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:26:# 18 CG- (2) INFORMATION FOR SEQ ID NO:27:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 43 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (ix) FEATURE: (A) NAME/KEY: Modified-sit - #e#10) (B) LOCATION: one-of(9,#/note= "Xaa=unknown."FORMATION:- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:27:- Asp Glu Thr Leu Ile Val Met Thr Xaa Xaa Le - #u Ile Val Met Leu Ile# 15- Val Met Ser Thr Ala Gly Ser Ala Gly Leu Il - #e Val Met Ser Thr Ala# 30- Gly His Ser Thr Ala Leu Ile Val Met Phe Ty - #r# 40- (2) INFORMATION FOR SEQ ID NO:28:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 26 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (ix) FEATURE: (A) NAME/KEY: Modified-sit - #e#6, 7, 19, 23)LOCATION: one-of(5,#/note= "Xaa=unknown."FORMATION:- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:28:- Ser Gly Ala Thr Xaa Xaa Xaa Leu Ile Val Me - #t Ala Arg Leu Ile Val# 15- Met Ala Xaa Phe Trp His Xaa Ser Ala Cys# 25- (2) INFORMATION FOR SEQ ID NO:29:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 8 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (ix) FEATURE: (A) NAME/KEY: Modified-sit - #e#3, 4, 5) (B) LOCATION: one-of(2,#/note= "Xaa=unknown."FORMATION:- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:29:- Gly Xaa Xaa Xaa Xaa Gly Lys Thr1 5- (2) INFORMATION FOR SEQ ID NO:30:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:30:# 20 TCAC- (2) INFORMATION FOR SEQ ID NO:31:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:31:# 20 GCGT- (2) INFORMATION FOR SEQ ID NO:32:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:32:# 20 GCGA- (2) INFORMATION FOR SEQ ID NO:33:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:33:# 20 GCTC- (2) INFORMATION FOR SEQ ID NO:34:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:34:# 20 AGTA- (2) INFORMATION FOR SEQ ID NO:35:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 17 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:35:# 17 G- (2) INFORMATION FOR SEQ ID NO:36:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 17 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:36:# 17 G- (2) INFORMATION FOR SEQ ID NO:37:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 17 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:37:# 17 A- (2) INFORMATION FOR SEQ ID NO:38:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 17 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:38:# 17 A- (2) INFORMATION FOR SEQ ID NO:39:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 17 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:39:# 17 G- (2) INFORMATION FOR SEQ ID NO:40:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:40:# 20 TGGT- (2) INFORMATION FOR SEQ ID NO:41:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 20 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:41:# 20 ATGA- (2) INFORMATION FOR SEQ ID NO:42:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 360 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:42:- ATGACCATGA TTACGCCAAG CTTGCATGCC TGCAGGTCGA CTCTAGAGGA TC - #CCCATCCG 60- ACACTTCGCG ATCACATCCG TGATCACAGC CCGATAACAC CAACTCCTGG AA - #GGAATGCT 120- GTGCCCGAGC AACACCCACC CATTACAGAA ACCACCACCG GAGCCGCTAG CA - #ACGGCTGT 180- CCCGTCGTGG GTCATATGAA ATACCCCGTC GAGGGCGGCG GAAACCAGGA CT - #GGTGGCCC 240- AACCGGCTCA ATCTGAAGGT ACTGCACCAA AACCCGGCCG TCGCTGACCC GA - #TGGGTGCG 300- GCGTTCGACT ATGCCGCGGA GGTCGCGACC AGTCGACTTG ACGCCCTGAC GC - #GGGACATC 360- (2) INFORMATION FOR SEQ ID NO:43:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 120 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:43:- Met Thr Met Ile Thr Pro Ser Leu His Ala Cy - #s Arg Ser Thr Leu Glu# 15- Asp Pro His Pro Thr Leu Arg Asp His Ile Ar - #g Asp His Ser Pro Ile# 30- Thr Pro Thr Pro Gly Arg Asn Ala Met Pro Gl - #u Gln His Pro Pro Ile# 45- Thr Glu Thr Thr Thr Gly Ala Ala Ser Asn Gl - #y Cys Pro Val Val Gly# 60- His Met Lys Tyr Pro Val Glu Gly Gly Gly As - #n Gln Asp Trp Trp Pro#80- Asn Arg Leu Asn Leu Lys Val Leu His Gln As - #n Pro Ala Val Ala Asp# 95- Pro Met Gly Ala Ala Phe Asp Tyr Ala Ala Gl - #u Val Ala Thr Ser Arg# 110- Leu Asp Ala Leu Thr Arg Asp Ile# 120- (2) INFORMATION FOR SEQ ID NO:44:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 78 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:44:- Met Ser Thr Ser Asp Asp Ile His Asn Thr Th - #r Ala Thr Gly Lys Cys# 15- Pro Phe His Gln Gly Gly His Asp Gln Ser Al - #a Gly Ala Gly Thr Thr# 30- Thr Arg Asp Trp Trp Pro Asn Gln Leu Arg Va - #l Asp Leu Leu Asn Gln# 45- His Ser Asn Arg Ser Asn Pro Leu Gly Glu As - #p Phe Asp Tyr Arg Lys# 60- Glu Phe Ser Lys Leu Asp Tyr Tyr Gly Leu Ly - #s Lys Asp Leu#75- (2) INFORMATION FOR SEQ ID NO:45:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 4795 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:45:- GGTACCGTGA GGCGATGGGT GGCCCGGGGC CCGGCTGTCT GGTAAGCGCG GC - #CGCAAAAC 60- AGCTGTACTC TCGAATCCCA GTTAGTAACA ATGTGCTATG GAATCTCCAA TG - #ACGAGCAC 120- ACTTCACCGA ACCCCATTAG CCACCGCGGG GCTGGCGCTC GTAGTGGCGC TG - #GGTGGCTG 180- CGGGGGCGGG GGCGGTGACA GTCGAGAGAC ACCGCCATAC GTGCCGAAAG CG - #ACGACCGT 240- CGACGCAACA ACGCCGGCGC CGGCCGCCGA GCCACTGACG ATCGCCAGTC CC - #ATGTTCGC 300- CGACGGCGCC CCGATCCCGG TGCAATTCAG CTGCAAGGGG GCCAACGTGG CC - #GCCACCGT 360- TGACGTGGTC GTCGCCCGCG GCGAGCGAAC TGGCACTCGT CGTCGATGAC CC - #CGACGCGG 420- TCGGCGGACT GTACGTGCAC TGGATCGTGA CCGGAATCGC CCCTGGCTCT GG - #CAGCACGG 480- CGGATGGTCA GACTCCTGCT GGTGGGCACA GCGTGCCGAA TTCTGGTGGT CG - #GCAAGGAT 540- ACTTCGGTCC ATGCCCGCCG GCGGGCACCG GGACACACCA CTACCGGTTT AC - #CCTCTACC 600- ACCTTCCTGT CGCGCTCCAG CTGCCACCGG GAGCCACGGG AGTCCAAGCG GC - #ACAGGCGA 660- TAGCACAGGC CGCCAGCGAC AGGCCCGGCT CGTCGGCACA TTCGAAGGCT GA - #CGCCGCGG 720- CATCCCTGGC GAGGTGGTCG AAACCCTGGC TTCTCCAATT GCGCCTGGCG AC - #AATGATCA 780- ATATGGAATC GACAGTGGCG CACGCATTTC ACCGGTTCGC ACTGGCCATC TT - #GGGGCTGG 840- CGCTCCCCGT GGCGCTAGTT GCCTACGGTG GCAACGGTGA CAGTCGAAAG GC - #GGCGGCCG 900- TGGCGCCGAA AGCAGCAGCG CTCGGTCGGA GTATGCCCGA AACGCCTACC GG - #CGATGTAC 960- TGACAATCAG CAGTCCGGCA TTCGCCGACG GTGCGCCGAT CCCGGAACAG TA - #CACCTGCA1020- AAGGAGCCAA TATCGCGGCC TCCGTTGACC TGGTCGGCGC CGTTTGGCGG CG - #CACTCGTT1080- GTCGATGATC CGGACCACCT CGCGAACCTT ACGTCCATTG GATCGTGATC GG - #GATCGCCC1140- CTGGTGCTGG CAGCAGCCGA TGGTGAGACT CCCGGTGGCG GAATCAGCCT GC - #CGAACTCC1200- AGCGGTCAGC CCGCATACAC CGGCCCCTGC CCGCCGGCGG GCACCGGGAC AC - #ACCACTAC1260- CGGTTTACCC TCTACCACCT TCCTGCCGTG CCTCCACTCG CGGGACTGGC TG - #GGACACAA1320- GCGGCGCGGG TGATCGCGCA GGCCGCCACC ATGCAGGCCC GGCTCATCGG AA - #CATACGAA1380- GGCTGATCCA CCCGCCATCC CACGATCCAG CGGCCCCGGG CGATCGGGTC CT - #AGCAGACG1440- CCTGTCACGC TAGCCAAAGT CTTGACTGAT TCCAGAAAAG GGAGTCATAT TG - #TCTAGTGT1500- GTCCTCTATA CCGGACTACG CCGAACAGCT CCGGACGGCC GACCTGCGCG TG - #ACCCGACC1560- GCGCGTCGCC GTCCTGGAAG CAGTGAATGC GCATCCACAC GCCGACACGG AA - #ACGATTTT1620- CGGTGCCGTG CGTTTTGCGC TGCCCGACGT ATCCGGCAAG CCGTGTACGA CG - #TGCTGCAT1680- GCCCTGACCG CCGCGGGCTT