This application claims the benefit of European Patent Application No. 20 191 142.7, filed Aug. 14, 2020, the entire contents of each of which are fully incorporated herein by reference.
A Sequence Listing, which is a part of the present disclosure, is submitted concurrently with the specification as a text file. The name of the text file containing the Sequence Listing is “56989_Seqlisting.txt.” The Sequence Listing was created on Jul. 30, 2021, and is 64,132 bytes in size. The subject matter of the Sequence Listing is incorporated by reference herein in its entirety.
The present invention aims to provide a novel vaccine for the treatment and/or prevention of coronavirus diseases. Thus, the present invention is within the field of coronavirus vaccines.
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is the strain of coronavirus that causes coronavirus disease 2019 (COVID-19), the respiratory illness responsible for the COVID-19 pandemic. SARS-CoV-2 has wreaked havoc around the world crippling healthcare systems and devastating economies. More particularly, SARS-CoV-2 is an emerging virus that is highly pathogenic and caused the recent global pandemic, officially known as coronavirus disease (COVID-19). It belongs to the family of Coronaviruses (CoVs), which can cause mild to lethal respiratory tract infections in mammals and birds. Members causing more lethal infections in humans include SARS-CoV, Middle East respiratory syndrome (MERS) and SARS-CoV-2. These are cytoplasmic replicating, single-stranded RNA viruses with four structural proteins: The Spike (S) glycoprotein, the envelope protein (E), the membrane protein (M), and the nucleocapsid protein (N) (Chen et al., 2020). The S protein plays a critical role in triggering the immune response in the disease process (To et al., 2020). SARS-CoV-2 enters host cells via the receptor angiotensin converting enzyme 2 (ACE2) and the S protein is required for cell entry (Hoffmann et al., 2020, Ou et al., 2020, Zhou et al., 2020). The trimeric S protein contains two subunits, S1 and S2, which mediate receptor binding and membrane fusion, respectively. The S1 subunit contains a fragment called the receptor-binding domain (RBD) that is capable of binding ACE2 (Letko et al., 2020, Wan et al., 2020). Binding of the S protein to the ACE2 receptor triggers complex conformational changes that move the S protein from a prefusion conformation to a postfusion conformation. In view of previous studies and the experience of previously approved SARS-CoV-2 vaccines, the inventors considered that the S protein elicits potent cellular and humoral immune responses. The S protein of SARS-CoV-2, particularly the RBD, is capable of inducing neutralizing antibody and T cell immune responses (Suthar et al., 2020).
In addition to the S protein, the nucleocapsid protein (N protein) may function as promising antigen in vaccines. For the CoV N protein it has been demonstrated to induce protective specific cytotoxic T lymphocytes (Gao et al., 2003, Kim et al., 2004).
Live attenuated S. enterica serovar Typhi (S. typhi) are candidates for the engineering of live recombinant mucosal vaccines. One strategy to develop new vaccines is the use of live attenuated bacteria as carriers for the presentation of heterologous antigens (Cheminay et al., 2008). Salmonella strains are useful since these strains can be administered orally, i.e. by the natural route of infection, and may induce mucosal as well as systemic immune responses. Both humoral and cellular immune responses can be primed by this form of application. Furthermore, convenient methods for the genetic manipulation of Salmonella are available, and one can express single or multiple heterologous antigens from other bacteria or from viruses or parasites, allowing to create a single recombinant vaccine for simultaneous protection against S. typhi and other pathogens. More than 20 years of experience with a licensed live attenuated Salmonella vaccine, S. typhi Ty21a (Typhoral® L) (Xu et al., 2013) are available and indicate that this strain is safe in mass vaccination against typhoid fever.
To produce foreign antigens in S. typhi, plasmids carrying genetic cassettes for the expression and delivery of cargo proteins have been generated. Therefore, plasmid stability is the most critical parameter for the successful delivery of cargo proteins (antigens) in vaccinated humans. Plasmid stability in general has been achieved by integrating genes conferring antibiotics resistance into the plasmid. However, the use of antibiotic resistance genes as a selective determinant for plasmid maintenance is impractical in vivo. This problem was first addressed by the construction of a balanced-lethal system in which the asd gene of St. mutans was introduced in a plasmid that complements an asd mutation in the chromosome of an diaminopimelic acid auxotrophic Salmonella strain (Galan et al., 1990).
Recently, the inventors developed a balanced-lethal-system (BLS) for the antibiotic-free stabilization of plasmids in S. typhi Ty21a which is independent of any auxotrophy. The system depends on the complementation of an essential gene and therefore does not require cost-intensive defined media for selection. The BLS the inventors designed is made up of the chromosomal knockout of the putative essential gene tyrS encoding for the tyrosyl-tRNA-synthetase and the in trans complementation of this gene on the respective antigen-delivery-plasmid (Diessner, 2009, Gesser, 2010). For the construction of the chromosomal tyrS-knockout the inventors modified the method of “one-step inactivation of chromosomal genes using PCR products” which was described by Datsenko and Wanner (2000) (Datsenko et al., 2000). As tyrS is an essential gene, the approach described by Datsenko and Wanner (2000) has to be adapted since the knockout without genetic compensation would be lethal. For this reason, tyrS was replaced by a knock-in fragment encoding for the antibiotic resistance and also for a gene encoding E. coli tyrS flanked by two flippase recognition targets (FRT) for the conditional deletion in complemented strains resulting in the newly generated (FRT-tyrS Cm FRT)-knock-in-strain (->S.t. Typhi Ty21a (ΔtyrS (tyrS Cm)+) (Diessner, 2009). Based on this intermediate strain, the balanced lethal stabilized vaccine strains can be constructed.
Antigens expressed by the Salmonella carriers can be secreted as hemolysin fusion proteins via the hemolysin (HlyA) secretion system of Escherichia coli, which allows efficient protein secretion (Gentschev et al., 1996). The secretion of antigens from the carrier strain has been used for anti-infective vaccination and for cancer vaccines (Hess et al., 1996, Gomez-Duarte et al., 2001, Fensterle et al., 2008). Protein antigens can be fused to cholera toxin subunit B (CtxB) (Arakawa et al., 1998, Yuki et al., 2001, Sadeghi et al., 2002), one of the most effective experimental mucosal adjuvants (Holmgren et al., 2005, Lycke, 2005). U.S. Pat. No. 10,973,908 B1 (date of patent: Apr. 13, 2021) relates to the expression of Sars-Cov-2 spike protein receptor binding domain in attenuated salmonella as a vaccine.
In summary, there is currently a dire need for a vaccine that can prevent SARS-CoV-2 infections. In particular, there is still an urgent need for a SARS-CoV-2 vaccine that can be used globally and with less stringent handling requirements, i.e. provided at moderate costs, stored without a need for ultra-low temperature freezers or other high-tech equipment, and administered without the need for medical equipment or trained medical personnel.
A) Codon-optimized sequence (SEQ ID NO: 119) of CDS RBD (Receptor-binding domain) of S-Protein in fusion protein A1. CodonUsage adapted to Salmonella typhi (strain ATCC 700931/Ty2) using JCat http://www.jcat.de. A total of 76 codons of RBD coding sequence (CDS RBD: 223 codons, S-Protein Wuhan Hu-1, GeneID 43740568—NC_045512.2, (SEQ ID NO: 179)) were modified for optimal codon utilization, which resulted in no change in the amino acid sequence of the encoded protein. The sequence alignments were performed using the SnapGene software using global alignment (Needleman-Wunsch).
B) Codon usage optimization of the Dimerization Region (DR) of N-Protein (SEQ ID NO: 169). CodonUsage adapted to Salmonella typhi (strain ATCC 700931/Ty2) using JCat: http://www.jcat.de. A total of 65 codons of DR coding sequence (CDS DR: 104 codons, (SEQ ID NO: 182) CDS N-Protein NC_045512.2, GeneID: 43740575) were modified for optimal codon utilization, which resulted in no change in the amino acid sequence of the encoded protein. The sequence alignments were performed by SnapGene software using global alignment (Needleman-Wunsch)
A. Shown is the sequence of the ΔtyrS locus of the BLS strains. (TAA in bold: Stop codon of ΔtyrS upstream-gene pdxH; ATG in bold: Start codon of ΔtyrS downstream-gene pdxY; FRT-Site (minimal): underlined). SEQ ID NO: 184
B. Validation of the tyrS deletion in the indicated strains by PCR amplification. (Primer sequences (17/18; SEQ ID NO: 47/48)) correspond to regions flanking tyrS gene on chromosome.)
A: Expression and secretion of fusion proteins A1 (49.1 kDa) and A3 (45.8 kDa) detected in the lysate of bacteria (pellet) and the supernatant using anti-CtxB and anti-S-protein antisera. Proteins precipitated from supernatant (S) of bacterial culture or pellets of whole cell lysate (P) were loaded. The immunoblots were developed with anti-CtxB antibody and anti-RBD-Antibody. Arrow: 55 kDa.
B: Expression of fusion proteins B3 (27.6 kDa), B5 (20.7 kDa) and B7 (23.0 kDa). Whole cell lysate of mid-log cultures were analyzed by Western blot. The immunoblots were developed with anti-hBD1 antibody (abeam). Black arrow indicates the mol. mass of 35 kDa
The present invention provides a live-attenuated bacterium of the genus Salmonella comprising a recombinant plasmid encoding a fusion protein, wherein the fusion protein comprises a coronavirus antigen, and an adjuvant peptide.
The present invention also provides a combination product comprising the bacterium of the present invention and at least one of the one or more fusion proteins encoded by the plasmid of said bacterium.
Further, the present invention provides a vaccine comprising the bacterium of the present invention or the combination product of the present invention.
The bacterium, combination product or vaccine may be used as a medicament. In particular, they may be used in a method of treating a disease or disorder caused by a member of the coronavirus family.
The present invention also provides a kit comprising a live-attenuated bacterium of the genus Salmonella, and a recombinant plasmid encoding a fusion protein, wherein the fusion protein comprises a coronavirus antigen and an adjuvant peptide.
Any term not defined in the present application should be given the normal meaning in the art.
As used herein, the term “adjuvant” refers to a substance used in combination with a specific antigen that produces a more robust immune response than the antigen alone.
The term “combination product” can refer to (i) a product comprised of two or more regulated components that are physically, chemically, or otherwise combined or mixed and produced as a single entity; (ii) two or more separate products packaged together in a single package or as a unit and comprised of drug and device products, device and biological products, or biological and drug products; (iii) a drug, device, or biological product packaged separately that according to its investigational plan or proposed labeling is intended for use only with an approved individually specified drug, device, or biological product where both are required to achieve the intended use, indication, or effect and where upon approval of the proposed product the labeling of the approved product would need to be changed, e.g., to reflect a change in intended use, dosage form, strength, route of administration, or significant change in dose; or (iv) any investigational drug, device, or biological product packaged separately that according to its proposed labeling is for use only with another individually specified investigational drug, device, or biological product where both are required to achieve the intended use, indication, or effect. This definition is in accordance with 21 CFR 3.2(e) (see US Code of Federal Regulations).
As used herein, the term “coronavirus antigen” refers to a peptide encoded by the genome of a member of the coronavirus family that can elicit an adaptive immune system response in a subject. An exemplary member of the coronavirus family is SARS-CoV-2.
As used herein, the term “effective amount” is that amount sufficient to effect beneficial or desired results, for example, clinical results, and, as such, an “effective amount” depends upon the context in which it is being applied. The term “effective amount” can be used interchangeably with “effective dose”, “therapeutically effective amount”, or “therapeutically effective dose”.
The terms “identical” or “percent identity”, in the context of two or more polypeptide or nucleic acid molecule sequences, means two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same over a specified region (e.g., 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identity), when compared and aligned for maximum correspondence over a comparison window, or designated region, as measured using methods known in the art, such as a sequence comparison algorithm, by manual alignment, or by visual inspection. For example, preferred algorithms suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., 1977. Nucleic Acids Res. 25:3389 and Altschul et al., 1990. J Mol Biol. 215:403, respectively.
The terms “individual”, “patient” or “subject” are used interchangeably in the present application and refer to any multicellular eukaryotic heterotroph which can be infected by a coronavirus. The subject is preferably a mammal. Mammals which would be infected by a coronavirus include humans, cats, dogs, pigs, ferrets, rabbits, gerbils, hamsters, guinea pigs, horses, rats, mice, cows, sheep, goats, alpacas, camels, donkeys, llamas, yaks, giraffes, elephants, meerkats, lemurs, lions, tigers, kangaroos, koalas, bats, monkeys, chimpanzees, gorillas, bears, dugongs, manatees, seals and rhinoceroses. Most preferably, the subject is human.
As used herein, the expression “live-attenuated bacterium” refers to a prokaryote that has been rendered less virulent through modification and/or selection so that it can no longer cause a systemic infection in an immunocompetent subject.
As used herein, “pharmaceutically acceptable carrier” or “pharmaceutically acceptable diluent” means any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed and, without limiting the scope of the present invention, include: additional buffering agents; preservatives; co-solvents; antioxidants, including ascorbic acid and methionine; chelating agents such as EDTA; metal complexes (e.g., Zn-protein complexes); biodegradable polymers, such as polyesters; salt-forming counterions, such as sodium, polyhydric sugar alcohols; amino acids, such as alanine, glycine, glutamine, asparagine, histidine, arginine, lysine, ornithine, leucine, 2-phenylalanine, glutamic acid, and threonine; organic sugars or sugar alcohols, such as lactitol, stachyose, mannose, sorbose, xylose, ribose, ribitol, myoinisitose, myoinisitol, galactose, galactitol, glycerol, cyclitols (e.g., inositol), polyethylene glycol; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, [alpha]-monothioglycerol, and sodium thio sulfate; low molecular weight proteins, such as human serum albumin, bovine serum albumin, gelatin, or other immunoglobulins; and hydrophilic polymers, such as polyvinylpyrrolidone. Other pharmaceutically acceptable carriers, excipients, or stabilizers, such as those described in Remington: The Science and Practice of Pharmacy 22nd edition, Pharmaceutical press (2012), ISBN-13: 9780857110626 may also be included.
As used herein, the term “plasmid” refers to a genetic structure in a cell that can replicate independently of the cell's chromosome or it can also refer to a genetic structure that can be integrated into the chromosome of the cell (e.g., using a FLP/FRT recombination system or a Cre-Lox recombination system). A plasmid used in accordance with the invention is preferably a plasmid which can replicate independently of the chromosome of the bacterium and does not require antibiotic selection to ensure its maintenance in the bacterium. This has the advantage that no antibiotic resistance genes are administered when administering the vaccine of the invention, resulting in improved safety of the vaccine.
The term “protein” is used interchangeably with the term “peptide” in the present application. Both terms, as used in the present application, refer to molecules comprising one or more chains of amino acid residues. A “fusion protein”, as used in the present application, refers to a protein created through the joining of two or more genes that originally coded for separate proteins via recombinant DNA techniques.
As used herein, the term “recombinant” refers to any material that is derived from or contains a nucleic acid molecule that was made through the combination or insertion of one or more nucleic acid molecules that would not normally occur together.
The terms “treatment” and “therapy”, as used in the present application, refer to a set of hygienic, pharmacological, surgical and/or physical means used with the intent to cure and/or alleviate a disease and/or symptom with the goal of remediating the health problem. The terms “treatment” and “therapy” include preventive and curative methods, since both are directed to the maintenance and/or reestablishment of the health of an individual or animal. Regardless of the origin of the symptoms, disease and disability, the administration of a suitable medicament to alleviate and/or cure a health problem should be interpreted as a form of treatment or therapy within the context of this application.
The present invention provides a live-attenuated bacterium of the genus Salmonella comprising a recombinant plasmid encoding a fusion protein, wherein the fusion protein comprises a coronavirus antigen, and an adjuvant peptide.
Methods for generating live-attenuated bacteria of the genus Salmonella are known in the art (Tennant & Levine, 2015. Vaccine. 33(0 3):C36-41, doi: 10.1016/j.vaccine.2015.04.029).