GGTGCGAAAG ATCCAACCCT CGGGCTCCGT CG - #CGCGCTAC1740- GAGTCCAGGG TCGGCGACAA CCACCATCAC ATCGTCTGCC GGTCTTGCGG GG - #TTATCGCC1800- GATGTCGACT GTGCTGTTGG CGAGGCACCC TGTCTGACGG CCTCGGACCA TA - #ACGGCTTC1860- CTGTTGGACG AGGCGGAGGT CATCTACTGG GGTCTATGTC CTGATTGTTC GA - #TATCCGAC1920- ACTTCGCGAT CACATCCGTG ATCACAGCCC GATAACACCA ACTCCTGGAA GG - #AATGCTGT1980- GCCCGAGCAA CACCCACCCA TTACAGAAAC CACCACCGGA GCCGCTAGCA AC - #GGCTGTCC2040- CGTCGTGGGT CATATGAAAT ACCCCGTCGA GGGCGGCGGA AACCAGGACT GG - #TGGCCCAA2100- CCGGCTCAAT CTGAAGGTAC TGCACCAAAA CCCGGCCGTC GCTGACCCGA TG - #GGTGCGGC2160- GTTCGACTAT GCCGCGGAGG TCGCGACCAG TCGACTTGAC GCCCTGACGC GG - #GACATCGA2220- GGAAGTGATG ACCACCTCGC AGCCGTGGTG GCCCGCCGAC TACGGCCACT AC - #GGGCCGCT2280- GTTTATCCGG ATGGCGTGGC ACGCTGCCGG CACCTACCGC ATCCACGACG GC - #CGCGGCGG2340- CGCCGGGGGC GGCATGCAGC GGTTCGCGCC GCTTAACAGC TGGCCCGACA AC - #GCCAGCTT2400- GGACAAGGCG CGCCGGCTGC TGTGGCCGGT CAAGAAGAAG TACGGCAAGA AG - #CTCTCATG2460- GGCGGACCTG ATTGTTTTCG CCGGCAACCG CTGCGCTCGG AATCGATGGG CT - #TCAAGACG2520- TTCGGGTTCG GCTTCGGGCG TCGACCAGTG GGAGACCGAT GAGGTCTATT GG - #GGCAAGGA2580- AGCCACCTGG CTCGGCGATG ACGGTTACAG CGTAAGCGAT CTGGAGAACC CG - #CTGGCCGC2640- GGTGCAGATG GGGCTGATCT ACGTGAACCC GGAGGCGCCG AACGGCAACC CG - #GACCCCAT2700- GGCCGCGGCG GTCGACATTC GCGAGACGTT TCGGCGCATG GCCATGAACG AC - #GTCGAAAC2760- AGCGGCGCTG ATCGTCGGCG GTCACACTTT CGGTAAGACC CATGGCGCCG GC - #CCGGCCGA2820- TCTGGTCGGC CCCGAACCCG AGGCTGCTCC GCTGGAGCAG ATGGGCTTGG GC - #TGGAAGAG2880- CTCGTATGGC ACCGGAACCG GTAAGGACGC GATCACCAGC GGCATCGAGG TC - #GTATGGAC2940- GAACACCCCG ACGAAATGGG ACAACAGTTT CCTCGAGATC CTGTACGGCT AC - #GAGTGGGA3000- GCTGACGAAG AGCCCTGCTG GCGCTTGGCA ATACACCGCC AAGGACGGCG CC - #GGTGCCGG3060- CACCATCCCG GACCCGTTCG GCGGGCCAGG GCGCTCCCCG ACGATGCTGG CC - #ACTGACCT3120- CTCGCTGCGG GTGGATCCGA TCTATGAGCG GATCACGCGT CGCTGGCTGG AA - #CACCCCGA3180- GGAATTGGCC GACGAGTTCC GCAAGGCCTG GTACAAGCTG ATCCACCGAG AC - #ATGGGTCC3240- CGTTGCGAGA TACCTTGGGC CGCTGGTCCC CAAGCAGACC CTGCTGTGGC AG - #GATCCGGT3300- CCCTGCGGTC AGCACGACCT CGTCGGCGAA GCAGATTGCC AGCCTTAAGA GC - #CAGATCCG3360- GGCATCGGGA TTGACTGTCT CACAGCTAGT TTCGACCGCA TGGGCGGCGG CG - #TCGTCGTT3420- CCGTGGTAGC GACAAGCGCG GCGGCGCCAA CGGTGGTCGC ATCCGCCTGC AG - #CCACAACT3480- CGGGTGGGAG GTCAACGACC CCGACGGATC TGCGCAAGGT CATTCGCACC CT - #GAAGAGAT3540- CCAGGAGTCA TTCACTCGGC GCGGGAACAT CAAAGTGTCC TTCGCCGACC TC - #GTCGTGCT3600- CGGTGGCTGT GCGCCACTAG AGAAAGCAGC AAAGGCGGCT GGCCACAACA TC - #ACGGTGCC3660- CTTCACCCCG GGCCCGCACG ATGCGTCGCA GGAACAAACC GACGTGGAAT CC - #TTTGCCGT3720- GCTGGAGCCC AAGGCAGATG GCTTCCGAAA CTACCTCGGA AAGGGCAACC GT - #TGCCGGCC3780- GAGTACATCG CTGCTCGACA AGGCGAACCT GCTTACGCTC AGTGCCCCTG AG - #ATGACGGT3840- GCTGGTAGGT GGCCTGCGCG TCCTCGGCGC AAACTACAAG CGCTTACCGC TG - #GGCGTGTT3900- CACCGAGGCC TCCGAGTCAC TGACCAACGA CTTCTTCGTG AACCTGCTCG AC - #ATGGGTAT3960- CACCTGGGAG CCCTCGCCAG CAGATGACGG GACCTACCAG GGCAAGGATG GC - #AGTGGCAA4020- GGTGAAGTGG ACCGGCAGCC GCGTGGACCT GGTCTTCGGG TCCAACTCGG AG - #TTGCGGGC4080- GCTTGTCGAG GTCTATGCGC CGATGACGCG GCAGGCGAAG TTCGTGACAG GA - #TTCGTCGC4140- TGCGTGGGAC AAGGTGATGA ACCTCGACAG GTTCGACGTG CGCTGATTCG GG - #TTGATCGG4200- CCCTGCCCGC CGATCAACCA CAACCCGCCG CAGCACCCCG CGAGCTGACC GG - #CTCGCGGG4260- GTGCTGGTGT TTGCCCGGCG CGATTTGTCA GACCCCGCGT GCATGGTGGT CG - #CACGGACG4320- CACGAGACGG GGATGACGAG ACGGGGATGA GGAGAAAGGG CGCCGAAATG TG - #CTGGATGT4380- GCGATCACCC GGAAGCCACC GCCGAGGAGT ACCTCGACGA GGTGTACGGG AT - #AATGCTCA4440- TGCATGGCTG GGCGGTACAG CACGTGGAGT GCGAGCGACG GCCATTTGCC TA - #CACGGTTG4500- GTCTAACCCG GCGCGGCTTG CCCGAACTGG TGGTGACTGG CCTCTCGCCA CG - #ACGTGGGC4560- AGCGGTTGTT GAACATGCCG TCGAGGGCTC TGGTCGGTGA CTTGCTGACT CC - #CGGTATGT4620- AGACCACCCT CAAAGCCGGC CCTCTTGTCG AAACGGTCCA GGCTACACAT CC - #GGACGCGC4680- ATTTGTATTG TGCGATCGCC ATCTTTGCGC ACAAGGTGAC GGCCTTGCAG TT - #GGTGTGGG4740- CCGACCGCGT GGTCGCTGGC CGTGGGCGGC GGACTTCGAC GAAGGTCGCG GT - #ACC4795- (2) INFORMATION FOR SEQ ID NO:46:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 700 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:46:- TTCGAAGGCT GACGCCGCGG CATCCCTGGC GAGGTGGTCG AAACCCTGGC TT - #CTCCAATT 60- GCGCCTGGCG ACAATGATCA ATATGGAATC GACAGTGGCG CACGCATTTC AC - #CGGTTCGC 120- ACTGGCCATC TTGGGGCTGG CGCTCCCCGT GGCGCTAGTT GCCTACGGTG GC - #AACGGTGA 180- CAGTCGAAAG GCGGCGGCCG TGGCGCCGAA AGCAGCAGCG CTCGGTCGGA GT - #ATGCCCGA 240- AACGCCTACC GGCGATGTAC TGACAATCAG CAGTCCGGCA TTCGCCGACG GT - #GCGCCGAT 300- CCCGGAACAG TACACCTGCA AAGGAGCCAA TATCGCGGCC TCCGTTGACC TG - #GTCGGCGC 360- CGTTTGGCGG CGCACTCGTT GTCGATGATC CGGACCACCT CGCGAACCTT AC - #GTCCATTG 420- GATCGTGATC GGGATCGCCC CTGGTGCTGG CAGCAGCCGA TGGTGAGACT CC - #CGGTGGCG 480- GAATCAGCCT GCCGAACTCC AGCGGTCAGC CCGCATACAC CGGCCCCTGC CC - #GCCGGCGG 540- GCACCGGGAC ACACCACTAC CGGTTTACCC TCTACCACCT TCCTGCCGTG CC - #TCCACTCG 600- CGGGACTGGC TGGGACACAA GCGGCGCGGG TGATCGCGCA GGCCGCCACC AT - #GCAGGCCC 660# 700 CGAA GGCTGATCCA CCCGCCATCC- (2) INFORMATION FOR SEQ ID NO:47:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 700 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:47:- GGTACCGTGA GGCGATGGGT GGCCCGGGGC CCGGCTGTCT GGTAAGCGCG GC - #CGCAAAAC 60- AGCTGTACTC TCGAATCCCA GTTAGTAACA ATGTGCTATG GAATCTCCAA TG - #ACGAGCAC 120- ACTTCACCGA ACCCCATTAG CCACCGCGGG GCTGGCGCTC GTAGTGGCGC TG - #GGTGGCTG 180- CGGGGGCGGG GGCGGTGACA GTCGAGAGAC ACCGCCATAC GTGCCGAAAG CG - #ACGACCGT 240- CGACGCAACA ACGCCGGCGC CGGCCGCCGA GCCACTGACG ATCGCCAGTC CC - #ATGTTCGC 300- CGACGGCGCC CCGATCCCGG TGCAATTCAG CTGCAAGGGG GCCAACGTGG CC - #GCCACCGT 360- TGACGTGGTC GTCGCCCGCG GCGAGCGAAC TGGCACTCGT CGTCGATGAC CC - #CGACGCGG 420- TCGGCGGACT GTACGTGCAC TGGATCGTGA CCGGAATCGC CCCTGGCTCT GG - #CAGCACGG 480- CGGATGGTCA GACTCCTGCT GGTGGGCACA GCGTGCCGAA TTCTGGTGGT CG - #GCAAGGAT 540- ACTTCGGTCC ATGCCCGCCG GCGGGCACCG GGACACACCA CTACCGGTTT AC - #CCTCTACC 600- ACCTTCCTGT CGCGATCCAG CTGCCACCGG GAGCCACGGG AGTCCAAGCG GC - #ACAGGCGA 660# 700 CGAC AGGCCCGGCT CGTCGGCACA- (2) INFORMATION FOR SEQ ID NO:48:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 735 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:48:- Met Pro Glu Gln His Pro Pro Ile Thr Glu Th - #r Thr Thr Gly Ala Ala# 15- Ser Asn Gly Cys Pro Val Val Gly His Met Ly - #s Tyr Pro Val Glu Gly# 30- Gly Gly Asn Gln Asp Trp Trp Pro Asn Arg Le - #u Asn Leu Lys Val Leu# 45- His Gln Asn Pro Ala Val Ala Asp Pro Met Gl - #y Ala Ala Phe Asp Tyr# 60- Ala Ala Glu Val Ala Thr Ser Arg Leu Asp Al - #a Leu Thr Arg Asp Ile#80- Glu Glu Val Met Thr Thr Ser Gln Pro Trp Tr - #p Pro Ala Asp Tyr Gly# 95- His Tyr Gly Pro Leu Phe Ile Arg Met Ala Tr - #p His Ala Ala Gly Thr# 110- Tyr Arg Ile His Asp Gly Arg Gly Gly Ala Gl - #y Gly Gly Met Gln Arg# 125- Phe Ala Pro Leu Asn Ser Trp Pro Asp Asn Al - #a Ser Leu Asp Lys Ala# 140- Arg Arg Leu Leu Trp Pro Val Lys Lys Lys Ty - #r Gly Lys Lys Leu Ser145 1 - #50 1 - #55 1 -#60- Trp Ala Asp Leu Ile Val Phe Ala Gly Asn Ar - #g Cys Ala Arg Asn Arg# 175- Trp Ala Ser Arg Arg Ser Gly Ser Ala Ser Gl - #y Val Asp Gln Trp Glu# 190- Thr Asp Glu Val Tyr Trp Gly Lys Glu Ala Th - #r Trp Leu Gly Asp Asp# 205- Gly Tyr Ser Val Ser Asp Leu Glu Asn Pro Le - #u Ala Ala Val Gln Met# 220- Gly Leu Ile Tyr Val Asn Pro Glu Ala Pro As - #n Gly Asn Pro Asp Pro225 2 - #30 2 - #35 2 -#40- Met Ala Ala Ala Val Asp Ile Arg Glu Thr Ph - #e Arg Arg Met Ala Met# 255- Asn Asp Val Glu Thr Ala Ala Leu Ile Val Gl - #y Gly His Thr Phe Gly# 270- Lys Thr His Gly Ala Gly Pro Ala Asp Leu Va - #l Gly Pro Glu Pro Glu# 285- Ala Ala Pro Leu Glu Gln Met Gly Leu Gly Tr - #p Lys Ser Ser Tyr Gly# 300- Thr Gly Thr Gly Lys Asp Ala Ile Thr Ser Gl - #y Ile Glu Val Val Trp305 3 - #10 3 - #15 3 -#20- Thr Asn Thr Pro Thr Lys Trp Asp Asn Ser Ph - #e Leu Glu Ile Leu Tyr# 335- Gly Tyr Glu Trp Glu Leu Thr Lys Ser Pro Al - #a Gly Ala Trp Gln Tyr# 350- Thr Ala Lys Asp Gly Ala Gly Ala Gly Thr Il - #e Pro Asp Pro Phe Gly# 365- Gly Pro Gly Arg Ser Pro Thr Met Leu Ala Th - #r Asp Leu Ser Leu Arg# 380- Val Asp Pro Ile Tyr Glu Arg Ile Thr Arg Ar - #g Trp Leu Glu His Pro385 3 - #90 3 - #95 4 -#00- Glu Glu Leu Ala Asp Glu Phe Arg Lys Ala Tr - #p Tyr Lys Leu Ile His# 415- Arg Asp Met Gly Pro Val Ala Arg Tyr Leu Gl - #y Pro Leu Val Pro Lys# 430- Gln Thr Leu Leu Trp Gln Asp Pro Val Pro Al - #a Val Ser Thr Thr Ser# 445- Ser Ala Lys Gln Ile Ala Ser Leu Lys Ser Gl - #n Ile Arg Ala Ser Gly# 460- Leu Thr Val Ser Gln Leu Val Ser Thr Ala Tr - #p Ala Ala Ala Ser Ser465 4 - #70 4 - #75 4 -#80- Phe Arg Gly Ser Asp Lys Arg Gly Gly Ala As - #n Gly Gly Arg Ile Arg# 495- Leu Gln Pro Gln Val Gly Trp Glu Val Asn As - #p Pro Asp Gly Ser Ala# 510- Gln Gly His Ser His Pro Glu Glu Ile Gln Gl - #u Ser Phe Thr Arg Arg# 525- Gly Asn Ile Lys Val Ser Phe Ala Asp Leu Va - #l Val Leu Gly Gly Cys# 540- Ala Pro Leu Glu Lys Ala Ala Lys Ala Ala Gl - #y His Asn Ile Thr Val545 5 - #50 5 - #55 5 -#60- Pro Phe Thr Pro Gly Pro His Asp Ala Ser Gl - #n Glu Gln Thr Asp Val# 575- Glu Ser Phe Ala Val Leu Glu Pro Lys Ala As - #p Gly Phe Arg Asn Tyr# 590- Leu Gly Lys Gly Asn Arg Cys Arg Pro Ser Th - #r Ser Leu Leu Asp Lys# 605- Ala Asn Leu Leu Thr Leu Ser Ala Pro Glu Me - #t Thr Val Leu Val Gly# 620- Gly Leu Arg Val Leu Gly Ala Asn Tyr Lys Ar - #g Leu Pro Leu Gly Val625 6 - #30 6 - #35 6 -#40- Phe Thr Glu Ala Ser Glu Ser Leu Thr Asn As - #p Phe Phe Val Asn Leu# 655- Leu Asp Met Gly Ile Thr Trp Glu Pro Ser Pr - #o Ala Asp Asp Gly Thr# 670- Tyr Gln Gly Lys Asp Gly Ser Gly Lys Val Ly - #s Trp Thr Gly Ser Arg# 685- Val Asp Leu Val Phe Gly Ser Asn Ser Glu Le - #u Arg Ala Leu Val Glu# 700- Val Tyr Ala Pro Met Thr Arg Gln Ala Lys Ph - #e Val Thr Gly Phe Val705 7 - #10 7 - #15 7 -#20- Ala Ala Trp Asp Lys Val Met Asn Leu Asp Ar - #g Phe Asp Val Arg# 735- (2) INFORMATION FOR SEQ ID NO:49:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 726 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:49:- Met Ser Thr Ser Asp Asp Ile His Asn Thr Th - #r Ala Thr Gly Lys Cys# 15- Pro Phe His Gln Gly Gly His Asp Gln Ser Al - #a Gly Ala Gly Thr Thr# 30- Thr Arg Asp Trp Trp Pro Asn Gln Leu Arg Va - #l Asp Leu Leu Asn Gln# 45- His Ser Asn Arg Ser Asn Pro Leu Gly Glu As - #p Phe Asp Tyr Arg Lys# 60- Glu Phe Ser Lys Leu Asp Tyr Tyr Gly Leu Ly - #s Lys Asp Leu Lys Ala#80- Leu Leu Thr Glu Ser Gln Pro Trp Trp Pro Al - #a Asp Trp Gly Ser Tyr# 95- Ala Gly Leu Phe Ile Arg Met Ala Trp His Gl - #y Ala Gly Thr Tyr Arg# 110- Ser Ile Asp Gly Arg Gly Gly Ala Gly Arg Gl - #y Gln Gln Arg Phe Ala# 125- Pro Leu Asn Ser Trp Pro Asp Asn Val Ser Le - #u Asp Lys Ala Arg Arg# 140- Leu Leu Trp Pro Ile Lys Gln Lys Tyr Gly Gl - #n Lys Ile Ser Trp Ala145 1 - #50 1 - #55 1 -#60- Asp Leu Phe Ile Leu Ala Gly Asn Val Ala Le - #u Glu Asn Ser Gly Phe# 175- Arg Thr Phe Gly Phe Gly Ala Gly Arg Glu As - #p Val Trp Glu Pro Asp# 190- Leu Asp Val Asn Trp Gly Asp Glu Lys Ala Tr - #p Leu Thr His Arg His# 205- Pro Glu Ala Leu Ala Lys Ala Pro Leu Gly Al - #a Thr Glu Met Gly Leu# 220- Ile Tyr Val Asn Pro Glu Gly Pro Asp His Se - #r Gly Glu Pro Leu Ser225 2 - #30 2 - #35 2 -#40- Ala Ala Ala Ala Ile Arg Ala Thr Phe Gly As - #n Met Gly Met Asn Asp# 255- Glu Glu Thr Val Ala Leu Ile Ala Gly Gly Hi - #s Thr Leu Gly Lys Thr# 270- His Gly Ala Gly Pro Thr Ser Asn Val Gly Pr - #o Asp Pro Glu Ala Ala# 285- Pro Ile Glu Glu Gln Gly Leu Gly Trp Ala Se - #r Thr Tyr Gly Ser Gly# 300- Val Gly Ala Asp Ala Ile Thr Ser Gly Leu Gl - #u Val Val Trp Thr Gln305 3 - #10 3 - #15 3 -#20- Thr Pro Thr Gln Trp Ser Asn Tyr Phe Phe Gl - #u Asn Leu Phe Lys Tyr# 335- Glu Trp Val Gln Thr Arg Ser Pro Ala Gly Al - #a Ile Gln Phe Glu Ala# 350- Val Asp Ala Pro Glu Ile Ile Pro Asp Pro Ph - #e Asp Pro Ser Lys Lys# 365- Arg Lys Pro Thr Met Leu Val Thr Asp Leu Th - #r Leu Arg Phe Asp Pro# 380- Glu Phe Glu Lys Ile Ser Arg Arg Phe Leu As - #n Asp Pro Gln Ala Phe385 3 - #90 3 - #95 4 -#00- Asn Glu Ala Phe Ala Arg Ala Trp Phe Lys Le - #u Thr His Arg Asp Met# 415- Gly Pro Lys Ser Arg Tyr Ile Gly Pro Glu Va - #l Pro Lys Glu Asp Leu# 430- Ile Trp Gln Asp Pro Leu Pro Gln Pro Ile Ty - #r Asn Pro Thr Glu Gln# 445- Asp Ile Ile Asp Leu Lys Phe Ala Ile Ala As - #p Ser Gly Leu Ser Val# 460- Ser Glu Leu Val Ser Val Ala Trp Ala Ser Al - #a Ser Thr Phe Arg Gly465 4 - #70 4 - #75 4 -#80- Gly Asp Lys Arg Gly Gly Ala Asn Gly Ala Ar - #g Leu Ala Leu Met Pro# 495- Gln Arg Asp Trp Asp Val Asn Ala Ala Ala Va - #l Arg Ala Leu Pro Val# 510- Leu Glu Lys Ile Gln Lys Glu Ser Gly Lys Al - #a Ser Leu Ala Asp Ile# 525- Ile Val Leu Ala Gly Val Val Gly Val Glu Ly - #s Ala Ala Ser Ala Ala# 540- Gly Leu Ser Ile His Val Pro Phe Ala Pro Gl - #y Arg Val Asp Ala Arg545 5 - #50 5 - #55 5 -#60- Gln Asp Gln Thr Asp Ile Glu Met Phe Glu Le - #u Leu Glu Pro Ile Ala# 575- Asp Gly Phe Arg Asn Tyr Arg Ala Arg Leu As - #p Val Ser Thr Thr Glu# 590- Ser Leu Leu Ile Asp Lys Ala Gln Gln Leu Th - #r Leu Thr Ala Pro Glu# 605- Met Thr Ala Leu Val Gly Gly Met Arg Val Le - #u Gly Gly Asn Phe Asp# 620- Gly Ser Lys Asn Gly Val Phe Thr Asp Arg Va - #l Gly Val Leu Ser Asn625 6 - #30 6 - #35 6 -#40- Asp Phe Phe Val Asn Leu Leu Asp Met Arg Ty - #r Glu Trp Lys Ala Thr# 655- Asp Glu Ser Lys Glu Leu Phe Glu Gly Arg As - #p Arg Glu Thr Gly Glu# 670- Val Lys Phe Thr Ala Ser Arg Ala Asp Leu Va - #l Phe Gly Ser Asn Ser# 685- Val Leu Arg Ala Val Ala Glu Val Tyr Ala Se - #r Ser Asp Ala His Glu# 700- Lys Phe Val Lys Asp Phe Val Ala Ala Trp Va - #l Lys Val Met Asn Leu705 7 - #10 7 - #15 7 -#20- Asp Arg Phe Asp Leu Leu 725- (2) INFORMATION FOR SEQ ID NO:50:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 729 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:50:- Met Ser Thr Thr Asp Asp Thr His Asn Thr Le - #u Ser Thr Gly Lys Cys# 15- Pro Phe His Gln Gly Gly His Asp Arg Ser Al - #a Gly Ala Gly Thr Ala# 30- Ser Arg Asp Trp Trp Pro Asn Gln Leu Arg Va - #l Asp Leu Leu Asn Gln# 45- His Ser Asn Arg Ser Asn Pro Leu Gly Glu As - #p Phe Asp Tyr Arg Lys# 60- Glu Phe Ser Lys Leu Asp Tyr Tyr Ser Ala Le - #u Lys Gly Asp Leu Lys#80- Ala Leu Leu Thr Asp Ser Gln Pro Trp Trp Pr - #o Ala Asp Trp Gly Ser# 95- Tyr Val Gly Leu Phe Ile Arg Met Ala Trp Hi - #s Gly Ala Gly Thr Tyr# 110- Arg