In some embodiments, the bacterium is of the species Salmonella enterica. In some embodiments, the bacterium is a Salmonella enterica serovar Typhi strain, Salmonella enterica serovar Paratyphi A strain, Salmonella enterica serovar Paratyphi B strain, Salmonella enterica serovar Typhimurium strain, Salmonella enterica serovar Enteritidis strain or Salmonella enterica serovar Choleraesuis strain. In some embodiments, the bacterium is a Salmonella enterica serovar Typhi strain.
In some embodiments, the bacterium has one of the genotypes disclosed in Table 1 of Tennant & Levine, 2015. Vaccine. 33(0 3):C36-41 which is incorporated herein in its entirety by reference. In some embodiments, the bacterium is galE negative and Vi-capsule negative (see Germanier & Füer, 1975. J Infect Dis. 131(5):553-8).
In some embodiments, the bacterium is the Salmonella enterica serovar Typhi Ty21a strain (Germanier & Füer, 1975. J Infect Dis. 131(5):553-8). The genotype of the Ty21a strain is provided in Table 1 of Dharmasena et al., 2016. PLoS One. 11(9): e0163511. Ty21a is available for purchase from the American Type Culture Collection (ATCC 33459).
In some embodiments, the plasmid encodes one fusion protein comprising a coronavirus antigen and an adjuvant peptide. In some embodiments, the adjuvant promotes a Th1 or Th2-mediate response.
In some embodiments, the adjuvant is a mucosal adjuvant (see Aoshi, 2017. Viral Immunol. 30(6): 463-470). Exemplary mucosal adjuvants include interleukin-2 (IL-2) and cholera toxin B subunit.
In some embodiments, the adjuvant is SEQ ID NO: 1 or a peptide that has at least 95% sequence identity with SEQ ID NO: 1. In some embodiments, the adjuvant is SEQ ID NO: 1 or a peptide that has at least 98% sequence identity with SEQ ID NO: 1. In some embodiments, the adjuvant is SEQ ID NO: 1 or a peptide that has at least 99% sequence identity with SEQ ID NO: 1.
In some embodiments, the adjuvant is SEQ ID NO: 2 or a peptide that has at least 95% sequence identity with SEQ ID NO: 2. In some embodiments, the adjuvant is SEQ ID NO: 2 or a peptide that has at least 98% sequence identity with SEQ ID NO: 2. In some embodiments, the adjuvant is SEQ ID NO: 2 or a peptide that has at least 99% sequence identity with SEQ ID NO: 2.
In some embodiments, the adjuvant is a toll-like receptor agonist. Exemplary toll-like receptor agonists include Neisseria PorB and 50 s ribosomal protein L7/L12.
Neisseria PorB (SEQ ID NO: 3; UniProtKB - X5EGH0)
In some embodiments, the adjuvant is SEQ ID NO: 3 or a peptide that has at least 95% sequence identity with SEQ ID NO: 3. In some embodiments, the adjuvant is SEQ ID NO: 3 or a peptide that has at least 98% sequence identity with SEQ ID NO: 3. In some embodiments, the adjuvant is SEQ ID NO: 3 or a peptide that has at least 99% sequence identity with SEQ ID NO: 3.
In some embodiments, the adjuvant is SEQ ID NO: 4 or a peptide that has at least 95% sequence identity with SEQ ID NO: 4. In some embodiments, the adjuvant is SEQ ID NO: 4 or a peptide that has at least 98% sequence identity with SEQ ID NO: 4. In some embodiments, the adjuvant is SEQ ID NO: 4 or a peptide that has at least 99% sequence identity with SEQ ID NO: 4.
In some embodiments, the adjuvant is a β-defensin. Exemplary β-defensins include human β-defensin 1, human β-defensin 2, human β-defensin 3 and human β-defensin 4. In some embodiments, the adjuvant is human β-defensin 1.
In some embodiments, the adjuvant is SEQ ID NO: 5 or a peptide that has at least 90% sequence identity with SEQ ID NO: 5. In some embodiments, the adjuvant is SEQ ID NO: 5 or a peptide that has at least 95% sequence identity with SEQ ID NO: 5.
In some embodiments, the adjuvant is SEQ ID NO: 6 or a peptide that has at least 90% sequence identity with SEQ ID NO: 6. In some embodiments, the adjuvant is SEQ ID NO: 6 or a peptide that has at least 95% sequence identity with SEQ ID NO: 6.
In some embodiments, the adjuvant is SEQ ID NO: 7 or a peptide that has at least 90% sequence identity with SEQ ID NO: 7. In some embodiments, the adjuvant is SEQ ID NO: 7 or a peptide that has at least 95% sequence identity with SEQ ID NO: 7.
In some embodiments, the adjuvant is SEQ ID NO: 8 or a peptide that has at least 90% sequence identity with SEQ ID NO: 8. In some embodiments, the adjuvant is SEQ ID NO: 8 or a peptide that has at least 95% sequence identity with SEQ ID NO: 8.
In some embodiments, the fusion protein comprises the following structure:
Av-L-Ag (from N-terminus to C-terminus),
wherein Av is an adjuvant peptide, L is a linker and Ag is a coronavirus antigen.
The linker may be any genetically encodable linker known in the art (see Chen et al., 2013. Adv Drug Deliv Rev. 65(10):1357-1369). In some embodiments, the linker is EAAAK (SEQ ID NO: 9) or DPRVPSS (SEQ ID NO: 10).
In some embodiments, the plasmid encodes a first fusion protein and a second fusion protein, wherein each fusion protein comprises a coronavirus antigen and an adjuvant peptide.
An advantage of the present invention is that it allows for the combination of multiple antigens wherein one fusion protein may, for example, preferentially induce an antibody response whereas the second fusion protein may, for example, preferentially induce a T-cell response. The combination of an antibody response and T-cell response would be particularly advantageous for the treatment of a coronavirus infection.
In some embodiments, the first fusion protein comprises an adjuvant that promotes a Th1-mediated response and the second fusion protein comprises an adjuvant that promotes a Th2-mediated response.
In some embodiments, the first fusion protein comprises a mucosal adjuvant and the second fusion protein comprises an adjuvant that is a toll-like receptor agonist. In some embodiments, the first fusion protein comprises a mucosal adjuvant and the second fusion protein comprises an adjuvant that is a β-defensin.
In some embodiments, the first fusion protein comprises SEQ ID NO: 2 or a peptide that has at least 95, 98 or 99% sequence identity with SEQ ID NO: 2 and the second fusion protein comprises an adjuvant that is a toll-like receptor agonist. In some embodiments, the first fusion protein comprises SEQ ID NO: 2 or a peptide that has at least 95, 98 or 99% sequence identity with SEQ ID NO: 2 and the second fusion protein comprises an adjuvant that is a β-defensin.
In some embodiments, the coronavirus antigen is a SARS-CoV-2 antigen.
In some embodiments, the SARS-CoV-2 antigen is the spike glycoprotein or an antigenic fragment thereof, the membrane glycoprotein or an antigenic fragment thereof, the envelope protein, or the nucleocapsid protein or an antigenic fragment thereof.
In some embodiments, the coronavirus antigen comprises SEQ ID NO: 11 or a sequence that has at least 99% sequence identity with SEQ ID NO: 11. In some embodiments, the coronavirus antigen comprises residues 2-1273 of SEQ ID NO: 11 or a sequence that has at least 99% sequence identity with residues 2-1273 of SEQ ID NO: 11. In some embodiments, the coronavirus antigen comprises residues 13-303 of SEQ ID NO: 11 or a sequence that has at least 99% sequence identity with residues 13-303 of SEQ ID NO: 11. In some embodiments, the coronavirus antigen comprises residues 319-541 of SEQ ID NO: 11 or a sequence that has at least 99% sequence identity with residues 319-541 of SEQ ID NO: 11. In some embodiments, the coronavirus antigen comprises residues 334-527 of SEQ ID NO: 11 or a sequence that has at least 99% sequence identity with residues 334-527 of SEQ ID NO: 11. In some embodiments, the coronavirus antigen comprises residues 437-508 of SEQ ID NO: 11 or a sequence that has at least 98% sequence identity with residues 437-508 of SEQ ID NO: 11. In some embodiments, the coronavirus antigen comprises residues 788-806 of SEQ ID NO: 11 or a sequence that has at least 94% sequence identity with residues 788-806 of SEQ ID NO: 11. In some embodiments, the coronavirus antigen comprises residues 920-970 of SEQ ID NO: 11 or a sequence that has at least 98% sequence identity with residues 920-970 of SEQ ID NO: 11. In some embodiments, the coronavirus antigen comprises residues 1163-1202 of SEQ ID NO: 11 or a sequence that has at least 97% sequence identity with residues 1163-1202 of SEQ ID NO: 11. In some embodiments, the coronavirus antigen comprises residues 1235-1273 of SEQ ID NO: 11 or a sequence that has at least 97% sequence identity with residues 1235-1273 of SEQ ID NO: 11.
In some embodiments, the coronavirus antigen comprises SEQ ID NO: 12 or a sequence that has at least 99% sequence identity with SEQ ID NO: 12. In some embodiments, the coronavirus antigen comprises residues 2-222 of SEQ ID NO: 12 or a sequence that has at least 99% sequence identity with residues 2-222 of SEQ ID NO: 12. In some embodiments, the coronavirus antigen comprises residues 2-100 of SEQ ID NO: 12 or a sequence that has at least 99% sequence identity with residues 2-100 of SEQ ID NO: 12.
In some embodiments, the coronavirus antigen comprises SEQ ID NO: 13 or a sequence that has at least 98% sequence identity with SEQ ID NO: 13.
In some embodiments, the coronavirus antigen comprises SEQ ID NO: 14 or a sequence that has at least 99% sequence identity with SEQ ID NO: 14. In some embodiments, the coronavirus antigen comprises residues 2-419 of SEQ ID NO: 14 or a sequence that has at least 99% sequence identity with residues 2-419 of SEQ ID NO: 14. In some embodiments, the coronavirus antigen comprises residues 41-186 of SEQ ID NO: 14 or a sequence that has at least 99% sequence identity with residues 41-186 of SEQ ID NO: 14. In some embodiments, the coronavirus antigen comprises residues 258-361 of SEQ ID NO: 14 or a sequence that has at least 99% sequence identity with residues 258-361 of SEQ ID NO: 14.
Other SARS-CoV-2 antigens include SEQ ID NOs: 15-18 provided below.
In some embodiments, the coronavirus antigen comprises SEQ ID NO: 15 or a sequence that has at least 99% sequence identity with SEQ ID NO: 15. In some embodiments, the coronavirus antigen comprises SEQ ID NO: 16 or a sequence that has at least 99% sequence identity with SEQ ID NO: 16. In some embodiments, the coronavirus antigen comprises SEQ ID NO: 17 or a sequence that has at least 98% sequence identity with SEQ ID NO: 17. In some embodiments, the coronavirus antigen comprises SEQ ID NO: 18 or a sequence that has at least 99% sequence identity with SEQ ID NO: 18.
In some embodiments, the coronavirus antigen comprises any one of SEQ ID NOs: 11-18 or an antigenic fragment thereof. In some embodiments, the coronavirus antigen is selected from any one of SEQ ID NOs: 11-18 or is an antigenic fragment of any one of SEQ ID NOs: 11-18.
In some embodiments, the fusion protein comprises:
(i) residues 319-541 of SEQ ID NO: 11 or a sequence that has at least 99% sequence identity with residues 319-541 of SEQ ID NO: 11; and
(ii) SEQ ID NO: 2 or a peptide that has at least 95% sequence identity with SEQ ID NO: 2.
In some embodiments, the fusion protein comprises the following structure:
Av-L-Ag (from N-terminus to C-terminus),
wherein Av is SEQ ID NO: 2 or a peptide that has at least 95% sequence identity with SEQ ID NO: 2, L is EAAAK; and
Ag is residues 319-541 of SEQ ID NO: 11 or a sequence that has at least 99% sequence identity with residues 319-541 of SEQ ID NO: 11.
In some embodiments, the fusion protein comprises:
(i) SEQ ID NO: 15 or a sequence that has at least 99% sequence identity with SEQ ID NO: 15; and
(ii) SEQ ID NO: 5 or a peptide that has at least 95% sequence identity with SEQ ID NO: 5.
In some embodiments, the fusion protein comprises the following structure:
Av-L-Ag (from N-terminus to C-terminus),
wherein Av is SEQ ID NO: 5 or a peptide that has at least 95% sequence identity with SEQ ID NO: 5, L is EAAAK; and
Ag is SEQ ID NO: 15 or a sequence that has at least 99% sequence identity with SEQ ID NO: 15.
In some embodiments, the plasmid comprises a nucleic acid encoding a first fusion protein and a nucleic acid encoding a second fusion protein,
wherein the first fusion protein comprises:
(i) residues 319-541 of SEQ ID NO: 11 or a sequence that has at least 99% sequence identity with residues 319-541 of SEQ ID NO: 11; and
(ii) SEQ ID NO: 2 or a peptide that has at least 95% sequence identity with SEQ ID NO: 2; and the second fusion protein comprises:
(i) SEQ ID NO: 15 or a sequence that has at least 99% sequence identity with SEQ ID NO: 15; and
(ii) SEQ ID NO: 5 or a peptide that has at least 95% sequence identity with SEQ ID NO: 5.
In some embodiments, the one or more fusion proteins further comprise a secretion signal peptide. The secretion signal peptide may be a hemolysin A secretion signal peptide, a PhoA signal peptide, an OmpA signal peptide, or a BLA signal peptide.
An example of a hemolysin A (HlyA) secretion signal peptide is SEQ ID NO: 19:
An example of a PhoA signal peptide is SEQ ID NO: 20:
An example of an OmpA signal peptide is SEQ ID NO: 21:
An example of a BLA signal peptide is SEQ ID NO: 22:
In some embodiments, the fusion protein comprises the BLA signal peptide according to SEQ ID NO: 23 and the C-terminal sequence of BLA according to SEQ ID NO: 24 (Xin et al., 2008. Infect Immun. 76(7):3241-3254).
In embodiments wherein the fusion protein comprises the C-terminal signal peptide of HlyA (e.g., SEQ ID NO: 19), it may be advantageous to include the N-terminal sequence of HlyA (e.g., SEQ ID NO: 25).
Thus, in some embodiments the fusion protein comprises the following structure:
HlyAN-L-Av-L-Ag-L-HlyAS (from N-terminus to C-terminus),
wherein HlyAN is the N-terminal sequence of HlyA (e.g., SEQ ID NO: 25),
Av is an adjuvant peptide,
L is a linker,
Ag is a coronavirus antigen, and
HlyAS is the signal peptide of HlyA (e.g., SEQ ID NO: 19).
In embodiments where the fusion protein comprises the HlyA secretion signal peptide, the plasmid may further encode HlyB and HlyD. Alternatively, a further nucleic acid encoding HlyB and HlyD is inserted into the bacterium. The plasmid may also further encode HlyC and/or HlyR or a further nucleic acid encoding HlyC and/or HlyR could be used.
In some embodiments, the bacterium and/or the plasmid does not comprise an antibiotic marker. In some embodiments, the bacterium is a ΔtyrS (i.e., the gene encoding tyrosyl-tRNA-synthetase has been removed or inactivated) strain and the plasmid further encodes tyrS. This provides a balanced lethal system which allows for the maintenance of the plasmid in the bacterium without the need of an antibiotic resistance cassette.
In some embodiments, the plasmid is integrated into the chromosome of the bacterium or replicates independently of the chromosome of the bacterium. Preferably, the plasmid replicates independently of the chromosome of the bacterium.
Thus, in some embodiments, the first fusion protein comprises a HlyA secretion signal peptide and the second fusion protein comprises a HlyA secretion signal peptide, a PhoA signal peptide, an OmpA signal peptide, or a BLA signal peptide.
In some embodiments, the fusion protein further comprises a purification tag. Different purification tags and purification systems are known to the skilled person. The purification tag may be any one of those disclosed in Table 9.9.1 of Kimple et al., 2013. Curr Protoc Protein Sci. 73(1): 9.9.1-9.9.23 which is incorporated by reference in its entirety. In some embodiments, the purification tag is a polyhistidine tag, FLAG-tag or HA-tag. The HA-tag may consist of YPYDVPDYA (SEQ ID NO: 26).