Ser Ile Asp Gly Arg Gly Gly Ala Gly Ar - #g Gly Gln Gln Arg Phe# 125- Ala Pro Leu Asn Ser Trp Pro Asp Thr Val Se - #r Leu Asp Lys Ala Arg# 140- Arg Leu Leu Trp Pro Ile Lys Gln Lys Tyr Gl - #y Gln Lys Ile Ser Trp145 1 - #50 1 - #55 1 -#60- Ala Asp Leu Phe Ile Leu Ala Gly Asn Val Al - #a Leu Glu Asn Ser Gly# 175- Phe Arg Thr Phe Gly Phe Gly Ala Gly Arg Gl - #u Asp Val Trp Glu Pro# 190- Asp Leu Asp Val Asn Trp Gly Asp Glu Lys Al - #a Trp Leu Thr His Arg# 205- His Pro Glu Ala Leu Ala Lys Ala Pro Leu Gl - #y Ala Thr Glu Met Asp# 220- Leu Ile Tyr Val Thr Pro Glu Gly Pro Asn Hi - #s Ser Gly Glu Pro Leu225 2 - #30 2 - #35 2 -#40- Ser Ala Ala Ala Ala Ile Arg Ala Thr Phe Gl - #y Asn Met Gly Met Asn# 255- Asp Glu Glu Thr Val Ala Leu Ile Ala Gly Gl - #y His Thr Leu Gly Lys# 270- Thr His Gly Pro Ala Ala Ala Ser His Val Gl - #y Ala Asp Pro Glu Ala# 285- Ala Pro Ile Glu Ala Gln Gly Leu Gly Trp Al - #a Ser Ser Tyr Gly Ser# 300- Gly Val Gly Ala Asp Ala Ile Thr Ser Gly Le - #u Glu Val Val Trp Thr305 3 - #10 3 - #15 3 -#20- Gln Thr Pro Thr Gln Trp Ser Asn Tyr Phe Ph - #e Glu Asn Leu Phe Lys# 335- Tyr Glu Trp Val Gln Thr Arg Ser Pro Ala Gl - #y Ala Ile Gln Phe Glu# 350- Ala Val Asp Ala Pro Asp Ile Ile Pro Asp Pr - #o Phe Asp Pro Ser Lys# 365- Lys Arg Xaa Xaa Lys Pro Thr Met Leu Val Th - #r Asp Leu Thr Leu Arg# 380- Phe Asp Pro Glu Phe Glu Lys Ile Ser Arg Ar - #g Phe Leu Asn Asp Pro385 3 - #90 3 - #95 4 -#00- Gln Ala Phe Asn Glu Ala Phe Ala Arg Ala Tr - #p Phe Lys Leu Thr His# 415- Arg Asp Met Gly Pro Lys Ala Arg Tyr Ile Gl - #y Pro Glu Val Pro Lys# 430- Glu Asp Leu Ile Trp Gln Asp Pro Leu Pro Gl - #n Pro Leu Tyr Gln Pro# 445- Thr Gln Glu Asp Ile Ile Asn Leu Lys Ala Al - #a Ile Ala Ala Ser Gly# 460- Leu Ser Ile Ser Glu Met Val Ser Val Ala Tr - #p Ala Ser Ala Ser Thr465 4 - #70 4 - #75 4 -#80- Phe Arg Gly Gly Asp Lys Arg Gly Gly Ala As - #n Gly Ala Arg Leu Ala# 495- Leu Ala Pro Gln Arg Asp Trp Asp Val Asn Al - #a Val Ala Ala Arg Val# 510- Leu Pro Val Leu Glu Glu Ile Gln Lys Thr Th - #r Asn Lys Ala Ser Leu# 525- Ala Asp Ile Ile Val Leu Ala Gly Val Val Gl - #y Ile Glu Gln Ala Ala# 540- Ala Ala Ala Arg Val Ser Ile His Val Pro Ph - #e Pro Pro Gly Arg Val545 5 - #50 5 - #55 5 -#60- Asp Ala Arg His Asp Gln Thr Asp Ile Glu Me - #t Phe Ser Leu Leu Glu# 575- Pro Ile Ala Asp Gly Phe Arg Asn Tyr Arg Al - #a Arg Leu Asp Val Ser# 590- Thr Thr Glu Ser Leu Leu Ile Asp Lys Ala Gl - #n Gln Leu Thr Leu Thr# 605- Ala Pro Glu Met Thr Val Leu Val Gly Gly Me - #t Arg Val Leu Gly Thr# 620- Asn Phe Asp Gly Ser Gln Asn Gly Val Phe Th - #r Asp Lys Pro Gly Val625 6 - #30 6 - #35 6 -#40- Leu Ser Thr Asp Phe Phe Ala Asn Leu Leu As - #p Met Arg Tyr Glu Trp# 655- Lys Pro Thr Asp Asp Ala Asn Glu Leu Phe Gl - #u Gly Arg Asp Arg Leu# 670- Thr Gly Glu Val Lys Tyr Thr Ala Thr Arg Al - #a Asp Leu Val Phe Gly# 685- Ser Asn Ser Val Leu Arg Ala Leu Ala Glu Va - #l Tyr Ala Cys Ser Asp# 700- Ala His Glu Lys Phe Val Lys Asp Phe Val Al - #a Ala Trp Val Lys Val705 7 - #10 7 - #15 7 -#20- Met Asn Leu Asp Arg Phe Asp Leu Gln 725- (2) INFORMATION FOR SEQ ID NO:51:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 731 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:51:- Met Glu Asn Gln Asn Arg Gln Asn Ala Ala Gl - #n Cys Pro Phe His Glu# 15- Ser Val Thr Asn Gln Ser Ser Asn Arg Thr Th - #r Asn Lys Asp Trp Trp# 30- Pro Asn Gln Leu Asn Leu Ser Ile Leu His Gl - #n His Asp Arg Lys Thr# 45- Asn Pro His Asp Glu Glu Phe Asn Tyr Ala Gl - #u Glu Phe Gln Lys Leu# 60- Asp Tyr Trp Ala Leu Lys Glu Asp Leu Arg Ly - #s Leu Met Thr Glu Ser#80- Gln Asp Trp Trp Pro Ala Asp Tyr Gly His Ty - #r Gly Pro Leu Phe Ile# 95- Arg Met Ala Trp His Ser Ala Gly Thr Tyr Ar - #g Ile Gly Asp Gly Arg# 110- Gly Gly Ala Ser Thr Gly Thr Gln Arg Phe Al - #a Pro Leu Asn Ser Trp# 125- Pro Asp Asn Ala Asn Leu Asp Lys Ala Arg Ar - #g Cys Tyr Gly Arg Ser# 140- Lys Arg Asn Thr Gly Thr Lys Ser Leu Gly Pr - #o Ile Cys Ser Phe Trp145 1 - #50 1 - #55 1 -#60- Arg Ala Met Ser Leu Leu Asn Arg Trp Val Gl - #u Lys Arg Leu Asp Ser# 175- Ala Ala Gly Pro Leu Thr Ser Gly Ile Arg Ly - #s Lys Thr Phe Ile Gly# 190- Asp Arg Lys Lys Ser Gly Ser Pro Leu Asn Al - #a Ile Pro Val Ile Ala# 205- Ser Ser Lys Thr Arg Ser Pro Arg Ala Asn Gl - #y Val Asn Leu Arg Gln# 220- Pro Arg Arg Ala Gly Arg Gln Ala Gly Ser Ly - #s Ser Arg Gly Ile Ser225 2 - #30 2 - #35 2 -#40- Ala Glu Thr Phe Arg Arg Met Gly Met Asn As - #p Glu Glu Thr Val Ala# 255- Leu Ile Ala Gly Gly His Thr Phe Gly Lys Al - #a His Arg Gly Gly Pro# 270- Ala Thr His Val Gly Pro Glu Pro Glu Ala Al - #a Pro Ile Glu Ala Gln# 285- Gly Leu Gly Trp Ile Ser Ser Tyr Gly Lys Gl - #y Lys Gly Ser Asp Thr# 300- Ile Thr Ser Gly Ile Glu Gly Ala Trp Thr Pr - #o Thr Pro Thr Gln Trp305 3 - #10 3 - #15 3 -#20- Asp Thr Ser Tyr Phe Asp Met Leu Phe Gly Ty - #r Asp Trp Trp Leu Thr# 335- Lys Ser Pro Ala Gly Ala Trp Gln Trp Met Al - #a Val Asp Pro Asp Glu# 350- Lys Asp Leu Ala Pro Asp Ala Glu Asp Pro Se - #r Lys Lys Val Pro Thr# 365- Met Met Met Thr Thr Asp Leu Ala Leu Arg Ph - #e Asp Pro Glu Tyr Glu# 380- Lys Ile Ala Arg Arg Phe His Gln Asn Pro Gl - #u Glu Phe Ala Glu Ala385 3 - #90 3 - #95 4 -#00- Phe Ala Arg Ala Trp Phe Lys Leu Thr His Ar - #g Asp Met Gly Pro Lys# 415- Thr Arg Tyr Leu Gly Pro Glu Val Pro Lys Gl - #u Asp Phe Ile Trp Gln# 430- Asp Pro Ile Pro Glu Val Asp Tyr Glu Leu Th - #r Glu Ala Glu Ile Glu# 445- Glu Ile Lys Ala Lys Ile Leu Asn Ser Gly Le - #u Thr Val Ser Glu Leu# 460- Val Lys Thr Ala Trp Ala Ser Ala Ala Arg Se - #r Ala Thr Arg Ile Ser465 4 - #70 4 - #75 4 -#80- Ala Ala Thr Asn Gly Arg Arg Ile Arg Leu Al - #a Pro Gln Lys Asp Trp# 495- Glu Val Asn Glu Pro Glu Arg Leu Ala Lys Va - #l Leu Ser Val Leu Arg# 510- Gly His Pro Ala Arg Thr Ala Glu Lys Ser Ly - #s His Arg Arg Leu Asp# 525- Arg Leu Gly Gly Thr Leu Arg Trp Lys Arg Gl - #n Pro Ala Thr Pro Ala# 540- Leu Met Ser Lys Cys His Phe Ser Leu Ala Al - #a Ala Met Arg His Lys545 5 - #50 5 - #55 5 -#60- Ser Lys Pro Met Ser Lys Ala Leu Pro Cys Tr - #p Asn Arg Ser Gln Met# 575- Ala Ser Ala Thr Ile Lys Ser Lys Ser Thr Ar - #g Phe Arg Arg Lys Ser# 590- Cys Ser Ser Thr Lys Pro Ser Ser Ser Ala As - #p Arg Pro Arg Asn Asp# 605- Gly Leu Ser Trp Arg Phe Ala Arg Val Gly Pr - #o Asn Tyr Arg His Leu# 620- Pro His Gly Val Phe Thr Asp Arg Ile Gly Va - #l Leu Thr Asn Asp Phe625 6 - #30 6 - #35 6 -#40- Phe Val Asn Leu Leu Asp Met Asn Tyr Glu Tr - #p Val Pro Thr Asp Ser# 655- Gly Ile Tyr Glu Ile Arg Asp Arg Lys Thr Gl - #y Glu Val Arg Trp Thr# 670- Ala Thr Arg Val Asp Leu Ile Phe Gly Ser As - #n Ser Ile Leu Arg Ser# 685- Tyr Ala Glu Phe Tyr Ala Gln Asp Asp Asn Gl - #n Glu Lys Phe Val Arg# 700- Asp Phe Ile Asn Ala Trp Val Lys Val Met As - #n Ala Asp Arg Phe Asp705 7 - #10 7 - #15 7 -#20- Leu Val Lys Lys Ala Arg Glu Ser Val Thr Al - #a# 730- (2) INFORMATION FOR SEQ ID NO:52:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 293 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:52:- Thr Thr Pro Leu Val His Val Ala Ser Val Gl - #u Lys Gly Arg Ser Tyr# 15- Glu Asp Phe Gln Lys Val Tyr Asn Ala Ile Al - #a Leu Lys Leu Arg Glu# 30- Asp Asp Glu Tyr Asp Asn Tyr Ile Gly Tyr Gl - #y Pro Val Leu Val Arg# 45- Leu Ala Trp His Ile Ser Gly Thr Trp Asp Ly - #s His Asp Asn Thr Gly# 60- Gly Ser Tyr Gly Gly Thr Tyr Arg Phe Lys Ly - #s Glu Phe Asn Asp Pro#80- Ser Asn Ala Gly Leu Gln Asn Gly Phe Lys Ph - #e Leu Glu Pro Ile His# 95- Lys Glu Phe Pro Trp Ile Ser Ser Gly Asp Le - #u Phe Ser Leu Gly Gly# 110- Val Thr Ala Val Glu Met Gln Gly Pro Lys Il - #e Pro Trp Arg Cys Gly# 125- Arg Val Asp Thr Pro Glu Asp Thr Thr Pro As - #p Asn Gly Arg Leu Pro# 140- Asp Ala Asp Lys Asp Ala Gly Tyr Val Arg Th - #r Phe Phe Gln Arg Leu145 1 - #50 1 - #55 1 -#60- Asn Met Asn Asp Arg Glu Val Val Ala Leu Me - #t Gly Ala His Ala Leu# 175- Gly Lys Thr His Leu Lys Asn Ser Gly Tyr Gl - #u Gly Pro Trp Gly Ala# 190- Ala Asn Asn Val Phe Thr Asn Glu Phe Tyr Le - #u Asn Leu Leu Asn Glu# 205- Asp Trp Lys Leu Glu Lys Asn Asp Ala Asn As - #n Glu Gln Trp Asp Ser# 220- Lys Ser Gly Tyr Met Met Leu Pro Thr Asp Ty - #r Ser Leu Ile Gln Asp225 2 - #30 2 - #35 2 -#40- Pro Lys Tyr Leu Ser Ile Val Lys Glu Tyr Al - #a Asn Asp Gln Asp Lys# 255- Phe Phe Lys Asp Phe Ser Lys Ala Phe Glu Ly - #s Leu Leu Glu Asn Gly# 270- Ile Thr Phe Pro Lys Asp Ala Pro Ser Pro Ph - #e Ile Phe Lys Thr Leu# 285- Glu Glu Gln Gly Leu 290- (2) INFORMATION FOR SEQ ID NO:53:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 652 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:53:- Met Ser Thr Asp Asp Thr His Asn Thr Thr Ly - #s Cys Pro Phe His Gln# 15- Gly Gly His Asp Gln Ser Ala Gly Ala Gly Th - #r Thr Asn Arg Asp Trp# 30- Trp Pro Asn Gln Leu Asp Leu Leu His Gln Hi - #s Ser Asn Arg Ser Asn# 45- Pro Leu Gly Glu Asp Phe Asp Tyr Lys Glu Ph - #e Ser Lys Leu Asp Tyr# 60- Tyr Ala Leu Lys Asp Leu Lys Ala Leu Leu Th - #r Glu Ser Gln Pro Trp#80- Trp Pro Ala Asp Tyr Gly Tyr Gly Pro Leu Ph - #e Ile Arg Met Ala Trp# 95- His Gly Ala Gly Thr Tyr Arg Asp Gly Arg Gl - #y Gly Ala Gly Gly Gln# 110- Arg Phe Ala Pro Leu Asn Ser Trp Pro Asp As - #n Ala Ser Leu Asp Lys# 125- Ala Arg Arg Leu Leu Trp Pro Ile Lys Lys Ty - #r Gly Gln Lys Ile Ser# 140- Trp Ala Asp Leu Phe Ile Leu Ala Gly Asn Va - #l Ala Leu Glu Asn Phe145 1 - #50 1 - #55 1 -#60- Arg Gly Phe Ala Gly Arg Thr Glu Asp Val Tr - #p Glu Pro Asp Leu Asp# 175- Val Asn Trp Gly Glu Lys Ala Trp Leu Thr Hi - #s Arg His Pro Glu Leu# 190- Ala Lys Ala Pro Leu Gly Ala Thr Glu Met Gl - #y Leu Ile Tyr Val Asn# 205- Pro Glu Gly Pro Asn His Ser Pro Leu Ser Al - #a Ala Ala Ala Ile Arg# 220- Thr Phe Arg Met Gly Met Asn Asp Glu Glu Th - #r Val Ala Leu Ile Ala225 2 - #30 2 - #35 2 -#40- Gly Gly His Thr Leu Gly Lys Thr His Gly Al - #a Gly Pro Ala Ser His# 255- Val Gly Pro Pro Glu Ala Ala Pro Ile Glu Al - #a Gln Gly Leu Gly Trp# 270- Ala Ser Ser Tyr Gly Ser Gly Val Gly Ala As - #p Ala Ile Thr Ser Gly# 285- Glu Val Val Trp Thr Gln Thr Pro Thr Gln Tr - #p Asn Phe Phe Glu Asn# 300- Leu Phe Tyr Glu Trp Val Leu Thr Lys Ser Pr - #o Ala Gly Ala Gln Glu305 3 - #10 3 - #15 3 -#20- Ala Val Asp Gly Ala Pro Asp Ile Ile Pro As - #p Pro Phe Asp Pro Ser# 335- Lys Lys Arg Lys Pro Thr Met Leu Val Thr As - #p Leu Leu Arg Phe Asp# 350- Pro Glu Tyr Glu Lys Ile Ser Arg Arg Phe Le - #u Asn Asp Pro Glu Phe# 365- Glu Ala Phe Ala Arg Ala Trp Phe Lys Leu Th - #r His Arg Asp Met Gly# 380- Pro Lys Arg Tyr Ile Gly Pro Glu Val Pro Ly - #s Glu Asp Leu Ile Trp385 3 - #90 3 - #95 4 -#00- Gln Asp Pro Pro Gln Tyr Pro Thr Glu Asp Il - #e Ile Leu Lys Ala Ala# 415- Ile Ala Ala Ser Gly Leu Val Ser Glu Leu Va - #l Ser Ala Trp Ala Ser# 430- Ala Ser Thr Phe Arg Gly Gly Asp Lys Arg Gl - #y Gly Ala Asn Gly Ala# 445- Arg Leu Ala Pro Gln Arg Asp Trp Val Asn Pr - #o Ala Ala Arg Val Leu# 460- Val Leu Glu Glu Ile Gln Thr Lys Ala Ser Le - #u Ala Asp Ile Val Leu465 4 - #70 4 - #75 4 -#80- Gly Val Val Gly Glu Lys Ala Ala Ala Ala Al - #a Gly Leu Ser Ile His# 495- Val Pro Phe Ala Pro Gly Arg Asp Ala Arg Gl - #n Asp Gln Thr Asp Ile# 510- Glu Met Phe Leu Leu Glu Pro Ile Ala Asp Gl - #y Phe Arg Asn Tyr Arg# 525- Ala Leu Asp Val Ser Thr Thr Glu Ser Leu Il - #e Asp Lys Ala Gln Gln# 540- Leu Thr Leu Ala Pro Glu Met Thr Val Leu Va - #l Gly Gly Met Arg Val545 5 - #50 5 - #55 5 -#60- Leu Gly Asn Asp Gly Pro Asn Gly Val Phe Th - #r Asp Arg Gly Val Leu# 575- Asn Asp Phe Phe Val Asn Leu Leu Asp Met Ar - #g Tyr Glu Trp Lys Pro# 590- Thr Asp Leu Glu Gly Arg Asp Arg Thr Gly Gl - #u Val Lys Trp Thr Ala# 605- Arg Asp Leu Val Phe Gly Ser Asn Ser Val Le - #u Arg Ala Leu Ala Glu# 620- Val Tyr Ala Ser Asp Ala Glu Lys Phe Val Ly - #s Asp Phe Val Ala Ala625 6 - #30 6 - #35 6 -#40- Trp Val Lys Val Met Asn Leu Asp Arg Phe As - #p Leu# 650- (2) INFORMATION FOR SEQ ID NO:54:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 57 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:54:- CAGTTCATGG ATCAGAACAA CCCTCTGTCG GGCCTGACCC ACAAGCGCCG GC - #TGTCG 57- (2) INFORMATION FOR SEQ ID NO:55:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 33 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:55:- Phe Phe Gly Ser Ser Gln Leu Ser Gln Phe Me - #t Asp Gln Asn Asn Pro# 15- Leu Ser Glu Ile Thr His Lys Arg Arg Ile Se - #r Ala Leu Gly Pro Gly# 30- Gly- (2) INFORMATION FOR SEQ ID NO:56:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 33 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:56:- Phe Phe Gly Thr Ser Gln Leu Ser Gln Phe Me - #t Asp Gln Asn Asn Pro# 15- Leu Ser Gly Leu Thr His Lys Arg Arg Leu Se - #r Ala Leu Gly Pro Gly# 30- Gly- (2) INFORMATION FOR SEQ ID NO:57:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 3447 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:57:- GTGCCCGGCG CGCCCAACCG AATTTCATTT GCCAAGCTCC GCGAACCGCT TG - #AGGTTCCG 60- GGGCTACTTG ATGTGCAGAC TGATTCATTT GAGTGGTTGA TCGGATCGCC GT - #GCTGGCGT 120- GCAGCGGCCG CAAGCCGCGG CGATCTCAAG CCGGTGGGTG GTCTCGAAGA GG - #TGCTCTAC 180- GAGCTGTCGC CGATCGAGGA TTTCTCCGGC TCAATGTCAT TGTCTTTCTC CG - #ATCCCCGT 240- TTTGACGAAG TCAAGGCGCC CGTCGAAGAG TGCAAAGACA AGGACATGAC GT - #ACGCGGCC 300- CCGCTGTTCG TCACGGCCGA GTTCATCAAC AACAACACCG GGGAGATCAA GA - #GCCAGACG 360- GTGTTTATGG GCGACTTCCC TATGATGACT GAGAAGGGAA CCTTCATCAT CA - #ACGGGACC 420- GAGCGTGTCG TCGTTAGCCA GCTGGTGCGC TCCCCTGGAG TATACTTCGA CG - #AGACGATC 480- GACAAGTCCA CAGAAAAGAC GCTGCATAGT GTCAAGGTGA TTCCCAGCCG CG - #GTGCCTGG 540- TTGGAATTCG ATGTCGATAA ACGCGACACC GTCGGTGTCC GCATTGACCG GA - #AGCGCCGG 600- CAACCCGTCA CGGTGCTTCT CAAAGCGCTA GGTTGGACCA GTGAGCAGAT CA - #CCGAGCGT 660- TTCGGTTTCT CCGAGATCAT GCGCTCGACG CTGGAGAAGG ACAACACAGT TG - #GCACCGAC 720- GAGGCGCTGC TAGACATCTA TCGTAAGTTG CGCCCAGGTG AGCCGCCGAC TA - #AGGAGTCC 780- GCGCAGACGC TGTTGGAGAA CCTGTTCTTC AAGGAGAAAC GCTACGACCT GG - #CCAGGGTT 840- GGTCGTTACA AGGTCAACAA GAAGCTCGGG TTGCACGCCG GTGAGTTGAT CA - #CGTCGTCC 900- ACGCTGACCG AAGAGGATGT CGTCGCCACC ATAGAGTACC TGGTTCGTCT GC - #ATGAGGGT 960- CAGTCGACAA TGACTGTCCC AGGTGGGGTA GAAGTGCCAG TGGAAACTGA CG - #ATATCGAC1020- CACTTCGGCA ACCGCCGGCT GCGCACGGTC GGCGAATTGA TCCAGAACCA GA - #TCCGGGTC1080- GGTATGTCGC GGATGGAGCG GGTGGTCCGG GAGCGGATGA CCACCCAGGA