In some embodiments, the purification tag may be attached to the fusion protein via a cleavable linker. Cleavable linkers are known in the art (see Chen et al., 2013. Adv Drug Deliv Rev. 65(10):1357-1369). In some embodiments, the cleavable linker consists of DDDDK (SEQ ID NO: 27) or LVPRGS (SEQ ID NO: 28).
In a preferred embodiment of the invention, the fusion protein selected from any one of the constructs of Table 4 or Table 5.
In another preferred embodiment of the invention, the fusion protein selected from any one of the constructs of Table 13 or Table 15.
In another preferred embodiment of the invention, the fusion protein is a protein consisting of an amino acid sequence of any one of SEQ ID NO: 30, 92, 94, 96, 98, 100, 102, 106, 108, 110, 112, 114, 116, 118, 146, 148, 150, 152, 154, 156, 162, 164, or 166, or a protein consisting of an amino acid sequence at least 99% identical to the amino acid sequence of any one of SEQ ID NO: 30, 92, 94, 96, 98, 100, 102, 106, 108, 110, 112, 114, 116, 118, 146, 148, 150, 152, 154, 156, 162, 164, or 166.
In another preferred embodiment of the invention, the fusion protein is encoded by any one of the coding sequences (CDS) of Tables 13 or 15.
In a very preferred embodiment of the invention, the first fusion protein is selected from any one of the constructs of Table 4, and the second fusion protein is selected from any one of the constructs of Table 5.
In a very preferred embodiment of the invention, the first fusion protein is selected from any one of the constructs of Table 13, and the second fusion protein is selected from any one of the constructs of Table 15.
In some embodiments, the plasmid comprises a nucleic acid encoding the following components:
Tg-L-Av-L-Ag; or
Av-L-Ag-L-Tg,
wherein Av is an adjuvant peptide, L is a linker, Ag is a coronavirus antigen and Tg is a purification tag.
In some embodiments, the plasmid comprises the following components:
HlyAN-X-L1-Av-L2-Ag-L3-X-HlyAS;
HlyAN-X-L1-Av-L2-Ag-L4-Tg-L3-X-HlyAS; or
HlyAN-X-Tg-L1-Av-L2-Ag-L3-X-HlyAS,
wherein HlyAN encodes the N-terminal sequence of HlyA (e.g., SEQ ID NO: 25),
X is a restriction recognition site,
Tg encodes a purification tag,
L1 encodes SEQ ID NO: 9 or SEQ ID NO: 10,
Av encodes an adjuvant peptide (preferably a mucosal adjuvant),
L2 encodes SEQ ID NO: 9 or SEQ ID NO: 10,
Ag encodes a coronavirus antigen,
L3 encodes SEQ ID NO: 9,
L4 encodes AAY, GPGPG (SEQ ID NO: 29), or KK, and
HlyAS encodes the signal peptide of HlyA (e.g., SEQ ID NO: 19). In some embodiments, the restriction recognition site is the NsiI recognition site (i.e., ATGCAT).
In some embodiments, the plasmid comprises a sequence that encodes SEQ ID NO: 30 or a sequence that has at least 95% identity with SEQ ID NO: 30. In some embodiments, the plasmid comprises a sequence that encodes SEQ ID NO: 30 or a sequence that has at least 98% identity with SEQ ID NO: 30. In some embodiments, the plasmid comprises a sequence that encodes SEQ ID NO: 30 or a sequence that has at least 99% identity with SEQ ID NO: 30.
In some embodiments, the fusion proteins have been codon optimized for optimal expression in the bacterium.
In some embodiments, the plasmid comprises SEQ ID NO: 31 or a sequence that has 75, 80, 85, 90, 95, 98 or 99% identity with SEQ ID NO: 31.
In some embodiments, the plasmid comprises SEQ ID NO: 32 or a sequence that has 75, 80, 85, 90, 95, 98 or 99% sequence identity with SEQ ID NO: 32.
In some embodiments, the plasmid comprises the following components:
X-Pr-Av-L1-Ag-Tr-X;
X-Pr-Sp-Av-L1-Ag-Tr-X;
X-Pr-Av-L1-Ag-L2-Tg-Tr-X;
X-Pr-Sp-Av-L1-Ag-Tg-Tr-X; or
X-Pr-Sp-Av-L1-Ag-L2-Tg-Tr-X, wherein
X is a restriction recognition site,
Pr is a Promoter region,
Tr is a Terminator region,
Sp encodes a secretion signal peptide,
Tg encodes a purification tag,
Av encodes an adjuvant peptide (preferably a toll-like receptor agonist or β-defensin),
L1 encodes SEQ ID NO: 9, and
L2 encodes SEQ ID NO: 9, AAY, SEQ ID NO: 29 or KK, and
Ag encodes a coronavirus antigen. In some embodiments, L2 is optional. In some embodiments, the restriction recognition site is the SalI recognition site (i.e., GTCGAC). In some embodiments, Sp encodes a PhoA signal peptide, an OmpA signal peptide or a BLA signal peptide.
Exemplary promoter regions include:
Exemplary terminator regions include
In some embodiments, the plasmid comprises a sequence that encodes SEQ ID NO: 41 or a sequence that has at least 95% identity with SEQ ID NO: 41. In some embodiments, the plasmid comprises a sequence that encodes SEQ ID NO: 41 or a sequence that has at least 98% identity with SEQ ID NO: 41. In some embodiments, the plasmid comprises a sequence that encodes SEQ ID NO: 41 or a sequence that has at least 99% identity with SEQ ID NO: 41.
In some embodiments, the plasmid comprises:
(i) a sequence that encodes SEQ ID NO: 41 or a sequence that has at least 95% identity with SEQ ID NO: 41; and
(ii) a sequence that encodes SEQ ID NO: 30 or a sequence that has at least 95% identity with SEQ ID NO: 30.
In some embodiments, the plasmid comprises:
(i) a sequence that encodes SEQ ID NO: 41 or a sequence that has at least 98% identity with SEQ ID NO: 41; and
(ii) a sequence that encodes SEQ ID NO: 30 or a sequence that has at least 98% identity with SEQ ID NO: 30.
In some embodiments, the plasmid comprises:
(i) a sequence that encodes SEQ ID NO: 41 or a sequence that has at least 99% identity with SEQ ID NO: 41; and
(ii) a sequence that encodes SEQ ID NO: 30 or a sequence that has at least 99% identity with SEQ ID NO: 30.
In some embodiments, the plasmid comprises:
(i) a sequence that encodes SEQ ID NO: 41; and
(ii) a sequence that encodes SEQ ID NO: 30.
In a preferred embodiment of the invention, the coronavirus antigen is selected from any one of the viral antigen units of Table 4 or Table 5.
In another preferred embodiment of the invention, the coronavirus antigen is selected from any one of the viral antigen units of Table 14 or Table 16.
In another preferred embodiment of the invention, the coronavirus antigen consists of an amino acid sequence of any one of SEQ ID NOs: 11-18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 168, or 170, or consists of an amino acid sequence at least 99% identical to the amino acid sequence of any one of SEQ ID NOs: 11-18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 168, or 170.
In another preferred embodiment of the invention, the coronavirus antigen is encoded by any one of the coding sequences (CDS) of Table 14 or Table 16 or by the coding sequences (CDS) of any one of SEQ ID Nos 178-183.
The inclusion of a purification tag allows one to express and purify the one or more fusion proteins encoded by the plasmid comprised in the bacterium. After cleavage of the purification tags and removal of LPS, the fusion protein can be used in prime-boost vaccines (e.g. oral, nasal) or can be added to the live vaccine as an adjuvant-antigen-fusion protein to increase amount of the antigenic fusion protein and/or to deliver an additional set of adjuvant-antigen-combinations.
Thus, in another aspect the present invention provides a combination product comprising (i) the live-attenuated bacterium of the present invention and (ii) the one or more fusion proteins encoded by the recombinant plasmid found within the bacterium of the present invention.
In another aspect, the present invention provides a vaccine comprising the bacterium of the present invention or the combination product of the present invention. In some embodiments, the vaccine further comprises a pharmaceutically acceptable carrier or diluent.
The vaccine may also be referred to as a “pharmaceutical composition”.
A pharmaceutical composition as described herein may also contain other substances. These substances include, but are not limited to, cryoprotectants, lyoprotectants, surfactants, bulking agents, anti-oxidants, and stabilizing agents. In some embodiments, the pharmaceutical composition may be lyophilized.
The term “cryoprotectant” as used herein, includes agents which provide stability to the active ingredient against freezing-induced stresses, by being preferentially excluded from the active ingredient's surface. Cryoprotectants may also offer protection during primary and secondary drying and long-term product storage. Non-limiting examples of cryoprotectants include sugars, such as sucrose, glucose, trehalose, mannitol, mannose, and lactose; polymers, such as dextran, hydroxyethyl starch and polyethylene glycol; surfactants, such as polysorbates (e.g., PS-20 or PS-80); and amino acids, such as glycine, arginine, leucine, and serine. A cryoprotectant exhibiting low toxicity in biological systems is generally used.
In one embodiment, a lyoprotectant is added to a pharmaceutical composition described herein. The term “lyoprotectant” as used herein, includes agents that provide stability to the active ingredient during the freeze-drying or dehydration process (primary and secondary freeze-drying cycles), by providing an amorphous glassy matrix and by binding with the a's surface through hydrogen bonding, replacing the water molecules that are removed during the drying process. This helps to minimize product degradation during the lyophilization cycle and improve the long-term product stability. Non-limiting examples of lyoprotectants include sugars, such as sucrose or trehalose; an amino acid, such as monosodium glutamate, non-crystalline glycine or histidine; a metHlyAmine, such as betaine; a lyotropic salt, such as magnesium sulfate; a polyol, such as trihydric or higher sugar alcohols, e.g., glycerin, erythritol, glycerol, arabitol, xylitol, sorbitol, and mannitol; propylene glycol; polyethylene glycol; pluronics; and combinations thereof. The amount of lyoprotectant added to a pharmaceutical composition is generally an amount that does not lead to an unacceptable amount of degradation of the strain when the pharmaceutical composition is lyophilized.
In some embodiments, a bulking agent is included in the pharmaceutical composition. The term “bulking agent” as used herein, includes agents that provide the structure of the freeze-dried product without interacting directly with the pharmaceutical product. In addition to providing a pharmaceutically elegant cake, bulking agents may also impart useful qualities in regard to modifying the collapse temperature, providing freeze-thaw protection, and enhancing the strain stability over long-term storage. Non-limiting examples of bulking agents include mannitol, glycine, lactose, and sucrose. Bulking agents may be crystalline (such as glycine, mannitol, or sodium chloride) or amorphous (such as dextran, hydroxyethyl starch) and are generally used in formulations in an amount from 0.5% to 10%.
Other pharmaceutically acceptable carriers, excipients, or stabilizers, such as those described in Remington: The Science and Practice of Pharmacy 22nd edition, Pharmaceutical press (2012), ISBN-13: 9780857110626 may also be included in a pharmaceutical composition described herein, provided that they do not adversely affect the desired characteristics of the pharmaceutical composition. As used herein, “pharmaceutically acceptable carrier” means any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed and include: additional buffering agents; preservatives; co-solvents; antioxidants, including ascorbic acid and methionine; chelating agents such as EDTA; metal complexes (e.g., Zn-protein complexes); biodegradable polymers, such as polyesters; salt-forming counterions, such as sodium, polyhydric sugar alcohols; amino acids, such as alanine, glycine, glutamine, asparagine, histidine, arginine, lysine, ornithine, leucine, 2-phenylalanine, glutamic acid, and threonine; organic sugars or sugar alcohols, such as lactitol, stachyose, mannose, sorbose, xylose, ribose, ribitol, myoinisitose, myoinisitol, galactose, galactitol, glycerol, cyclitols (e.g., inositol), polyethylene glycol; sulfur containing reducing agents, such as urea, glutathione, thioctic acid, sodium thioglycolate, thioglycerol, [alpha]-monothioglycerol, and sodium thio sulfate; low molecular weight proteins, such as human serum albumin, bovine serum albumin, gelatin, or other immunoglobulins; and hydrophilic polymers, such as polyvinylpyrrolidone.
In some embodiments, the pharmaceutical composition may be suitable for oral, buccal, nasal, intravenous, intramuscular, conjunctival, transdermal, intraperitoneal and/or subcutaneous administration, preferably oral, nasal, intravenous and/or intramuscular administration.
The pharmaceutical composition may further comprise common excipients and carriers which are known in the state of the art. For solution for injection, the pharmaceutical composition may further comprise cryoprotectants, lyoprotectants, surfactants, bulking agents, anti-oxidants, stabilizing agents and pharmaceutically acceptable carriers.
In another aspect, the present invention provides the bacterium of the present invention, the combination product of the present invention or the vaccine of the present invention for use as a medicament.
In another aspect, the present invention provides the bacterium of the present invention, the combination product of the present invention or the vaccine of the present invention for use in a method of treating a disease or disorder caused by a member of the coronavirus family. In some embodiments, the method comprises administering a therapeutically effective amount of the bacterium, combination product or vaccine to a subject.
In some embodiments, the disease or disorder is COVID-19. In some embodiments, the coronavirus is SARS-CoV-2.
In some embodiments, the bacterium, combination product or vaccine is administered orally, buccally, intranasally, intravenously, intramuscularly, transdermally, intraperitoneally or subcutaneously. In some embodiments, administration is performed orally, intranasally, intravenously or intramuscularly.
In another aspect, the present invention provides a kit comprising a live-attenuated bacterium of the genus Salmonella and a recombinant plasmid encoding a fusion protein, wherein the fusion protein comprises a coronavirus antigen and an adjuvant peptide.
The bacterium, plasmid and fusion protein may be in accordance with any aspect and/or embodiment disclosed throughout this application.
For the avoidance of any doubt, any instance wherein the term “comprising” is used throughout the entirety of the present application may optionally be replaced by the expression “consisting of”.
The present invention also provides the following items which may be combined with any aspect or embodiment described throughout the entirety of the present application.
[1] A live-attenuated bacterium of the genus Salmonella comprising a recombinant plasmid encoding a fusion protein, wherein the fusion protein comprises:
(i) a coronavirus antigen; and
(ii) an adjuvant peptide.
[2] The bacterium of [1], wherein the bacterium is of the species Salmonella enterica.
[3] The bacterium of [1] or [2], wherein the bacterium is a Salmonella enterica serovar Typhi strain.
[4] The bacterium of [3], wherein the bacterium is the Ty21a strain.
[5] The bacterium of any one of [1]-[4], wherein the adjuvant is a (i) mucosal adjuvant, or (ii) a toll-like receptor agonist or β-defensin.
[6] The bacterium of any one of [1]-[5], wherein the plasmid encodes a first fusion protein and a second fusion protein, wherein each fusion protein comprises:
(i) a coronavirus antigen; and
(ii) an adjuvant peptide.
[7] The bacterium of [6], wherein the first fusion protein comprises:
(i) a coronavirus antigen; and
(ii) a mucosal adjuvant peptide.
[8] The bacterium of [7], wherein the second fusion protein comprises:
(i) a coronavirus antigen; and
(ii) a toll-like receptor agonist or β-defensin.
[9] The bacterium of [5] or [7], wherein the mucosal adjuvant is an interleukin-2 or a cholera toxin B subunit, wherein, optionally, the mucosal adjuvant is a cholera toxin B subunit.
[10] The bacterium of [5] or [8], wherein the toll-like receptor agonist is a Neisseria PorB or 50 s ribosomal protein L7/L12.
[11] The bacterium of [5], [8] or [10], wherein the β-defensin is human β-defensin 1, human β-defensin 2, human β-defensin 3 or human β-defensin 4, wherein, optionally the β-defensin is human β-defensin 1.
[12] The bacterium of any one of [1]-[11], wherein the coronavirus antigen is a SARS-CoV-2 antigen.