CG - #TCGAGGCG1140- ATCACGCCGC AGACGCTGAT CAATATCCGT CCGGTGGTCG CCGCTATCAA GG - #AATTCTTC1200- GGCACCAGCC AGCTGTCGCA GTTCATGGAT CAGAACAACC CTCTGTCGGG CC - #TGACCCAC1260- AAGCGCCGGC TGTCGGCGCT GGGCCCGGGT GGTTTGTCGC GTGAGCGTGC CG - #GGCTAGAG1320- GTCCGTGACG TGCACCCTTC GCACTACGGC CGGATGTGCC CGATCGAGAC TC - #CGGAGGGC1380- CCGAACATAG GTCTGATCGG TTCATTGTCG GTGTACGCGC GGGTCAACCC CT - #TCGGGTTC1440- ATCGAAACAC CGTACCGCAA AGTGGTTGAC GGTGTGGTCA GCGACGAGAT CG - #AATACTTG1500- ACCGCTGACG AGGAAGACCG CCATGTCGTG GCGCAGGCCA ACTCGCCGAT CG - #ACGAGGCC1560- GGCCGTTCCT CGAGCCGCGC GTGTTGGGTG CGCCGCAAGG CGGGCGAGGT GG - #AGTACGTG1620- GCCTCGTCCG AGGTGGATTA CATGGATGTC TCGCCACGCC AGATGGTGTC GG - #TGGCCACA1680- GCGATGATTC CGTTCCTTGA GCACGACGAC GCCAACCGTG CCCTGATGGG CG - #CTAACATG1740- CAGCGCCAAG CGGTTCCGTT GGTGCGCAGC GAACGACCGT TGGTGGGTAC CG - #GTATGGAG1800- TTGCGCGCGG CCATCGACGC TGGCCACGTC GTCGTTGCGG AGAAGTCCGG GG - #TGATCGAG1860- GAGGTTTCCG CCGACTACAT CACCGTGATG GCCGATGACG GCACCCGGCG GA - #CTTATCGG1920- ATGCGTAAGT TCGCGCGCTC CAACCACGGC ACCTGCGCCA ACCAGTCCCC GA - #TCGTGGAT1980- GCGGGGGATC GGGTCGAGGC CGGCCAAGTG ATTGCTGACG GTCCGTGCAC TG - #AGAACGGC2040- GAGATGGCGT TGGGCAAGAA CTTGCTGGTG GCGATCAATG CCGTGGGAGG GT - #CAACAACT2100- AACGAGGATG CGATCATCCT GTCTAACCGA CTGGTCGAAG AGGACGTGCT TA - #CTTCGATT2160- CACATTGAGG AGCATGAGAT CGACGCCCGT GACACCAAGC TGGGTGCTGA GG - #AGATCACC2220- CGGGACATTC CCAACGTCTC CGATGAGGTG CTAGCCGACT TGGACGAGCG GG - #GCATCGTG2280- CGGATTGGCG CGGAGGTTCG TGACGGTGAT ATCCTGGTTG GCAAGGTCAC CC - #CGAAGGGG2340- GAAACTGAGC TGACACCGGA AGAGCGGTTG CTGCGGGCGA TCTTCGGCGA AA - #AGGCCCGC2400- GAGGTCCGTG ACACGTCGCT GAAGGTGCCA CACGGCGAAT CCGGCAAGGT GA - #TCGGCATT2460- CGGGTGTTCT CCCATGAGGA TGACGACGAG CTGCCCGCCG GCGTCAACGA GC - #TGGTCCGT2520- GTCTACGTAG CCCAGAAGCG CAAGATCTCT GACGGTGACA AGCTGGCTGG GC - #GGCACGGC2580- AACAAGGGCG TGATCGGCAA GATCCTGCCT GCCGAGGATA TGCCGTTTCT GC - #CAGACGGC2640- ACCCCGGTGG ACATCATCCT CAACACTCAC GGGGTGCCGC GGCGGATGAA CG - #TCGGTCAG2700- ATCTTGGAAA CCCACCTTGG GTGGGTAGCC AAGTCCGGCT GGAAGATCGA CG - #TGGCCGGC2760- GGTATACCGG ATTGGGCGGT CAACTTGCCT GAGGAGTTGT TGCACGCTGC GC - #CCAACCAG2820- ATCGTGTCGA CCCCGGTGTT CGACGGCGCC AAGGAAGAGG AACTACAGGG CC - #TGTTGTCC2880- TCCACGTTGC CCAACCGCGA CGGCGATGTG ATGGTGGGCG GCGACGGCAA GG - #CGGTGCTC2940- TTCGATGGGC GCAGCGGTGA GCCGTTCCCT TATCCGGTGA CGGTTGGCTA CA - #TGTACATC3000- ATGAAGCTGC ACCACTTGGT GGACGACAAG ATCCACGCCC GCTCCACCGG CC - #CGTACTCG3060- ATGATTACCC AGCAGCCGTT GGGTGGTAAG GCACAGTTCG GTGGCCAGCG AT - #TCGGTGAG3120- ATGGAGTGCT GGGCCATGCA GGCCTACGGT GCGGCCTACA CGCTGCAGGA GC - #TGTTGACC3180- ATCAAGTCCG ACGACACCGT CGGTCGGGTC AAGGTTTACG AGGCTATCGT TA - #AGGGTGAG3240- AACATCCCCG AGCCGGGCAT CCCCGAGTCG TTCAAGGTGC TGCTCAAGGA GT - #TACAGTCG3300- CTGTGTCTCA ACGTCGAGGT GCTGTCGTCC GACGGTGCGG CGATCGAGTT GC - #GCGAAGGT3360- GAGGATGAGG ACCTCGAGCG GGCTGCGGCC AACCTCGGTA TCAACTTGTC CC - #GCAACGAA3420# 3447 ATCT GGCTTAG- (2) INFORMATION FOR SEQ ID NO:58:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 1148 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:58:- Val Pro Gly Ala Pro Asn Arg Ile Ser Phe Al - #a Lys Leu Arg Glu Pro# 15- Leu Glu Val Pro Gly Leu Leu Asp Val Gln Th - #r Asp Ser Phe Glu Trp# 30- Leu Ile Gly Ser Pro Cys Trp Arg Ala Ala Al - #a Ala Ser Arg Gly Asp# 45- Leu Lys Pro Val Gly Gly Leu Glu Glu Val Le - #u Tyr Glu Leu Ser Pro# 60- Ile Glu Asp Phe Ser Gly Ser Met Ser Leu Se - #r Phe Ser Asp Pro Arg#80- Phe Asp Glu Val Lys Ala Pro Val Glu Glu Cy - #s Lys Asp Lys Asp Met# 95- Thr Tyr Ala Ala Pro Leu Phe Val Thr Ala Gl - #u Phe Ile Asn Asn Asn# 110- Thr Gly Glu Ile Lys Ser Gln Thr Val Phe Me - #t Gly Asp Phe Pro Met# 125- Met Thr Glu Lys Gly Thr Phe Ile Ile Asn Gl - #y Thr Glu Arg Val Val# 140- Val Ser Gln Leu Val Arg Ser Pro Gly Val Ty - #r Phe Asp Glu Thr Ile145 1 - #50 1 - #55 1 -#60- Asp Lys Ser Thr Glu Lys Thr Leu His Ser Va - #l Lys Val Ile Pro Ser# 175- Arg Gly Ala Trp Leu Glu Phe Asp Val Asp Ly - #s Arg Asp Thr Val Gly# 190- Val Arg Ile Asp Arg Lys Arg Arg Gln Pro Va - #l Thr Val Leu Leu Lys# 205- Ala Leu Gly Trp Thr Ser Glu Gln Ile Thr Gl - #u Arg Phe Gly Phe Ser# 220- Glu Ile Met Arg Ser Thr Leu Glu Lys Asp As - #n Thr Val Gly Thr Asp225 2 - #30 2 - #35 2 -#40- Glu Ala Leu Leu Asp Ile Tyr Arg Lys Leu Ar - #g Pro Gly Glu Pro Pro# 255- Thr Lys Glu Ser Ala Gln Thr Leu Leu Glu As - #n Leu Phe Phe Lys Glu# 270- Lys Arg Tyr Asp Leu Ala Arg Val Gly Arg Ty - #r Lys Val Asn Lys Lys# 285- Leu Gly Leu His Ala Gly Glu Leu Ile Thr Se - #r Ser Thr Leu Thr Glu# 300- Glu Asp Val Val Ala Thr Ile Glu Tyr Leu Va - #l Arg Leu His Glu Gly305 3 - #10 3 - #15 3 -#20- Gln Ser Thr Met Thr Val Pro Gly Gly Val Gl - #u Val Pro Val Glu Thr# 335- Asp Asp Ile Asp His Phe Gly Asn Arg Arg Le - #u Arg Thr Val Gly Glu# 350- Leu Ile Gln Asn Gln Ile Arg Val Gly Met Se - #r Arg Met Glu Arg Val# 365- Val Arg Glu Arg Met Thr Thr Gln Asp Val Gl - #u Ala Ile Thr Pro Gln# 380- Thr Leu Ile Asn Ile Arg Pro Val Val Ala Al - #a Ile Lys Glu Phe Phe385 3 - #90 3 - #95 4 -#00- Gly Thr Ser Gln Leu Ser Gln Phe Met Asp Gl - #n Asn Asn Pro Leu Ser# 415- Gly Leu Thr His Lys Arg Arg Leu Ser Ala Le - #u Gly Pro Gly Gly Leu# 430- Ser Arg Glu Arg Ala Gly Leu Glu Val Arg As - #p Val His Pro Ser His# 445- Tyr Gly Arg Met Cys Pro Ile Glu Thr Pro Gl - #u Gly Pro Asn Ile Gly# 460- Leu Ile Gly Ser Leu Ser Val Tyr Ala Arg Va - #l Asn Pro Phe Gly Phe465 4 - #70 4 - #75 4 -#80- Ile Glu Thr Pro Tyr Arg Lys Val Val Asp Gl - #y Val Val Ser Asp Glu# 495- Ile Glu Tyr Leu Thr Ala Asp Glu Glu Asp Ar - #g His Val Val Ala Gln# 510- Ala Asn Ser Pro Ile Asp Glu Ala Gly Arg Se - #r Ser Ser Arg Ala Cys# 525- Trp Val Arg Arg Lys Ala Gly Glu Val Glu Ty - #r Val Ala Ser Ser Glu# 540- Val Asp Tyr Met Asp Val Ser Pro Arg Gln Me - #t Val Ser Val Ala Thr545 5 - #50 5 - #55 5 -#60- Ala Met Ile Pro Phe Leu Glu His Asp Asp Al - #a Asn Arg Ala Leu Met# 575- Gly Ala Asn Met Gln Arg Gln Ala Val Pro Le - #u Val Arg Ser Glu Arg# 590- Pro Leu Val Gly Thr Gly Met Glu Leu Arg Al - #a Ala Ile Asp Ala Gly# 605- His Val Val Val Ala Glu Lys Ser Gly Val Il - #e Glu Glu Val Ser Ala# 620- Asp Tyr Ile Thr Val Met Ala Asp Asp Gly Th - #r Arg Arg Thr Tyr Arg625 6 - #30 6 - #35 6 -#40- Met Arg Lys Phe Ala Arg Ser Asn His Gly Th - #r Cys Ala Asn Gln Ser# 655- Pro Ile Val Asp Ala Gly Asp Arg Val Glu Al - #a Gly Gln Val Ile Ala# 670- Asp Gly Pro Cys Thr Glu Asn Gly Glu Met Al - #a Leu Gly Lys Asn Leu# 685- Leu Val Ala Ile Asn Ala Val Gly Gly Ser Th - #r Thr Asn Glu Asp Ala# 700- Ile Ile Leu Ser Asn Arg Leu Val Glu Glu As - #p Val Leu Thr Ser Ile705 7 - #10 7 - #15 7 -#20- His Ile Glu Glu His Glu Ile Asp Ala Arg As - #p Thr Lys Leu Gly Ala# 735- Glu Glu Ile Thr Arg Asp Ile Pro Asn Val Se - #r Asp Glu Val Leu Ala# 750- Asp Leu Asp Glu Arg Gly Ile Val Arg Ile Gl - #y Ala Glu Val Arg Asp# 765- Gly Asp Ile Leu Val Gly Lys Val Thr Pro Ly - #s Gly Glu Thr Glu Leu# 780- Thr Pro Glu Glu Arg Leu Leu Arg Ala Ile Ph - #e Gly Glu Lys Ala Arg785 7 - #90 7 - #95 8 -#00- Glu Val Arg Asp Thr Ser Leu Lys Val Pro Hi - #s Gly Glu Ser Gly Lys# 815- Val Ile Gly Ile Arg Val Phe Ser His Glu As - #p Asp Asp Glu Leu Pro# 830- Ala Gly Val Asn Glu Leu Val Arg Val Tyr Va - #l Ala Gln Lys Arg Lys# 845- Ile Ser Asp Gly Asp Lys Leu Ala Gly Arg Hi - #s Gly Asn Lys Gly Val# 860- Ile Gly Lys Ile Leu Pro Ala Glu Asp Met Pr - #o Phe Leu Pro Asp Gly865 8 - #70 8 - #75 8 -#80- Thr Pro Val Asp Ile Ile Leu Asn Thr His Gl - #y Val Pro Arg Arg Met# 895- Asn Val Gly Gln Ile Leu Glu Thr His Leu Gl - #y Trp Val Ala Lys Ser# 910- Gly Trp Lys Ile Asp Val Ala Gly Gly Ile Pr - #o Asp Trp Ala Val Asn# 925- Leu Pro Glu Glu Leu Leu His Ala Ala Pro As - #n Gln Ile Val Ser Thr# 940- Pro Val Phe Asp Gly Ala Lys Glu Glu Glu Le - #u Gln Gly Leu Leu Ser945 9 - #50 9 - #55 9 -#60- Ser Thr Leu Pro Asn Arg Asp Gly Asp Val Me - #t Val Gly Gly Asp Gly# 975- Lys Ala Val Leu Phe Asp Gly Arg Ser Gly Gl - #u Pro Phe Pro Tyr Pro# 990- Val Thr Val Gly Tyr Met Tyr Ile Met Lys Le - #u His His Leu Val Asp# 10050- Asp Lys Ile His Ala Arg Ser Thr Gly Pro Ty - #r Ser Met Ile Thr Gln# 10205- Gln Pro Leu Gly Gly Lys Ala Gln Phe Gly Gl - #y Gln Arg Phe Gly Glu# 10401030 - # 1035- Met Glu Cys Trp Ala Met Gln Ala Tyr Gly Al - #a Ala Tyr Thr Leu Gln# 10550- Glu Leu Leu Thr Ile Lys Ser Asp Asp Thr Va - #l Gly Arg Val Lys Val# 10705- Tyr Glu Ala Ile Val Lys Gly Glu Asn Ile Pr - #o Glu Pro Gly Ile Pro# 10850- Glu Ser Phe Lys Val Leu Leu Lys Glu Leu Gl - #n Ser Leu Cys Leu Asn# 11005- Val Glu Val Leu Ser Ser Asp Gly Ala Ala Il - #e Glu Leu Arg Glu Gly# 11201110 - # 1115- Glu Asp Glu Asp Leu Glu Arg Ala Ala Ala As - #n Leu Gly Ile Asn Leu# 11350- Ser Arg Asn Glu Ser Ala Ser Ile Glu Asp Le - #u Ala# 1145- (2) INFORMATION FOR SEQ ID NO:59:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 432 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:59:- GGCAACCGCC GCCTGCGTAC GGTCGGCGAG CTGATCCAAA ACCAGATCCG GG - #TCGGCATG 60- TCGCGGATGG AGCGGGTGGT CCGGGAGCGG ATGACCACCC AGGACGTGGA GG - #CGATCACA 120- CCGCAGACGT TGATCAACAT CCGGCCGGTG GTCGCCGCGA TCAAGGAGTT CT - #TCGGCACC 180- AGCCAGCTGA GCCAATTCAT GGACCAGAAC AACCCGCTGT CGGGGTTGAC GC - #ACAAGCGC 240- CGACTGTCGG CGCTGGGGCC CGGCGGTCTG TCACGTGAGC GTGCCGGGCT GG - #AGGTCCGC 300- GACGTGCACC CGTCGCACTA CGGCCGGATG TGCCCGATCG AAACCCCTGA GG - #GGCCCAAC 360- ATCGGTCTGA TCGGCTCGCT GTCGGTGTAC GCGCGGGTCA ACCCGTTCGG GT - #TCATCGAA 420# 432- (2) INFORMATION FOR SEQ ID NO:60:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 144 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:60:- Gly Asn Arg Arg Leu Arg Thr Val Gly Glu Le - #u Ile Gln Asn Gln Ile# 15- Arg Val Gly Met Ser Arg Met Glu Arg Val Va - #l Arg Glu Arg Met Thr# 30- Thr Gln Asp Val Glu Ala Ile Thr Pro Gln Th - #r Leu Ile Asn Ile Arg# 45- Pro Val Val Ala Ala Ile Lys Glu Phe Phe Gl - #y Thr Ser Gln Leu Ser# 60- Gln Phe Met Asp Gln Asn Asn Pro Leu Ser Gl - #y Leu Thr His Lys Arg#80- Arg Leu Ser Ala Leu Gly Pro Gly Gly Leu Se - #r Arg Glu Arg Ala Gly# 95- Leu Glu Val Arg Asp Val His Pro Ser His Ty - #r Gly Arg Met Cys Pro# 110- Ile Glu Thr Pro Glu Gly Pro Asn Ile Gly Le - #u Ile Gly Ser Leu Ser# 125- Val Tyr Ala Arg Val Asn Pro Phe Gly Phe Il - #e Glu Thr Pro Tyr Arg# 140- (2) INFORMATION FOR SEQ ID NO:61:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 462 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:61:- ATGCCCGATC ACAGGGCACT GCGGCAGGGA ATAATTGCAC TACGCCAACA TG - #TTAACAAC 60- GAACACAATT TACCTGGGAG CCGGTATATG CCCACCATTC AGCAGCTGGT AC - #GCAAGGGT 120- CGTCGAGACA AGATTGGCAA GGTCAAGACT GCGGCTCTGA AGGGCAACCC AC - #AGCGTCGC 180- GGTGTTTGCA CCCGTGTGTA CACTTCCACC CCGAAGAAGC CGAACTCGGC GC - #TTCGCAAG 240- GTTGCCCGCG TGAAGCTGAC GAGTCAGGTT GAGGTCACAG CGTACATACC AG - #GCGAGGGT 300- CACAACCTAC AGGAACACTC CATGGTGTTG GTGCGTGGTG GCCGGGTGAA AG - #ATCTGCCT 360- GGTGTGCGTT ACAAAATCAT TCGCGGTTCG CTCGACACCC AGGGTGTCAA GA - #ACCGGAAG 420# 462 ATGG AGCCAAGAAG GAGAAGAGCT GA- (2) INFORMATION FOR SEQ ID NO:62:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 124 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:62:- Met Pro Thr Ile Gln Gln Leu Val Arg Lys Gl - #y Arg Arg Asp Lys Ile# 15- Gly Lys Val Lys Thr Ala Ala Leu Lys Gly As - #n Pro Gln Arg Arg Gly# 30- Val Cys Thr Arg Val Tyr Thr Ser Thr Pro Ly - #s Lys Pro Asn Ser Ala# 45- Leu Arg Lys Val Ala Arg Val Lys Leu Thr Se - #r Gln Val Glu Val Thr# 60- Ala Tyr Ile Pro Gly Glu Gly His Asn Leu Gl - #n Glu His Ser Met Val#80- Leu Val Arg Gly Gly Arg Val Lys Asp Leu Pr - #o Gly Val Arg Tyr Lys# 95- Ile Ile Arg Gly Ser Leu Asp Thr Gln Gly Va - #l Lys Asn Arg Lys Gln# 110- Ala Arg Ser Arg Tyr Gly Ala Lys Lys Glu Ly - #s Ser# 120- (2) INFORMATION FOR SEQ ID NO:63:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 306 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:63:- CCCACCATTC AGCAGCTGGT CCGCAAGGGT CGTCGGGACA AGATCAGTAA GG - #TCAAGACC 60- GCGGCTCTGA AGGGCAGCCC GCAGCGTCGT GGTGTATGCA CCCGCGTGTA CA - #CCACCACT 120- CCGAAGAAGC CGAACTCGGC GCTTCGGAAG GTTGCCCGCG TGAAGTTGAC GA - #GTCAGGTC 180- GAGGTCACGG CGTACATTCC CGGCGAGGCG CACAACCTGC AGGAGCACTC GA - #TGGTGCTG 240- GTGCGCGGCG GCCGGGTGAA GGACCTGCCT GGTGTGCGCT ACAAGATCAT TC - #GCGGTTCG 300# 306- (2) INFORMATION FOR SEQ ID NO:64:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 102 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:64:- Pro Thr Ile Gln Gln Leu Val Arg Lys Gly Ar - #g Arg Asp Lys Ile Ser# 15- Lys Val Lys Thr Ala Ala Leu Lys Gly Ser Pr - #o Gln Arg Arg Gly Val# 30- Cys Thr Arg Val Tyr Thr Thr Thr Pro Lys Ly - #s Pro Asn Ser Ala Leu# 45- Arg Lys Val Ala Arg Val Lys Leu Thr Ser Gl - #n Val Glu Val Thr Ala# 60- Tyr Ile Pro Gly Glu Ala His Asn Leu Gln Gl - #u His Ser Met Val Leu#80- Val Arg Gly Gly Arg Val Lys Asp Leu Pro Gl - #y Val Arg Tyr Lys Ile# 95- Ile Arg Gly Ser Leu Asp 100- (2) INFORMATION FOR SEQ ID NO:65:- (i) SEQUENCE CHARACTERISTICS:#pairs (A) LENGTH: 264 base (B) TYPE: nucleic acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: DNA (genomic)- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:65:- CGCAAGGGTC GTCGAGACAA GATTGGCAAG GTCAAGACCG CGGCTCTGAA GG - #GCAGCCCG 60- CAGCGTCGTG GTGTATGCAC CCGCGTGTAC ACCACCACTC CGAAGAAGCC GA - #ACTCGGCG 120- CTTCGGAAGG TTGCCCGCGT GAAGTTGACG AGTCAGGTCG AGGTCACGGC GT - #ACATTCCC 180- GGCGAGGCGC ACAACCTGCA GGAGCACTCG ATGGTGCTGG TGCGCGGCGG CC - #GGGTGAAG 240# 264GCTA CAAG- (2) INFORMATION FOR SEQ ID NO:66:- (i) SEQUENCE CHARACTERISTICS:#acids (A) LENGTH: 88 amino (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear- (ii) MOLECULE TYPE: peptide- (xi) SEQUENCE DESCRIPTION: SEQ ID NO:66:- Arg Lys Gly Arg Arg Asp Lys Ile Gly Lys Va - #l Lys Thr Ala Ala Leu# 15- Lys Gly Asn Pro Gln Arg Arg Gly Val Cys Th - #r Arg Val Tyr Thr Ser# 30- Thr Pro Lys Lys Pro Asn Ser Ala Leu Arg Ly - #s Val Ala Arg Val Lys# 45- Leu Thr Ser Gln Val Glu Val Thr Ala Tyr Il - #e Pro Gly Glu Gly His# 60- Asn Leu Gln Glu His Ser Met Val Leu Val Ar - #g Gly Gly Arg Val Lys#80- Asp Leu Pro Gly Val Arg Tyr Lys 85__________________________________________________________________________