[13] The bacterium of any one of [1]-[12], wherein the coronavirus antigen is selected from any one of SEQ ID NOs: 11-18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 168, or 170 or is an antigenic fragment of any one of SEQ ID NOs: 11-18, 120, 122, 124, 126, 128, 130, 132, 134, 136, 138, 140, 142, 144, 168, or 170.
[14] The bacterium of any one of [1]-[13], wherein the coronavirus antigen is SEQ ID NO: 11 or an antigenic fragment thereof.
[15] The bacterium of any one of [1]-[13], wherein the coronavirus antigen is SEQ ID NO: 12 or an antigenic fragment thereof.
[16] The bacterium of any one of [1]-[13], wherein the coronavirus antigen is SEQ ID NO: 13 or an antigenic fragment thereof.
[17] The bacterium of any one of [1]-[13], wherein the coronavirus antigen is SEQ ID NO: 14 or an antigenic fragment thereof.
[18] The bacterium of any one of [1]-[13], wherein the coronavirus antigen is SEQ ID NO: 15 or an antigenic fragment thereof.
[19] The bacterium of any one of [1]-[13], wherein the coronavirus antigen is SEQ ID NO: 16 or an antigenic fragment thereof.
[20] The bacterium of any one of [1]-[13], wherein the coronavirus antigen is SEQ ID NO: 17 or an antigenic fragment thereof.
[21] The bacterium of any one of [1]-[13], wherein the coronavirus antigen is SEQ ID NO: 18 or an antigenic fragment thereof.
[22] The bacterium of any one of [1]-[21], wherein the one or more fusion proteins further comprise a secretion signal peptide.
[23] The bacterium of [22], wherein the secretion signal peptide is the hemolysin A secretion signal peptide, and the plasmid further encodes HlyB and HlyD.
[24] The bacterium of [23], wherein the plasmid further encodes HlyC and/or HlyR.
[25] The bacterium of any one of [1]-[24], wherein the bacterium and/or the plasmid does not comprise an antibiotic marker.
[26] The bacterium of any one of [1]-[25], wherein the bacterium is a ΔtyrS strain and the plasmid further encodes tyrS.
[27] The bacterium of any one of [1]-[26], wherein the plasmid is integrated into the chromosome of the bacterium or replicates independently of the chromosome of the bacterium.
[28] A combination product comprising:
(a) the bacterium of any one of [1]-[27]; and
(b) at least one of the one or more fusion proteins encoded by the plasmid of said bacterium.
[29] A vaccine comprising the bacterium of any one of [1]-[27] or the combination product of [28].
[30] The bacterium of any one of [1]-[27], the combination product of [28] or the vaccine of [29] for use as a medicament.
[31] The bacterium of any one of [1]-[27], the combination product of [28] or the vaccine of [29] for use in a method of treating a disease or disorder caused by a member of the coronavirus family.
[32] The bacterium, combination product or vaccine for use of [31], wherein the disease or disorder is COVID-19.
[33] A kit comprising:
(a) a live-attenuated bacterium of the genus Salmonella; and
(b) a recombinant plasmid encoding a fusion protein, wherein the fusion protein comprises:
[34] The kit of [33], wherein the live-attenuated bacterium and the recombinant plasmid are according to any one of [1]-[126].
Exemplary materials which can be used in accordance with the invention are shown in the following tables. These materials may be combined with any aspect or embodiment described throughout the entirety of the present application.
E. coli DH5α
E. coli CC118 (λpir)
S. enterica serovar Typhi Ty21a
S. enterica serovar Typhimurium
S. enterica serovar Typhi Ty21a ΔtyrS
TGA TGG TGA TGG TGA TGT TTC
CAT CAC CAT CAC CAT CAC GCA
GTG TAC CGG CAA AGG TGC AGT
CGT TTT ATA CAT GGA GAT TTT
GAT GGC A
GT GTA GGC TGG AGC
TGC TTC
GAT AGT GAC AGC GTT GGA GGC
GAT AGT CTT ACG CGC CTG ACC
ACG TGA CGG ATG GG A ATT AGC
CAT GGT CC
CAA AGG TGA GTC G
GGT GAT GGT GAT GTT TCC AGC
S. enterica serovar Typhi
S. enterica serovar Typhi
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCAAAATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCTGTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCACCCCGTGCAACGGCGTTGAAGGCTTCAACTGCTACTTCCCGCTGCAGTCCTA
CGGCTTCCAGCCGACCAACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGTCC
TTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACCTG
GTTAAAAACAAATGCGTTAACTTCGACTACAAAGACGACGACGACAAAGAAGCGGC
GGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGATCTTAATCCATTAATTAATGAA
DKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVE
KLCVWNNKTPHAIAAISMANEAAAKRVQPTESIVRFPNITNLCPFGEVFNATRFASVYA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEI
YQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKS
TNLVKNKCVNFDYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTAA
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAAAACCTGTGTCCGTT
TGGCGAAGTGTTCAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACG
TATCTCCAACTGCGTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCT
TCAAATGCTACGGCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTA
CGCGGACTCCTTCGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGAC
CGGCAAAATCGCGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTAT
CGCGTGGAACTCCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCTGTA
CCGTCTGTTCCGTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATC
TACCAGGCGGGCTCCACCCCGTGCAACGGCGTTGAAGGCTTCAACTGCTACTTCCCG
CTGCAGTCCTACGGCTTCCAGCCGACCAACGGCGTTGGCTACCAGCCGTACCGTGTT
GTTGTTCTGTCCTTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGGACTACA
AAGACGACGACGACAAAGAAGCGGCGGCGAAACATGCATTAGCCTATGGAAGTCAG
DKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVE
KLCVWNNKTPHAIAAISMANEAAAKNLCPFGEVFNATRFASVYAWNRKRISNCVADYS
VLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLP
DDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEG
FNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPDYKDDDDKEAAAKHAL
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCAAAATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCTGTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCACCCCGTGCAACGGCGTTGAAGGCTTCAACTGCTACTTCCCGCTGCAGTCCTA
CGGCTTCCAGCCGACCTACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGTCC
TTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACCTG
GTTAAAAACAAATGCGTTAACTTCGACTACAAAGACGACGACGACAAAGAAGCGGC
GGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGATCTTAATCCATTAATTAATGAA
DKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVE
KLCVWNNKTPHAIAAISMANEAAAKRVQPTESIVRFPNITNLCPFGEVFNATRFASVYA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEI
YQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKST
NLVKNKCVNFDYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTAAS
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCAAAATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCTGTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCACCCCGTGCAACGGCGTTAAAGGCTTCAACTGCTACTTCCCGCTGCAGTCCTA
CGGCTTCCAGCCGACCTACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGTCC
TTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACCTG
GTTAAAAACAAATGCGTTAACTTCGACTACAAAGACGACGACGACAAAGAAGCGGC
GGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGATCTTAATCCATTAATTAATGAA
DKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVE
KLCVWNNKTPHAIAAISMANEAAAKRVQPTESIVRFPNITNLCPFGEVFNATRFASVYA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEI
YQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKST
NLVKNKCVNFDYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTAAS
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCAACATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCTGTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCACCCCGTGCAACGGCGTTAAAGGCTTCAACTGCTACTTCCCGCTGCAGTCCTA
CGGCTTCCAGCCGACCTACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGTCC
TTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACCTG
GTTAAAAACAAATGCGTTAACTTCGACTACAAAGACGACGACGACAAAGAAGCGGC
GGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGATCTTAATCCATTAATTAATGAA
DKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVE
KLCVWNNKTPHAIAAISMANEAAAKRVQPTESIVRFPNITNLCPFGEVFNATRFASVYA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTE
IYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKS
TNLVKNKCVNFDYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTAA
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCAACATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCTGTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCACCCCGTGCAACGGCGTTAAAGGCTTCAACTGCTACTTCCCGCTGCAGTCCTA
CGGCTTCCAGCCGACCTACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGTCC
TTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACCTG
GTTAAAAACAAATGCGTTAACTTCCGTGTTCAGCCGACCGAATCCATAGTTAGGTTC
CCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTTCAACGCGACCCGTTTTGCGT
CCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGCGTTGCGGACTACTCCGTTCT
GTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACGGCGTTTCCCCGACCAAACTG
AACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTTCGTTATCCGTGGCGACGAA
GTTCGTCAGATCGCGCCGGGCCAGACCGGCAAAATCGCGGACTACAACTACAAACT
GCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACTCCAACAACCTGGACTCCAA
AGTTGGCGGCAACTACAACTACCTGTACCGTCTGTTCCGTAAATCCAACCTGAAACC
GTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGGGCTCCACCCCGTGCAACGG
CGTTGAAGGCTTCAACTGCTACTTCCCGCTGCAGTCCTACGGCTTCCAGCCGACCTAC
GGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGTCCTTCGAACTGCTGCACGCGC
CGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACCTGGTTAAAAACAAATGCGTT
AACTTCGACTACAAAGACGACGACGACAAAGAAGCGGCGGCGAAACATGCATTAGC
DKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVE
KLCVWNNKTPHAIAAISMANEAAAKRVQPTESIVRFPNITNLCPFGEVFNATRFASVYA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTE
IYQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKS
TNLVKNKCVNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYS
VLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLP
DDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEG
FNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFDYK
DDDDKEAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTAASLLQLSGNASDFSYG
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCACCATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCTGTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCACCCCGTGCAACGGCGTTAAAGGCTTCAACTGCTACTTCCCGCTGCAGTCCTA
CGGCTTCCAGCCGACCTACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGTCC
TTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACCTG
GTTAAAAACAAATGCGTTAACTTCGACTACAAAGACGACGACGACAAAGAAGCGGC
GGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGATCTTAATCCATTAATTAATGAA
DKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVE
KLCVWNNKTPHAIAAISMANEAAAKRVQPTESIVRFPNITNLCPFGEVFNATRFASVYA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGTIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEI
YQAGSTPCNGVKGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKST
NLVKNKCVNFDYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTAAS
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAAGACTACAAAGACG
ACGACGACAAAGAAGCGGCGGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGAT
DKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVE
KLCVWNNKTPHAIAAISMANEAAAKDYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIIS
GCGAAACGTGTTCAGCCGACCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTG
TGTCCGTTTGGCGAAGTGTTCAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACC
GTAAACGTATCTCCAACTGCGTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTT
CTCCACCTTCAAATGCTACGGCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACC
AACGTTTACGCGGACTCCTTCGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCG
GGCCAGACCGGCAAAATCGCGGACTACAACTACAAACTGCCGGACGACTTCACCGG
CTGCGTTATCGCGTGGAACTCCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAA
CTACCTGTACCGTCTGTTCCGTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCC
ACCGAAATCTACCAGGCGGGCTCCACCCCGTGCAACGGCGTTGAAGGCTTCAACTGC
TACTTCCCGCTGCAGTCCTACGGCTTCCAGCCGACCAACGGCGTTGGCTACCAGCCGT
ACCGTGTTGTTGTTCTGTCCTTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCC
GAAAAAATCCACCAACCTGGTTAAAAACAAATGCGTTAACTTCGACTACAAAGACGA
CGACGACAAAGAAGCGGCGGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGATC
EVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYAD
SFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFR
KSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFEL
LHAPATVCGPKKSTNLVKNKCVNFDYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIISA
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCAAAATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCGTTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCACCCCGTGCAACGGCGTTCAGGGCTTCAACTGCTACTTCCCGCTGCAGTCCTA
CGGCTTCCAGCCGACCAACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGTCC
TTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACCTG
GTTAAAAACAAATGCGTTAACTTCGACTACAAAGACGACGACGACAAAGAAGCGGC
GGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGATCTTAATCCATTAATTAATGAA
DKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVE
KLCVWNNKTPHAIAAISMANEAAAKRVQPTESIVRFPNITNLCPFGEVFNATRFASVYA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTE
IYQAGSTPCNGVQGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKK
STNLVKNKCVNFDYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTA
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCAAAATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCGTTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCAAACCGTGCAACGGCGTTGAAGGCTTCAACTGCTACTTCCCGCTGCAGTCCT
ACGGCTTCCAGCCGACCAACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGT
CCTTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACC
TGGTTAAAAACAAATGCGTTAACTTCGACTACAAAGACGACGACGACAAAGAAGCG
GCGGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGATCTTAATCCATTAATTAATG
DKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVE
KLCVWNNKTPHAIAAISMANEAAAKRVQPTESIVRFPNITNLCPFGEVFNATRFASVYA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTE
IYQAGSKPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKS
TNLVKNKCVNFDYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTAA
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCAACATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCGTTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCAAACCGTGCAACGGCGTTGAAGGCTTCAACTGCTACTTCCCGCTGCAGTCCT
ACGGCTTCCAGCCGACCAACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGT
CCTTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACC
TGGTTAAAAACAAATGCGTTAACTTCGACTACAAAGACGACGACGACAAAGAAGCG
GCGGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGATCTTAATCCATTAATTAATG
DKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVE
KLCVWNNKTPHAIAAISMANEAAAKRVQPTESIVRFPNITNLCPFGEVFNATRFASVYA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTE
IYQAGSKPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKS
TNLVKNKCVNFDYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTAA
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCAAAATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCAGTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCACCCCGTGCAACGGCGTTGAAGGCTTCAACTGCTACTCCCCGCTGCAGTCCTA
CGGCTTCCAGCCGACCAACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGTCC
TTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACCTG
GTTAAAAACAAATGCGTTAACTTCGACTACAAAGACGACGACGACAAAGAAGCGGC
GGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGATCTTAATCCATTAATTAATGAA
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYQYRLFRKSNLKPFERDISTE
IYQAGSTPCNGVEGFNCYSPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKS
TNLVKNKCVNFDYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTAA
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCAAAATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCGTTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCAAACCGTGCAACGGCGTTGAAGGCTTCAACTGCTACTTCCCGCTGCAGTCCT
ACGGCTTCCAGCCGACCAACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGT
CCTTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACC
TGGTTAAAAACAAATGCGTTAACTTCCCGCGTCAGAAACGTACCGCGACCAAAGCG
TACAACGTTACCCAGGCGTTCGGCCGTCGTGGCCCGGAACAGACCCAGGGCAACTTC
GGCGACCAGGAACTGATCCGTCAGGGCACCGACTACAAACACTGGCCGCAGATCGC
GCAGTTCGCGCCGTCCGCGTCCGCGTTCTTCGGCATGTCCCGTATCGGCATGGAAGT
TACCCCGTCCGGCACCTGGCTGACCTACACCGGCGCGATCAAACTGGACGACAAAG
ACCCGAACTTCAAAGACCAGGTTATCCTGCTGAACAAACACATCGACGCGTACAAA
GACTACAAAGACGACGACGACAAAGAAGCGGCGGCGAAACATGCATTAGCCTATGG
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTE
IYQAGSKPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKS
TNLVKNKCVNFPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWP
QIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYK
DYKDDDDKEAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTAASLLQLSGNASDF
GCGAAAACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCACAACACCCAGATC
CACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTGGCGGGCAAACGTGAAA
TGGCGATCATCACCTTCAAAAACGGCGCGACCTTCCAGGTTGAAGTTCCGGGCTCCCA
GCACATCGACTCCCAGAAAAAAGCGATCGAACGTATGAAAGACACCCTGCGTATCGC
GTACCTGACCGAAGCGAAAGTTGAAAAACTGTGCGTTTGGAACAACAAAACCCCGCA
CGCGATCGCGGCGATCTCCATGGCGAACGAAGCGGCGGCGAAACGTGTTCAGCCGA
CCGAATCCATAGTTAGGTTCCCGAACATCACTAACCTGTGTCCGTTTGGCGAAGTGTT
CAACGCGACCCGTTTTGCGTCCGTCTACGCCTGGAACCGTAAACGTATCTCCAACTGC
GTTGCGGACTACTCCGTTCTGTACAACTCCGCGTCCTTCTCCACCTTCAAATGCTACG
GCGTTTCCCCGACCAAACTGAACGACCTGTGCTTCACCAACGTTTACGCGGACTCCTT
CGTTATCCGTGGCGACGAAGTTCGTCAGATCGCGCCGGGCCAGACCGGCAAAATCG
CGGACTACAACTACAAACTGCCGGACGACTTCACCGGCTGCGTTATCGCGTGGAACT
CCAACAACCTGGACTCCAAAGTTGGCGGCAACTACAACTACCGTTACCGTCTGTTCC
GTAAATCCAACCTGAAACCGTTCGAACGTGACATCTCCACCGAAATCTACCAGGCGG
GCTCCAAACCGTGCAACGGCGTTGAAGGCTTCAACTGCTACTTCCCGCTGCAGTCCT
ACGGCTTCCAGCCGACCAACGGCGTTGGCTACCAGCCGTACCGTGTTGTTGTTCTGT
CCTTCGAACTGCTGCACGCGCCGGCGACCGTTTGCGGCCCGAAAAAATCCACCAACC
TGGTTAAAAACAAATGCGTTAACTTCGCGGCGCTGGCGCTGCTGCTGCTGGACCGTC
TGAACCAGCTGGAATCCAAAATGTCCGGCAAAGGCCAGCAGCAGCAGGGCCAGAC
CGTTACCAAAAAATCCGCGGCGGAAGCGTCCAAAAAACCGCGTCAGAAACGTACCG
CGACCAAAGCGTACAACGTTACCCAGGCGTTCGGCCGTCGTGGCCCGGAACAGACC
CAGGGCAACTTCGGCGACCAGGAACTGATCCGTCAGGGCACCGACTACAAACACTG
GCCGCAGATCGCGCAGTTCGCGCCGTCCGCGTCCGCGTTCTTCGGCATGTCCCGTATC
GGCATGGAAGTTACCCCGTCCGGCACCTGGCTGACCTACACCGGCGCGATCAAACTG
GACGACAAAGACCCGAACTTCAAAGACCAGGTTATCCTGCTGAACAAACACATCGA
CGCGTACAAAACCTTCCCGCCGACCGAACCGAAAGACTACAAAGACGACGACGACA
AAGAAGCGGCGGCGAAACATGCATTAGCCTATGGAAGTCAGGGTGATCTTAATCCAT
WNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAP
GQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYRYRLFRKSNLKPFERDISTE
IYQAGSKPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKS
TNLVKNKCVNFAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKR
TATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMS
RIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKDYKDDDDK
EAAAKHALAYGSQGDLNPLINEISKIISAAGSFDVKEERTAASLLQLSGNASDFSYGRNSITL
CGATCGCGATCGCGGTTGCGCTGGCGGGCTTCGCGACCGTTGCGCAGGCGGG
CAACTTCCTGACCGGCCTGGGCCACCGTTCCGACCACTACAACTGCGTTTCCTC
CGGCGGCCAGTGCCTGTACTCCGCGTGCCCGATCTTCACCAAAATCCAGGGCA
CCTGCTACCGTGGCAAAGCGAAATGCTGCAAAGAAGCGGCGGCGAAAGCGG
CGCTGGCGCTGCTGCTGCTGGACCGTCTGAACCAGCTGGAAGGCCCGGGCCC
GGGCAAATCCGCGGCGGAAGCGTCCAAAAAACCGCGTCAGAAACGTACCGC
GACCAAAGCGTACAACGTTACCCAGGCGTTCGGCCGTCGTGGCCCGGAACA
GACCCAGGGCAACTTCGGCGACCAGGAACTGATCCGTCAGGGCACCGACTA
CAAACACTGGCCGCAGATCGCGCAGTTCGCGCCGTCCGCGTCCGCGTTCTTC
GGCATGTCCCGTATCGGCATGGAAGTTACCCCGTCCGGCACCTGGCTGACCT
ACACCGGCGCGATCAAACTGGACGACAAAGACCCGAACTTCAAAGACCAGG
TTATCCTGCTGAACAAACACATCGACGCGTACAAAACCTTCCCGCCGACCGA
ACCGAAAAAAGCGGCGTACAAAACCTTCCCGCCGACCGAACCGAAAAAAGC
GGCGTACAAAACCTTCCCGCCGACCGAACCGAAAAAAGCGGCGTACATGGC
GTCCATGACCGGCGGCCAGCAGATGGGCTAATGACGCAACGCAATTAATGTG
MKKTAIAIAVALAGFATVAQAGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQ
GTCYRGKAKCCKEAAAKAALALLLLDRLNQLEGPGPGKSAAEASKKPRQKRTAT
KAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFG
MSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKK
AAYKTFPPTEPKKAAYKTFPPTEPKKAAYMASMTGGQQMG*
CGATCGCGATCGCGGTTGCGCTGGCGGGCTTCGCGACCGTTGCGCAGGCGGG
CAACTTCCTGACCGGCCTGGGCCACCGTTCCGACCACTACAACTGCGTTTCCTC
CGGCGGCCAGTGCCTGTACTCCGCGTGCCCGATCTTCACCAAAATCCAGGGCA
CCTGCTACCGTGGCAAAGCGAAATGCTGCAAAGAAGCGGCGGCGAAACCGC
GTCAGAAACGTACCGCGACCAAAGCGTACAACGTTACCCAGGCGTTCGGCC
GTCGTGGCCCGGAACAGACCCAGGGCAACTTCGGCGACCAGGAACTGATCC
GTCAGGGCACCGACTACAAACACTGGCCGCAGATCGCGCAGTTCGCGCCGTC
CGCGTCCGCGTTCTTCGGCATGTCCCGTATCGGCATGGAAGTTACCCCGTCCG
GCACCTGGCTGACCTACACCGGCGCGATCAAACTGGACGACAAAGACCCGA
ACTTCAAAGACCAGGTTATCCTGCTGAACAAACACATCGACGCGTACAAAGC
GGCGTACATGGCGTCCATGACCGGCGGCCAGCAGATGGGCTAATGACGCAAC
MKKTAIAIAVALAGFATVAQAGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQ
GTCYRGKAKCCKEAAAKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDGELIR
QGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPN
FKDQVILLNKHIDAYKAAYMASMTGGQQMG*
CTTCCGTGTTGCGCTGATCCCGTTCTTCGCGGCGTTCTGTCTCCCGGTATTCGC
CCACCCGGAAACCCTGGTTAAAGTTAAAGACGCGGAAGCGGCGGCGAAAGG
CAACTTCCTGACCGGCCTGGGCCACCGTTCCGACCACTACAACTGCGTTTCCTC
CGGCGGCCAGTGCCTGTACTCCGCGTGCCCGATCTTCACCAAAATCCAGGGCA
CCTGCTACCGTGGCAAAGCGAAATGCTGCAAAGAAGCGGCGGCGAAACCGC
GTCAGAAACGTACCGCGACCAAAGCGTACAACGTTACCCAGGCGTTCGGCC
GTCGTGGCCCGGAACAGACCCAGGGCAACTTCGGCGACCAGGAACTGATCC
GTCAGGGCACCGACTACAAACACTGGCCGCAGATCGCGCAGTTCGCGCCGTC
CGCGTCCGCGTTCTTCGGCATGTCCCGTATCGGCATGGAAGTTACCCCGTCCG
GCACCTGGCTGACCTACACCGGCGCGATCAAACTGGACGACAAAGACCCGA
ACTTCAAAGACCAGGTTATCCTGCTGAACAAACACATCGACGCGTACAAAGC
GGCGTACATGGCGTCCATGACCGGCGGCCAGCAGATGGGCTAATGACGCAAC
GCAATTAATGTGAGTTAGCTCACTCATTAGGCACCGTCGAC
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEAAAKGNFLTGLGHRSDHYNC
VSSGGQCLYSACPIFTKIQGTCYRGKAKCCKEAAAKPRQKRTATKAYNVTQAFGR
RGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSG
TWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKAAYMASMTGGQQMG
*
CTTCCGTGTTGCGCTGATCCCGTTCTTCGCGGCGTTCTGTCTCCCGGTATTCGC
CCACCCGGAAACCCTGGTTAAAGTTAAAGACGCGGAAGCGGCGGCGAAAGG
CATCGGCGACCCGGTTACCTGCCTGAAATCCGGCGCGATCTGCCACCCGGTTT
TCTGCCCGCGTCGTTACAAACAGATCGGCACCTGCGGCCTGCCGGGCACCAAA
TGCTGCAAAAAACCGGAAGCGGCGGCGAAACCGCGTCAGAAACGTACCGCG
ACCAAAGCGTACAACGTTACCCAGGCGTTCGGCCGTCGTGGCCCGGAACAG
ACCCAGGGCAACTTCGGCGACCAGGAACTGATCCGTCAGGGCACCGACTAC
AAACACTGGCCGCAGATCGCGCAGTTCGCGCCGTCCGCGTCCGCGTTCTTCG
GCATGTCCCGTATCGGCATGGAAGTTACCCCGTCCGGCACCTGGCTGACCTA
CACCGGCGCGATCAAACTGGACGACAAAGACCCGAACTTCAAAGACCAGGT
TATCCTGCTGAACAAACACATCGACGCGTACAAAGCGGCGTACATGGCGTCC
ATGACCGGCGGCCAGCAGATGGGCTAATGACGCAACGCAATTAATGTGAGTT
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEAAAKGIGDPVTCLKSGAICHPV
FCPRRYKQIGTCGLPGTKCCKKPEAAAKPRQKRTATKAYNVTQAFGRRGPEQTQ
GNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTG
AIKLDDKDPNFKDQVILLNKHIDAYKAAYMASMTGGQQMG*
CGTTGCGCAGGCGCCGCGTCAGAAACGTACCGCGACCAAAGCGTACAACGT
TACCCAGGCGTTCGGCCGTCGTGGCCCGGAACAGACCCAGGGCAACTTCGGC
GACCAGGAACTGATCCGTCAGGGCACCGACTACAAACACTGGCCGCAGATC
GCGCAGTTCGCGCCGTCCGCGTCCGCGTTCTTCGGCATGTCCCGTATCGGCAT
GGAAGTTACCCCGTCCGGCACCTGGCTGACCTACACCGGCGCGATCAAACTG
GACGACAAAGACCCGAACTTCAAAGACCAGGTTATCCTGCTGAACAAACAC
ATCGACGCGTACAAACACCACCACCACCACCACTAATTGTTCAGAACGCTCGG
MKKTAIAIAVALAGFATVAQAPRQKRTATKAYNVTQAFGRRGPEQTQGNFGD
QELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDD
KDPNFKDQVILLNKHIDAYKHHHHHH*
CGTTGCGCAGGCGGGCATCGGCGACCCGGTTACCTGCCTGAAATCCGGCGCG
ATCTGCCACCCGGTTTTCTGCCCGCGTCGTTACAAACAGATCGGCACCTGCGG
CCTGCCGGGCACCAAATGCTGCAAAAAACCGGAAGCGGCGGCGAAACCGCGT
CAGAAACGTACCGCGACCAAAGCGTACAACGTTACCCAGGCGTTCGGCCGTC
GTGGCCCGGAACAGACCCAGGGCAACTTCGGCGACCAGGAACTGATCCGTC
AGGGCACCGACTACAAACACTGGCCGCAGATCGCGCAGTTCGCGCCGTCCGC
GTCCGCGTTCTTCGGCATGTCCCGTATCGGCATGGAAGTTACCCCGTCCGGCA
CCTGGCTGACCTACACCGGCGCGATCAAACTGGACGACAAAGACCCGAACTT
CAAAGACCAGGTTATCCTGCTGAACAAACACATCGACGCGTACAAACACCAC
CACCACCACCACTAATTGTTCAGAACGCTCGGTCTTGCACACCGGGCGTTTTTT
MKKTAIAIAVALAGFATVAQAGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGT
KCCKKPEAAAKPRQKRTATKAYNVTGAFGRRGPEQTQGNFGDQELIRQGTDYK
HINPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVIL
LNKHIDAYKHHHHHH*
CGTTGCGCAGGCGGGCATCGGCGACCCGGTTACCTGCCTGAAATCCGGCGCG
ATCTGCCACCCGGTTTTCTGCCCGCGTCGTTACAAACAGATCGGCACCTGCGG
CCTGCCGGGCACCAAATGCTGCAAAAAACCGGAAGCGGCGGCGAAACACCAC
CACCACCACCACTAATTGTTCAGAACGCTCGGTCTTGCACACCGGGCGTTTTTT
MKKTAIAIAVALAGFATVAQAGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGT
KCCKKPEAAAKHHHHHH*
CGTTGCGCAGGCGACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCAC
AACACCCAGATCCACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTG
GCGGGCAAACGTGAAATGGCGATCATCACCTTCAAAAACGGCGCGACCTTCC
AGGTTGAAGTTCCGGGCTCCCAGCACATCGACTCCCAGAAAAAAGCGATCGA
ACGTATGAAAGACACCCTGCGTATCGCGTACCTGACCGAAGCGAAAGTTGAA
AAACTGTGCGTTTGGAACAACAAAACCCCGCACGCGATCGCGGCGATCTCCAT
GGCGAACGAAGCGGCGGCGAAACACCACCACCACCACCACTAATTGTTCAGA
MKKTAIAIAVALAGFATVAQATPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKRE
MAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNK
TPHAIAAISMANEAAAKHHHHHH*
CGTTGCGCAGGCGACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCAC
AACACCCAGATCCACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTG
GCGGGCAAACGTGAAATGGCGATCATCACCTTCAAAAACGGCGCGACCTTCC
AGGTTGAAGTTCCGGGCTCCCAGCACATCGACTCCCAGAAAAAAGCGATCGA
ACGTATGAAAGACACCCTGCGTATCGCGTACCTGACCGAAGCGAAAGTTGAA
AAACTGTGCGTTTGGAACAACAAAACCCCGCACGCGATCGCGGCGATCTCCAT
GGCGAACGAAGCGGCGGCGAAACCGCGTCAGAAACGTACCGCGACCAAAGC
GTACAACGTTACCCAGGCGTTCGGCCGTCGTGGCCCGGAACAGACCCAGGG
CAACTTCGGCGACCAGGAACTGATCCGTCAGGGCACCGACTACAAACACTG
GCCGCAGATCGCGCAGTTCGCGCCGTCCGCGTCCGCGTTCTTCGGCATGTCCC
GTATCGGCATGGAAGTTACCCCGTCCGGCACCTGGCTGACCTACACCGGCGC
GATCAAACTGGACGACAAAGACCCGAACTTCAAAGACCAGGTTATCCTGCTG
AACAAACACATCGACGCGTACAAACACCACCACCACCACCACTAATTGTTCAG
MKKTAIAIAVALAGFATVAQATPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKRE
MAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNK
TPHAIAAISMANEAAAKPRQKRTATKAYNVTGAFGRRGPEQTQGNFGDQELIR
QGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPN
FKDQVILLNKHIDAYKHHHHHH*
CGTTGCGCAGGCGGCGGCGCTGGCGCTGCTGCTGCTGGACCGTCTGAACCAG
CTGGAAGGCCCGGGCCCGGGCAAATCCGCGGCGGAAGCGTCCAAAAAACC
GCGTCAGAAACGTACCGCGACCAAAGCGTACAACGTTACCCAGGCGTTCGG
CCGTCGTGGCCCGGAACAGACCCAGGGCAACTTCGGCGACCAGGAACTGAT
CCGTCAGGGCACCGACTACAAACACTGGCCGCAGATCGCGCAGTTCGCGCCG
TCCGCGTCCGCGTTCTTCGGCATGTCCCGTATCGGCATGGAAGTTACCCCGTC
CGGCACCTGGCTGACCTACACCGGCGCGATCAAACTGGACGACAAAGACCC
GAACTTCAAAGACCAGGTTATCCTGCTGAACAAACACATCGACGCGTACAAA
ACCTTCCCGCCGACCGAACCGAAAAAAGCGGCGTACAAAACCTTCCCGCCGA
CCGAACCGAAAAAAGCGGCGTACAAAACCTTCCCGCCGACCGAACCGAAAA
AAGCGGCGTACCACCACCACCACCACCACTAATTGTTCAGAACGCTCGGTCTT
MKKTAIAIAVALAGFATVAQAAALALLLLDRLNQLEGPGPGKSAAEASKKPRQK
RTATKAYNVTQAFGRRGPEQTQGNFGDGELIRQGTDYKHWPGIAQFAPSASA
FFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTE
PKKAAYKTFPPTEPKKAAYKTFPPTEPKKAAYHHHHHH*
CGTTGCGCAGGCGACCCCGCAGAACATCACCGACCTGTGCGCGGAATACCAC
AACACCCAGATCCACACCCTGAACGACAAAATCTTCTCCTACACCGAATCCCTG
GCGGGCAAACGTGAAATGGCGATCATCACCTTCAAAAACGGCGCGACCTTCC
AGGTTGAAGTTCCGGGCTCCCAGCACATCGACTCCCAGAAAAAAGCGATCGA
ACGTATGAAAGACACCCTGCGTATCGCGTACCTGACCGAAGCGAAAGTTGAA
AAACTGTGCGTTTGGAACAACAAAACCCCGCACGCGATCGCGGCGATCTCCAT
GGCGAACGAAGCGGCGGCGAAAGCGGCGCTGGCGCTGCTGCTGCTGGACCG
TCTGAACCAGCTGGAAGGCCCGGGCCCGGGCAAATCCGCGGCGGAAGCGTC
CAAAAAACCGCGTCAGAAACGTACCGCGACCAAAGCGTACAACGTTACCCA
GGCGTTCGGCCGTCGTGGCCCGGAACAGACCCAGGGCAACTTCGGCGACCA
GGAACTGATCCGTCAGGGCACCGACTACAAACACTGGCCGCAGATCGCGCA
GTTCGCGCCGTCCGCGTCCGCGTTCTTCGGCATGTCCCGTATCGGCATGGAA
GTTACCCCGTCCGGCACCTGGCTGACCTACACCGGCGCGATCAAACTGGACG
ACAAAGACCCGAACTTCAAAGACCAGGTTATCCTGCTGAACAAACACATCGA
CGCGTACAAAACCTTCCCGCCGACCGAACCGAAAAAAGCGGCGTACAAAAC
CTTCCCGCCGACCGAACCGAAAAAAGCGGCGTACAAAACCTTCCCGCCGACC
GAACCGAAAAAAGCGGCGTACCACCACCACCACCACCACTAATTGTTCAGAA
MKKTAIAIAVALAGFATVAQATPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKRE
MAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNK
TPHAIAAISMANEAAAKAALALLLLDRLNQLEGPGPGKSAAEASKKPRQKRTAT
KAYNVTQAFGRRGPEQTQGNFGD
I
ELIRQGTDYKHWPQ
I
AQFAPSASAFFG
MSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKK
AAYKTFPPTEPKKAAYKTFPPTEPKKAAYHHHHHH*
GGGCCCGGGCAAATCCGCGGCGGAAGCGTCCAAAAAACCGCGTCAGAAAC
GGGCCCGGGCAAATCCGCGGCGGAAGCGTCCAAAAAACCGCGTCAGAAAC
GGGCCCGGGCAAATCCGCGGCGGAAGCGTCCAAAAAACCGCGTCAGAAAC
GGTAGCCCAGGTGACGGACGAGGAAGCGTTAGCAGAGCGACTGGCGCAA
GGCCCGATCGCGCTCTATTGCGGCTTCGATCCTACCGCTGACAGCTTGCATT
TGGGGCATCTTGTTCCATTGTTATGCCTGAAACGCTTCCAGCAGGCGGGCC
ACAAGCCGGTTGCGCTGGTAGGCGGCGCGACGGGTCTGATTGGCGACCCG
AGCTTCAAAGCTGCCGAGCGTAAGCTGAACACCGAAGAAACTGTTCAGGA
GTGGGTGGACAAAATCCGTAAGCAGGTTGCCCCGTTCCTCGATTTCGACTG
TGGAGAAAACTCTGCTATCGCGGCGAACAACTATGACTGGTTCGGCAATAT
GAATGTGCTGACCTTCCTGCGCGATATTGGCAAACACTTCTCCGTTAACCAG
ATGATCAACAAAGAAGCGGTTAAGCAGCGTCTCAACCGTGAAGATCAGGG
GATTTCGTTCACTGAGTTTTCCTACAACCTGTTGCAGGGTTATGACTTCGCC
TGTCTGAACAAACAGTACGGTGTGGTGCTGCAAATTGGTGGTTCTGACCAG
TGGGGTAACATCACTTCTGGTATCGACCTGACCCGTCGTCTGCATCAGAATC
AGGTGTTTGGCCTGACCGTTCCGCTGATCACTAAAGCAGATGGCACCAAAT
TTGGTAAAACTGAAGGCGGCGCAGTCTGGTTGGATCCGAAGAAAACCAGC
CCGTACAAATTCTACCAGTTCTGGATCAACACTGCGGATGCCGACGTTTACC
GCTTCCTGAAGTTCTTCACCTTTATGAGCATTGAAGAGATCAACGCCCTGG
AAGAAGAAGATAAAAACAGCGGTAAAGCACCGCGCGCCCAGTATGTACT
GGCGGAGCAGGTGACTCGTCTGGTTCACGGTGAAGAAGGTTTACAGGCGG
CAAAACGTATTACCGAATGCCTGTTCAGCGGTTCTTTGAGTGCGCTGAGTG
AAGCGGACTTCGAACAGCTGGCGCAGGACGGCGTACCGATGGTTGAGATG
GAAAAGGGCGCAGACCTGATGCAGGCACTGGTCGATTCTGAACTGCAACC
TTCCCGTGGTCAGGCACGTAAAACTATCGCCTCCAATGCCATCACCATTAAC
GGTGAAAAACAGTCCGATCCTGAATACTTCTTTAAAGAAGAAGATCGTCTG
TTTGGTCGTTTTACCTTACTGCGTCGCGGTAAAAAGAATTACTGTCTGATTT
GCTGGAAACATCACCATCACCATCACTAATCCACGGCCGCCAGTTTGGGCT
GGTAGCCCAGGTGACGGACGAGGAAGCGTTAGCAGAGCGACTGGCGCAA
GGCCCGATCGCGCTCTATTGCGGCTTCGATCCTACCGCTGACAGCTTGCATT
TGGGGCATCTTGTTCCATTGTTATGCCTGAAACGCTTCCAGCAGGCGGGCC
ACAAGCCGGTTGCGCTGGTAGGCGGCGCGACGGGTCTGATTGGCGACCCG
AGCTTCAAAGCTGCCGAGCGTAAGCTGAACACCGAAGAAACTGTTCAGGA
GTGGGTGGACAAAATCCGTAAGCAGGTTGCCCCGTTCCTCGATTTCGACTG
TGGAGAAAACTCTGCTATCGCGGCGAACAACTATGACTGGTTCGGCAATAT
GAATGTGCTGACCTTCCTGCGCGATATTGGCAAACACTTCTCCGTTAACCAG
ATGATCAACAAAGAAGCGGTTAAGCAGCGTCTCAACCGTGAAGATCAGGG
GATTTCGTTCACTGAGTTTTCCTACAACCTGTTGCAGGGTTATGACTTCGCC
TGTCTGAACAAACAGTACGGTGTGGTGCTGCAAATTGGTGGTTCTGACCAG
TGGGGTAACATCACTTCTGGTATCGACCTGACCCGTCGTCTGCATCAGAATC
AGGTGTTTGGCCTGACCGTTCCGCTGATCACTAAAGCAGATGGCACCAAAT
TTGGTAAAACTGAAGGCGGCGCAGTCTGGTTGGATCCGAAGAAAACCAGC
CCGTACAAATTCTACCAGTTCTGGATCAACACTGCGGATGCCGACGTTTACC
GCTTCCTGAAGTTCTTCACCTTTATGAGCATTGAAGAGATCAACGCCCTGG
AAGAAGAAGATAAAAACAGCGGTAAAGCACCGCGCGCCCAGTATGTACT
GGCGGAGCAGGTGACTCGTCTGGTTCACGGTGAAGAAGGTTTACAGGCGG
CAAAACGTATTACCGAATGCCTGTTCAGCGGTTCTTTGAGTGCGCTGAGTG
AAGCGGACTTCGAACAGCTGGCGCAGGACGGCGTACCGATGGTTGAGATG
GAAAAGGGCGCAGACCTGATGCAGGCACTGGTCGATTCTGAACTGCAACC
TTCCCGTGGTCAGGCACGTAAAACTATCGCCTCCAATGCCATCACCATTAAC
GGTGAAAAACAGTCCGATCCTGAATACTTCTTTAAAGAAGAAGATCGTCTG
TTTGGTCGTTTTACCTTACTGCGTCGCGGTAAAAAGAATTACTGTCTGATTT
GCTGGAAACATCACCATCACCATCACTAATTGTTCAGAACGCTCGGTCTTGC
AGCCCAGGTGACGGACGAGGAAGCGTTAGCAGAGCGACTGGCGCAAGGC
CCGATCGCGCTCTATTGCGGCTTCGATCCTACCGCTGACAGCTTGCATTTGG
GGCATCTTGTTCCATTGTTATGCCTGAAACGCTTCCAGCAGGCGGGCCACA
AGCCGGTTGCGCTGGTAGGCGGCGCGACGGGTCTGATTGGCGACCCGAGC
TTCAAAGCTGCCGAGCGTAAGCTGAACACCGAAGAAACTGTTCAGGAGTG
GGTGGACAAAATCCGTAAGCAGGTTGCCCCGTTCCTCGATTTCGACTGTGG
AGAAAACTCTGCTATCGCGGCGAACAACTATGACTGGTTCGGCAATATGA
ATGTGCTGACCTTCCTGCGCGATATTGGCAAACACTTCTCCGTTAACCAGAT
GATCAACAAAGAAGCGGTTAAGCAGCGTCTCAACCGTGAAGATCAGGGG
ATTTCGTTCACTGAGTTTTCCTACAACCTGTTGCAGGGTTATGACTTCGCCT
GTCTGAACAAACAGTACGGTGTGGTGCTGCAAATTGGTGGTTCTGACCAGT
GGGGTAACATCACTTCTGGTATCGACCTGACCCGTCGTCTGCATCAGAATC
AGGTGTTTGGCCTGACCGTTCCGCTGATCACTAAAGCAGATGGCACCAAAT
TTGGTAAAACTGAAGGCGGCGCAGTCTGGTTGGATCCGAAGAAAACCAGC
CCGTACAAATTCTACCAGTTCTGGATCAACACTGCGGATGCCGACGTTTACC
GCTTCCTGAAGTTCTTCACCTTTATGAGCATTGAAGAGATCAACGCCCTGG
AAGAAGAAGATAAAAACAGCGGTAAAGCACCGCGCGCCCAGTATGTACT
GGCGGAGCAGGTGACTCGTCTGGTTCACGGTGAAGAAGGTTTACAGGCGG
CAAAACGTATTACCGAATGCCTGTTCAGCGGTTCTTTGAGTGCGCTGAGTG
AAGCGGACTTCGAACAGCTGGCGCAGGACGGCGTACCGATGGTTGAGATG
GAAAAGGGCGCAGACCTGATGCAGGCACTGGTCGATTCTGAACTGCAACC
TTCCCGTGGTCAGGCACGTAAAACTATCGCCTCCAATGCCATCACCATTAAC
GGTGAAAAACAGTCCGATCCTGAATACTTCTTTAAAGAAGAAGATCGTCTG
TTTGGTCGTTTTACCTTACTGCGTCGCGGTAAAAAGAATTACTGTCTGATTT
GCTGGAAACATCACCATCACCATCACTAATTGTTCAGAACGCTCGGTCTTGC
GCGCAGGTTACCGACGAAGAAGCGCTGGCGGAACGTCTGGCGCAGGGCC
CGATCGCGCTGTACTGCGGCTTCGACCCGACCGCGGACTCCCTGCACCTGG
GCCACCTGGTTCCGCTGCTGTGCCTGAAACGTTTCCAGCAGGCGGGCCACA
AACCGGTTGCGCTGGTTGGCGGCGCGACCGGCCTGATCGGCGACCCGTCCT
TCAAAGCGGCGGAACGTAAACTGAACACCGAAGAAACCGTTCAGGAATG
GGTTGACAAAATCCGTAAACAGGTTGCGCCGTTCCTGGACTTCGACTGCGG
CGAAAACTCCGCGATCGCGGCGAACAACTACGACTGGTTCGGCAACATGA
ACGTTCTGACCTTCCTGCGTGACATCGGCAAACACTTCTCCGTTAACCAGAT
GATCAACAAAGAAGCGGTTAAACAGCGTCTGAACCGTGAAGACCAGGGC
ATCTCCTTCACCGAATTCTCCTACAACCTGCTGCAGGGCTACGACTTCGCGT
GCCTGAACAAACAGTACGGCGTTGTTCTGCAGATCGGCGGCTCCGACCAGT
GGGGCAACATCACCTCCGGCATCGACCTGACCCGTCGTCTGCACCAAAATC
AGGTGTTCGGGCTGACCGTTCCGCTGATCACCAAAGCGGACGGCACCAAA
TTCGGCAAAACCGAAGGCGGCGCGGTTTGGCTGGACCCGAAAAAAACCTC
CCCGTACAAATTCTACCAGTTCTGGATCAACACAGCGGACGCGGACGTATA
CAGATTCCTGAAATTCTTCACCTTCATGTCCATCGAAGAAATCAACGCGCTG
GAAGAAGAAGACAAAAACTCCGGCAAAGCGCCGCGTGCGCAGTACGTTCT
GGCGGAACAGGTTACCCGTCTGGTTCACGGCGAAGAAGGCCTGCAGGCGG
CGAAACGTATCACCGAATGCCTGTTCTCCGGCTCCCTGTCCGCGCTGTCCGA
AGCGGACTTCGAACAGCTGGCGCAGGACGGCGTTCCGATGGTTGAAATGG
AAAAAGGCGCGGACCTGATGCAGGCGCTGGTTGACTCCGAACTGCAGCCG
TCCCGTGGCCAGGCGCGTAAAACCATCGCGTCCAACGCGATCACCATCAAC
GGCGAAAAACAGTCCGACCCGGAATACTTCTTCAAAGAAGAAGACCGTCT
GTTCGGCCGTTTCACCCTGCTGCGTCGTGGCAAAAAAAACTACTGCCTGAT
CTGCTGGAAACACCACCACCACCACCACTAA
TTGTTCAGAACGCTCGGTCTT
The bacterium, combination product and vaccine of the present invention are susceptible of industrial application. The invention can be manufactured for use in the medical and healthcare industry. In particular, the invention can be used to provide patients with an active adaptive immunity towards members of the coronavirus family.
The invention is exemplified by the following non-limiting Examples:
Antigenic plots of SEQ ID NO: 30 and SEQ ID NO: 41 were generated using the method disclosed in Kolaskar & Tongaonkar, 1990. FEBS Lett. 276(1-2):172-4. These plots are provided in
According to the antigenic plots, the herein disclosed fusion proteins have the potential to induce an immune response in a subject. Thus, they have the potential to function as a vaccine.
Further, antigenic plots were used to identify SARS-CoV-2 antigens with an antigenic propensity score of greater than 0.9. All the SARS-CoV-2 antigens disclosed herein have an antigenic propensity score of greater than 0.9.
The constructs disclosed herein can be introduced into a Ty21a Salmonella strain via the pSalVac plasmid. The pSalVac 001 A0_B0 plasmid is depicted in
The sequence of the pSalVac 001 A0_B0 KanR plasmid is provided in SEQ ID NO: 42:
Methods for inserting plasmids into S. typhi strains are known in the art (see Callaghan & Charbit, 1990. Mol Gen Genet. 223(1):156-8).