Number	Date	Country	Kind
92/11098	Sep 1992	FRX
93/04545	Apr 1993	FRX

Number	Name	Date
4683195	Mullis et al.	Jul 1987
5633131	Heym et al.	May 1997
5871912	Heym et al.	Feb 1999

Number	Date	Country
0 223 156	May 1987	EPX
WO9104036	Apr 1991	WOX
WO 9 106 674	May 1991	WOX
WO 95 33 074	Dec 1995	WOX

Rapid detection of antibiotic resistance in mycobacterium tuberculosis

Information

Patent Number

Date Filed

Date Issued

Inventors

Original Assignees

Examiners

Agents

CPC

US Classifications

Field of Search

US

International Classifications

Abstract

Description

Claims

Priority Claims (2)

Parent Case Info

US Referenced Citations (3)

Foreign Referenced Citations (4)

Non-Patent Literature Citations (8)

Continuations (1)

Entry
Heym et al. (1992), Research in Microbiology, vol. 143, No. 7, pp. 721-730.
Jin et al. (1988), Journal of Molecular Biology, vol. 202, No. 1, pp. 45-58.
Sriprakash et al. (1970), The Journal of General Microbiology, vol. 60, No. 1, pp. 125-132.
Telenti et al. (1993), The Lancet, vol. 341, No. 8846, pp. 647-650.
Zhang et al. (1992), Nature, vol. 358, No. 6387, pp. 591-593.
Prescott et al Microbiology pp. 253-256, 1990.
CDC MMWP vol. 39 No. 22 pp. 369-372, 1990.
Devi et al Biochem J. vol. 149 pp. 187-197, 1975.