1. Materials
1.1 Bacterial Strains
Bacterial strains are depicted in table 1 (E. coli, Salmonella initial strains), table 10 (Salmonella intermediate and recipient strains) and table 11 (BLS vaccine strains).
1.2 Plasmids
Plasmids are listed in table 6 (codon optimized synthetic antigen fragments in delivery plasmids by manufacturer), table 7A, and table 9 (plasmids for the construction of BLS strains and the JMU SalVac-100 series).
1.3 Primers
Primes are listed in table 7B (construction of BLS strains), table 8 (sequencing and PCR) and table 12 (qPCR).
1.4 Media
For strain construction purposes:
For quality control and characterization purposes:
Media for bacterial culture were autoclaved for 20 min at 121° C. Antibiotics and other temperature sensitive supplements were added after autoclaving and cooling of the media.
1.5 Chemicals
Unless otherwise stated, all chemicals were obtained from Sigma-Aldrich, Difco, Roth and Applichem.
1.6 Buffers and Solutions
242 g Tris
100 ml 0.5 M EDTA pH 8.0
57.1 ml acetic acid
Ad 1000 ml ddH2O
100 ml 10×TBE-Puffer (ThermoFisher)
Ad to 1000 ml ddH2O
10 ml 1.5 M Tris/HCl pH 6.8
40 ml 10% SDS
30 ml Glycerol
5 mg Bromophenol blue
1.5 ml β-mercaptoethanol
Ad to 100 ml ddH2O
90.85 g Tris
20 mil 10% SDS
Ad 500 ml ddH2O
Set pH to 8.8
30.3 g Tris
20 mil 10% SDS
Ad 500 ml ddH2O
Set pH to 6.8
4.15 ml millipore H2O
2.5 ml lower buffer
3.35 ml Rotiphorese Gel 30 (37.5:1)
75 μl 10% APS
7.5 μl TEMED
6.25 ml millipore H2O
2.5 ml upper buffer
1.25 ml Rotiphorese Gel 30 (37.5:1)
100 μl 10% APS
20 μl TEMED
10 g SDS
30.3 g Tris
144.1 g Glycine
Ad 1 1 ddH2O
77.5 g Glycine
100 ml 10% SDS
250 ml 1 M Tris pH 7.5-8.0
Ad 1 1 ddH2O
Set pH to 8.3
60.5 g Tris
87.6 g NaCl
Ad 1 1 ddH2O
Set pH to 7.5
5 ml Tween-20
5 ml 1 M Tris/HCl pH 8.5
500 μl 250 mM Luminol in DMSO
220 μl 90 mM cumeric acid in DMSO
Add to 50 ml ddH2O
5 ml 1 M Tris/HCl pH 8.5
32 μl 35% H2O2
Add to 50 ml ddH2O
2. Methods
2.1 Bacterial Strains and Media
E. coli DH5α (Invitrogen) were utilized for subcloning, plasmid amplification and maintenance. S. enterica serovar Typhi strain Ty21a and its ΔtyrS derivative were used as the basis for the generation of human vaccine strains. S. enterica serovar Typhimurium ΔaroA strain SL7207 was utilized for oral immunization studies in mice (Table 1). Unless otherwise stated, bacterial strains were grown aerobically in LB broth (Lennox) vegetal (Roth) at 37° C. with rigorous shaking (180-200 rpm), or on LB-Agar (Lennox) vegetal (Roth). Unless otherwise stated, antibiotic selection, as if necessary, was carried out using ampicillin (Sigma-Aldrich), kanamycin (Sigma-Aldrich) and chloramphenicol (Sigma-Aldrich) at final concentrations of 100, 25 and 20 μg/ml, respectively. For characterization experiments Salmonella spp. were grown in tryptic soy (TS) broth (Sigma-Aldrich) supplemented with appropriate antibiotics, if necessary. All strains were stored as glycerol (Roth) stock cultures (25-40%) at −80° C. For preparation of immunization aliquots, S. enterica serovar Typhi Ty21a ΔtyrS vaccine strains were grown in tryptic soy broth supplemented with 0.001% galactose (Merck).
2.2 in Silico Design of Antigen Selection
For vaccine construction, we have selected the structural proteins of SARS-CoV-2. The protein sequences of SARS-CoV-2 and the protein sequences of the adjuvant proteins for vaccine development were retrieved from UniProt database (https://www.uniprot.org/). Each of these protein sequences was screened for their average antigenic propensity using the antigenic peptides prediction tool (http://imed.med.ucm.es/Tools/antigenic.pl) (Kolaskar et al., 1990).
In silico cloning was performed using the SnapGene Viewer 5.3 and SnapGene 5.3.1. The optimized sequences of the NsiI- and SalI-fragments were synthesized by Invitrogen GeneArt Gene Synthesis (ThermoFisher scientific) and then cloned into one of their Standard GeneArt delivery vectors with ampicillin or kanamycin resistance markers (pMA respectively pMK)(Table 6). The DNA was delivered as 5 μg lyophilized plasmid DNA in microcentrifuge tube. After resolving in 50 μg Roti-CELL water (Roth) plasmid DNA was stored at −20° C.
2.3 Molecular Cloning
2.3.1. Standard Techniques.
All standard molecular methods were performed following published protocols (Sambroock and Russell, 2001). PCR-products and digests were purified either with QIAquick PCR Purification Kit (Qiagen) or the QIAquick Gel Extraction Kit (Qiagen) following the manufacturer's recommendations.
Restriction enzymes (FastDigest Mph1103I, FastDigest SalI) and T4 DNA ligase were purchased from Thermo Fisher Scientific. Oligonucleotides were synthesized by Sigma-Aldrich Chemie GmbH. PCR was performed with Biometra T3 Thermocycler Triple Block Laboratory PCR Thermal Cycler.
2.3.2 DNA Isolation.
Plasmids were purified with QIAprep Spin Miniprep Kit (Qiagen) and QIAGEN Plasmid Midi Kit (Qiagen) following the manufacturer's instructions. Chromosomal DNA was isolated using QIAamp DNA Mini Ki (Qiagen) following the manufacturer's instructions. The amount of DNA was measured using NanoDrop (Peglab, ND-1000).
2.3.3 Electroporation.
E. coli and Salmonella spp. strains were electroporated with recombinant plasmids using standard techniques. In brief, electrocompetent cultures were generated by harvesting them at an OD600 of 0.6-1.2 by centrifugation. Pellets were washed three times with ice-cold 10% glycerol (Roth), concentrated 100× in 10% glycerol and stored at −80° C. For electroporation, cells were thawed on ice. Subsequently, 0.1-1 μg of DNA was mixed with 40 to 100 μl cell suspension and incubated on ice for approximately 1 min. DNA was introduced into the bacteria by using a Bio-Rad MicroPulser following the manufacturer's recommendations. For electroporation, 0.1 cm or 0.2 cm cuvettes (VWR) were used. After pulsing, the bacteria were incubated in SOB-broth (Roth) supplemented with 20 mM Glucose (Roth) for 1 h at 37° C., respectively at 30° C. when the cells were harboring the temperature-sensitive plasmid pCP20. After 1 h the bacteria were plated out on LB-Agar plates with the appropriate antibiotic selection.
2.3.4 PCR.
DNA templates were prepared by different methods.
For screening purposes, DNA was obtained from the supernatant after heat-inactivation of bacteria at 100° C. for 5 min and a following centrifugation step for 2 min at ≥10.000 rpm, 4° C. in a microcentrifuge. After the centrifugation step the lysate was cooled on ice and 1 to 2 μl were used as template for the PCR reactions using MyTaq HS Red Mix (Bioline, cat. BIO-25048, lot. PM348-BO82870).
For sequencing, chromosomal DNA of selected strains was isolated using QIAamp DNA Mini Ki (Quiagen) following the manufacturer's instructions and used as template in PCR-Reactions using primers flanking the tyrS-region in the chromosome (primer pair No 17 and 18, see table 8) using Phusion Plus DNA polymerase (ThermoFisher Scientific) following the manufacturer's instructions.
PCR cycle program:
Program:
2.3.5 Agarose Gel Electrophoresis.
DNA fragments, if necessary and PCR products were mixed with 5× GelPilot DNA Loading Dye (Qiagen) and loaded on 1% agarose gels for subsequent control of PCR reactions and purification of desired DNA fragments. DNA bands of interest were excised from agarose gels and purified by GeneJET Gel Extraction Kit (ThermoFisher Scientific) or QIAquick Gel Extraction Kit (Quiagen) according to manufacturer's instructions.
Electrophoresis was performed with 1% agarose gels with 10 μl of the samples, 1×TAE buffer and at 110 V for around 30 minutes.
2.4 Construction of the Balanced-Lethal-System (BLS) for Plasmid Stabilization
Antibiotics are commonly used and are effective in providing plasmid stability under selective conditions. However, their use to stabilize plasmids in live vaccines is usually not applicable. Thus, without the selective pressure of antibiotics, plasmids might become unstable leading to their segregational loss. This in consequence leads to a sub-optimal efficacy of any bacterial live vector vaccine due to insufficient expression and presentation of the vaccine antigen to the human immune system (Spreng et al., 2005). The plasmid maintenance system the inventors previously designed to stabilize plasmids without any antibiotic selection pressure is made up of the chromosomal knockout of the gene tyrS encoding for the tyrosyl-tRNA-synthetase and the in trans complementation of this gene on the respective antigen-delivery-plasmid (Diessner, 2009).
2.4.1 Construction of the Chromosomal tyrS-Knockout-Strains
For the construction of the chromosomal tyrS knockout the inventors modified the method of “one-step inactivation of chromosomal genes using PCR products” which was described by Datsenko and Wanner, (Datsenko et al., 2000). As tyrS is an essential gene, this approach had to be adapted to avoid the lethal knockout of a gene without genetic complementation. A functionally active TyrS-expression cassette was therefore inserted into the PCR-template-plasmid pKD3. The TyrS expression cassette is located upstream of the promoter of the chloramphenicol resistance gene (cat) within the two FRT-sites. Hence the chromosomal tyrS was replaced by a fragment encoding for the antibiotic resistance and the gene encoding E. coli tyrS.
In brief, the FRT-flanked knock in fragment was amplified by PCR. The purified PCR-fragment was electroporated into S. typhi Ty21a, harbouring the temperature-sensitive easily curable Red helper plasmid pKD46 which carries the Red recombination system with the phage a Red recombinase under the control of an arabinose-inducible promoter. The chromosomal tyrS sequence was then replaced by the knock-in fragment by Red-mediated recombination in the flanking homologies (H1 and H2-region) resulting in strain S. enterica serovar Typhi Ty21a ΔtyrS (tyrS Cm)+ (Diessner, 2009).
This strain (clone 120) was transformed with the helper plasmid pCP20. The resulting strain is designated Ty21a-BLS-R (recipient) strain. The respective tyrS-complementing antigen delivery plasmids of the pSalVac Ax_By series was then electroporation. As a last step, all regions flanked by FRT-sites are eliminated by thermal induction of the pCP20 encoded flippase (Flp). The heat-induction simultaneously cured the strains from plasmid pCP20 due to its temperature-sensitive replication (Cherepanov et al., 1995). This generated the final antibiotic resistance gene free vaccine strain of the JMU-SalVac-100 series (S. enterica serovar Typhi Ty21a ΔtyrS pSalVac Ax_By ΔKanR.
2.4.2 Construction of Template Plasmid pKD3-SpeI-tyrS-HisTag-s (Diessner, 2009)
The E. coli strain used for pKD3-derivate constructions was the pir-positive E. coli strain CC118 λpir (Herrero et al., 1990). In brief, first a SpeI-(BcuI)-restriction site was introduced into plasmid pKD3 by PCR using QuickChange Site-directed Mutagenesis Kit (Stratagene) according to manufacturers' instructions.
The oligonucleotides used for mutagenesis were Mut-pKD3-SpeI-forward and Mut-pKD3-SpeI-reverse (see table 7B)
The DNA was then transformed into electrocompetent cells of pir-positive E. coli strain CC118 λpir. After 1 h incubation at 37° C., the entire transformation reaction was plated on LB agar plates containing the appropriate antibiotics. The plates were incubated at 37° C. for >16 h. Plasmid DNA of several colonies was isolated and screened for positive clones by SpeI restriction analysis. One positive clone of putative pKD3-SpeI was selected and further confirmed by sequencing.
For construction of template plasmid pKD3-SpeI-tyrS-HisTag-s, E. coli DH5α chromosomal DNA was used as template to create the tyrS×6His expression cassette (tyrS EPC). The tyrS EPC in which the tyrS gene is under control of its native 5′-flanking DNA region (PWT) was constructed as follows: first, a 1638 bp fragment was amplified with Pfu-Polymerase (Stratagene) by PCR using the forward primer tyrS-EPK-SpeI-reverse which binds 313-288 bp upstream from start codon of tyrS introducing a SpeI site and the reverse primer Ter-HisTag-1-forward 5′ which introduce a 6×His-tag upstream of the stop codon of the tyrS gene. The amplified DNA-fragment was then used as template in a second PCR using the same forward primer but a different reverse primer, namely SpeI-Ter-HisTag-2-forward which prolongs the template at the 3′-end to overall 1688 bp. Furthermore, the primer contains a SpeI recognition site. The resulting SpeI-PWTtyrS6×his-fragment included 313 bp flanking the open reading frame (ORF) of the tyrS gene at its 5′ end, as well as 58 bp following the stop codon of this gene. After digestion with the SpeI restriction enzyme the DNA fragment was inserted into the single SpeI site of the template vector pKD3-SpeI resulting in plasmid pKD3-SpeI-tyrS-HisTag-s which bears the tyrS gene in the same orientation as the cat gene. The correct clone was confirmed by sequencing.
2.4.3 Chromosomal Integration of the (FRT-tyrS CmR-FRT)-PCR-Fragment into S. typhi Ty21a
Disruption of chromosomal tyrS by integration of a FRT-tyrS CmR-FRT-knock-in PCR fragment was performed following the method of Datsenko and Wanner (2000) but with modifications.
Briefly, S. typhi Ty21a was transformed with the temperature-sensitive Red recombinase helper plasmid pKD46. Transformants were grown in LB at 30° C. supplemented with ampicillin and 0.2% L-(+)-arabinose and then made electrocompetent as described by Datsenko and Wanner (2000). The plasmid pKD46 express the Red system under control of an arabinose-inducible promoter conferring the ability for homologous recombination with linear PCR under inducing conditions (Datsenko and Wanner, 2000).
The knock-in PCR fragment to disrupt chromosomal tyrS in S. typhi Ty21a was generated by amplifying the FRT site flanked tyrS-CmR cassette on plasmid pKD3-SpeI tyrS HisTag-s using BioTherm™ Taq polymerase (Genecraft). To minimize possible polar effects on downstream gene expression, primer were designed to yield in the final step of the procedure a tyrS in-frame deletion to begin 6 bp downstream of the translation start site and end 168 bp upstream of the stop codon. Design of primers were based on the published sequences S. enterica subsp. enterica serovar Typhi Ty2 (GenBank accession no. NC_004631). The primer knockout-forward 5′ has a 49 nt extension that is homologous to the 5′-region adjacent to tyrS (H1), including the start codon and the first codon of the gene as well as 20 nt homologous priming site 1 (P1) of template plasmid pKD3-SpeI tyrS HisTag-s. The primer knockout-reverse (Table 7B) binds to priming site 2 (P2) of the template plasmid and has a 51 nt extension that is homologous to region 1108-1158 bp downstream the start codon of tyrS (H2). The knock-in-PCR-product has an overall length of 2803 bp. The PCR products were gel-purified, digested with DpnI, repurified, and suspended in elution buffer (10 mM Tris, pH 8.0). Subsequently, the PCR products were transformed into S. typhi Ty21a harbouring pKD46. After one hour incubation at 30° C. in TS medium clones were selected on TS agar plates containing 5 μg/ml chloramphenicol and 0.2% arabinose. Following primary selection at 30° C., mutants were maintained on TS medium without selection. Single colonies were then grown on TS agar without antibiotics at 37° C. and then tested for ampicillin sensitivity to confirm the loss of the helper plasmid pKD46 (Datsenko and Wanner, 2000). Correct insertion of the knock-in PCR-product into the chromosomal tyrS gene of S. typhi Ty21 was investigated by PCR analysis. Subsequently clone 120 of S. enterica serovar Typhi Ty21a ΔtyrS (tyrS Cm)+ (clone 120) was selected and confirmed by sequencing (Diessner, 2009).
2.4.4 Cloning of PlacI-like tyrS expression cassette in pMKhlyAIS2-CtxB-PSA (Gesser, 2010)
The plasmid pKD3 PWT tyrS EPC was digested with the SpeI restriction enzyme. Subsequently the DNA-Fragment carrying the SpeI-PWTtyrS EPC-fragment was inserted into the single SpeI site of pMKhlyAIS2 CtxB-PSA resulting in the plasmid pMKhlyAIS2 PWTtyrS CtxB-PSA which bears the tyrS gene in the same orientation as the recombinant Hly gene cluster. The correct clone was confirmed by sequencing.
In E. coli, the LacI repressor which regulates expression of the lactose metabolic genes by binding to the lacO operator sequence (Lewis, 2005) is synthesized constitutively at a very low level, approximately 5 to 10 copies per cell (Gilbert et al., 1966, Muller-Hill et al., 1968). Thus, to reduce the expression on each single plasmid and therefore to favour the regulation of expression towards a higher plasmid copy number the tyrS×6his-coding sequence was cloned under the control of a lacI-derived promoter and integrated into the single SpeI-site of pMKhlyAIS2-CtxB-PSA. First, a PCR was performed using pMKhly CtxB-PSA PWT tyrS EPC as template. The forward primer LacI-Prom.for binds to the region 48 nt to 21 nt upstream the start codon of the tyrS coding sequence. The Primer has an extension of 70 nt containing a lacI derived promoter sequence (PlacI-like) and moreover a SalI plus a SpeI-restriction-site at the 5′-end. The reverse primer LacI-Ter-rev spans the terminal 29 nucleotides including the stop codon of the tyrS6×His coding sequence. The 55 nt-extension of the primer contains a transcription terminator sequence and a SalI plus a SpeI-restriction-site at the 5′-end. The PCR-product was cleaved with SpeI and cloned into the SpeI-site of pMKhlyAIS2 CtxB-PSA. In the resulting plasmid the orientation of the putative tyrS EPC is likewise the same as that of the recombinant hly gene cluster of the vector resulting in plasmid pMKhlyAIS2 Plac-liketyrS CtxB-PSA (Gesser, 2010).
2.5 SDS-PAGE of Cell-Associated and Secreted Proteins.
Bacterial lysates were prepared from mid-log cultures grown in trypticase soy broth or LB medium containing appropriate antibiotics (if applicable). 0.5-2 ml of this culture were harvested by centrifugation and the supernatant was removed. The cell pellets were stored at −20° C. For SDS-PAGE, the pellets were resuspended in 100 to 200 μl of 1× Laemmli buffer with β-mercaptoethanol (Laemmli, 1970), boiled for 5 min and stored at −20° C. for SDS polyacrylamide gel electrophoresis (PAGE) analysis (->cell-associated proteins).
Periplasmic proteins were isolated by osmotic shock as previously described (Ludwig et al., 1999) with only slight modifications. In brief, the bacteria from a defined culture volume were centrifuged (Hereaus Megafuge, 30 min, 4° C., 6,000 rpm), washed with 10 mM Tris-HCl (pH 8.0) and resuspended in 0.25 volume (compared to the starting culture volume) of a solution containing 20% sucrose, 30 mM Tris-HCl (pH 8.0) and 1 mM Na-EDTA (shock buffer). After the addition of 2 μl 500 mM Na-EDTA, pH 8.0 per ml shock buffer, the mixture was incubated for 10 min at room temperature under gentle shaking. Subsequently, the bacteria were pelleted (Hereaus Megafuge, 30 min, 4° C., 6,000 rpm) and resuspended in 1 vol. of ice-cold H2O. After incubation on ice for 10 min, bacteria were pelleted (Hereaus Megafuge, 30 min, 4° C., 6,000 rpm). The supernatant was used as periplasmic protein extract. For the analysis by SDS-PAGE, periplasmic proteins were precipitated by addition of ice-cold trichloroacetic acid (final concentration: 10%) and carefully resuspended in appropriate volume of 1× Laemmli buffer with β-mercaptoethanol by rinsing the walls of the centrifugation tube. Finally, the pH was neutralized by adding 10 μl of saturated Tris solution.
Supernatant proteins were obtained by precipitating proteins from the culture medium of bacteria grown as described above. Bacteria were pelleted from 12 to 50 ml of culture medium by centrifugation (Hereaus Megafuge, 30 min, 4° C., 6,000 rpm). 10 to 45 ml of the supernatant was transferred to a fresh tube and proteins were precipitated with ice-cold 10% trichloric acid (Applichem) overnight at 4° C. The next day, the precipitates were collected by centrifugation (Hereaus Megafuge, 30 min, 4° C., 6,000 rpm), washed with 1 ml ice-cold acetone p.a. (Applichem), air-dried and carefully resuspended in 250 to 450 μl 1× Laemmli buffer with β-mercaptoethanol (Laemmli, 1970) by rinsing the walls of the centrifugation tube. Finally, the pH was neutralized by adding 10 μl of saturated Tris solution. Alternatively, the pellets were resuspended in 250 to 450 μl native sample buffer (BioRad) following manufacturer's instructions.
Unless otherwise stated, SDS-PAGE was performed using the PerfectBlue Vertical Double Gel System from Peqlab. For one gel, 4 ml of 10% separating gel and 2.5 ml of 3.75% stacking gel was used. After gel polymerization and addition of 1×SDS running buffer to the chamber, the gel was loaded with the samples and 5 μl PageRuler Prestained Protein Ladder 10-180 kDa (ThermoFisher, cat. 26617). SDS-PAGE was performed at 90V for 20 min and then increased to 135V for another 2 h depending on the desired separation. The gel was then used for Coomassie staining using Bio-Safe™ Coomassie Stain (BioRAD, cat. 1610786) according to the manufacturer's protocol or by Western blotting.
2.6 Western Blot Analysis.
Unless otherwise stated, Western blotting was performed using the PerfectBlue Semi-Dry Blotter from Peqlab. For the transfer, 3 Whatman paper (Hartenstein, cat. GB33, 580×600, 330 g/m3) were cut to the size of 6×9 cm and, unless otherwise stated, 1 PVDF membrane (Roche, cat. 03010040001, lot. 46099200) were used. The membrane was activated in MeOH for 1 min and the Whatman papers were soaked in 1× Semi-Dry transfer buffer and finally assembled in the following order in the Blotter: 1 Whatman paper, membrane, gel, 2 Whatman paper. The transfer was achieved by applying 1 mA/cm2 gel for 2 h. Transfer was controlled by staining the membranes with Ponceau-S solution (BioMol, cat. MB-072-0500) according to the manufacturer's instructions. Then the membrane was blocked in 5% milk for 1 h at RT and then rinsed 3 times with 1×TBS-T.
The primary antibody was then added overnight at 4° C. in TBS-T. The following day, the membrane was washed 3× for 5 min in 1×TBS-T. Afterwards, the membrane was incubated in the according secondary antibody in 5% milk for 1 h at RT and then washed again 3× for 5 min in 1×TBS-T. For detection, ECL solution 1 and 2 were mixed 1:1 and added to the membrane. If appropriate, Pierce™ ECL Plus Western Blotting Substrate (ThermoFisher scientific) was used according to manufacturer's instructions. Detection was performed using an Intas Chemiluminescence Imager.
Primary antibodies used for Western blotting: α-SARS-CoV-II Spike (Invitrogen, RBD, cat. PA5-114551, lot. WA3165784B, polyclonal rabbit), α-Flag (Sigma Aldrich, cat. F7425, polyclonal rabbit), α-CtxB (CytoMed Systems, cat. 203-1542, lot. 13031207, polyclonal rabbit), α-His (Novagen, cat. 70796_4, lot. 3290351, monoclonal mouse).
Secondary antibodies used: Mouse IgG HRP (Santa Cruz, cat. sc-2005), rabbit IgG HRP (Santa Cruz, cat. sc-2004).
2.7 Sequence Analysis.
Relevant regions of chromosomal or plasmid DNA were analyzed by PCR using appropriate primers (table 8) and/or sequenced. Sequencing was performed by Microsynth following manufacturer's recommendations. (Primer sequences for PCR analysis and for sequencing see table 8).
E coli NightSeq (Only for Screening Purposes)
In brief, clearly visible colonies were picked into E coli NightSeq® tubes (Microsynth) and also streaked out on LB-Agar plates containing appropriate antibiotic, if necessary, for preserving. Tubes were then sent to Microsynth and probes were sequenced by Sanger Sequencing.
Purified or gel-extracted PCR-Products and Plasmid DNA of selected positive clones were isolated (QIAprep Spin Miniprep Kit, Quiagen and QIAGEN Plasmid Midi Kit, Quiagen) and relevant regions were sequenced by Microsynth Single-Tube Sequencing, economy run, following manufacturer's recommendations.
PCR products were loaded on 1% agarose gels and purified by GeneJET Gel Extraction Kit (ThermoFisher Scientific). Finally, concentration of gel extracted products were measured via NanoDrop and prepared for Microsynth Single-Tube Sequencing, economy run. See also methods 2.3.5.
Furthermore, selected plasmids as well as the genome of BLS-R-strain, clone 1 was sequenced (Microsynth).
In brief, BLS-R-strain harboring pCP20, clone 1 was cultured overnight in liquid LB broth without any antibiotic pressure at 37° C. with shaking. This strain was then grown on LB-Agar plates to obtain single colonies. Depletion of pCP20 was confirmed by picking colonies on TS-Agar with and without 100 μg/ml ampicillin and incubation at 30° C. for two days. No growth was detected on TS-Agar containing ampicillin. In parallel, colonies were picked on TS-Agar plates containing 20 μg/ml chloramphenicol to confirm chromosomal chloramphenicol resistance. A colony that fulfilled all requirements (chloramphenicol resistant, ampicillin sensitive) was taken from the LB-Agar plate and preserved (BLS-R, clone 1, ΔpCP20).
For sequencing chromosomal DNA was isolated using QIAamp DNA Mini Ki (Quiagen) following the manufacturer's instructions and then prepared according to Microsynths recommendations.
2.8 Confirmation of Strain Identity by Multiplex PCR.
JMU-SalVac-100 strain identity was confirmed by Multiplex PCR of genomic DNA according to a protocol published by Kumar et al. (2006)(Kumar et al., 2006) with slight modifications.
In brief, Multiplex PCR was performed using MyTaq HS Red Mix (Bioline, cat. BIO-25048, lot. PM348-BO82870). PCR primer see table 8.
Program:
Strain identification:
Salmonella Typhy Ty21a: 4 bands
Salmonella Typhimurium: 1 band
2.9 Bacterial Growth
Bacterial strains were plated on LB agar plates with appropriate antibiotics if required from glycerol stocks. Plates were incubated over night at 37° C. for at least 24 h. The bacteria were then transferred to TSA plates containing appropriate antibiotics and grown for another 24 h at 37° C. At the day of growth measurements, bacteria were suspended in 1 ml of TS medium and vortexed several times until the bacterial suspension was homogenous. Bacteria were then diluted 1:10 with TS medium in semi-micro cuvettes to determine the optical density (OD) at 600 nm wavelength. Subsequently bacterial solutions were diluted to yield an OD600 of 0.1/ml. Finally, 300 μl of the diluted solutions were transferred to a 48-well cell culture dish in triplicates and growth was eventually measured by the TECAN MPlex software iControl 2.0.
2.10 Detection of mRNA Expression by qPCR.
Unless otherwise stated, bacterial pellets of 1 ml mid-log culture were used for RNA isolation with the miRNeasy micro Kit (50) (Qiagen, cat. 1071023, lot 166024980) following the manufacture's protocol. Amount of RNA was measured using NanoDrop (Peglab, ND-1000).
For cDNA synthesis, the RevertAid First Strand cDNA Synthesis Kit (ThermoFisher, cat. K1622) was used. One pg RNA was added to 1 μl Random Hexamer Primer and add RNase-free water to a total volume of 12 μl. After an incubation for 5 min at 65° C., 8 μl of the following master mix was added:
The cDNA synthesis was performed by incubation for 5 min at 25° C., 60 min at 42° C. and 5 min at 70° C., and finally diluted 1:5 with RNase-free water.
5 μl of the diluted cDNA was added to 21 μl of the following master mix:
qPCR was then performed in a One step Thermo Fisher and the following program was used:
Primers used for qPCR are listed in table 12.
2.11. Method to Determine Plasmid Stability and Copy Number.
Plasmid maintenance in vitro was determined by serial passage of bacteria without any selective pressure. A “Generation 0” was generated from several strains and these bacteria were grown over 5 consecutive days in the absence of antibiotics. Each day and from each strain, at least 100 individual colonies were tested for the presence of the plasmid.
2.11.1 Production of “Generation 0”, the Starting Cultures for Plasmid Stability Testing.
Bacteria with plasmids stabilized by the BLS or antibiotic selection were plated from frozen stocks on TS-Agar or on TS-Agar supplemented with 25 μg/ml kanamycin and incubated at 37° C. overnight. The next day bacteria from each strain were transferred into 25 ml TS medium. After mixing by vortexing, the optical density OD600 (Eppendorf Biophotometer) was adjusted in TS-Medium to about 0.05 to 0.1 in a final volume of about 120 ml TS medium with or without 25 μg/ml kanamycin. The cultures were incubated aerobically in 500 ml culture media flasks DURAN®, baffled, at 37° C. under rigorous shaking (180 rpm). After reaching an OD600 of about 1.5 (mid-logarithmic phase), each culture was cooled at least for 15 min on ice to stop bacterial growth. These cultures were the starting point (Generation 0) to determine the kinetics of plasmid loss or maintenance.
2.11.2 Serial Passage and Plasmid Stability Testing and Copy Number Determination
The bacteria were transferred at 1:1000 to 1:2500 dilutions into fresh liquid medium (TS-Medium) and cultured to stationary phase (25% filling in flasks DURAN®, baffled at 37° C., 180 rpm). In the same way, bacterial cultures were passaged up to 5 times. Each day, serial dilutions of the strains harboring plasmids with kanamycin resistance gene were plated on TS agar plates without antibiotic selection and incubated at 37° C. for 18-24 h to obtain single colonies. At least 100 colonies per day and strain harboring plasmids with kanamycin resistance gene were selected randomly and grown on a fresh TS-agar plates containing 25 μg/ml kanamycin and on TS Agar without antibiotics for growth control, preserving and further testing. In case of the investigated BLS-stabilized vaccine strains cultures of day 5 were serial diluted and plated on TS agar plates. After incubation overnight at 37° C. at least 100 colonies of each strain were picked on TS agar for preserving and further testing. The presence of the BLS-stabilized plasmid (ΔKanR) in the investigated strains was monitored by PCR amplification assays using plasmid specific primers. In brief, bacterial material of each colony were transferred in 50 μl sterile water, lysed by boiling at 100° C. for 5 min, and cooled on ice. After centrifugation at 13,000 rpm for 2 min, 2 μl of the lysates were used as a template in PCR reactions using primer pairs 4/6, 6/23 and/or 68/69. Additionally, some PCR reactions were performed with primer pair 17/18 to confirm chromosomal deletion of tyrS.
For copy number determination, qPCR was performed (2.10) with the primers 62 and 63 (hlyB) for the quantification of the plasmid and primers 73 and 75 (slyB) for normalization against a single copy genomic gene.
2.11.3 Stability of Antigen Expression and Secretion
5×2 ml and 4×1 ml culture were transferred into Eppendorf tubes. After a centrifugation step of at least 1 min, 4° C., 20,817 rcf, (Eppendorf centrifuge 5174R), the supernatants were removed quantitatively and the cell pellets were stored at −20° C. until further analysis were performed (see Western blotting, qPCR, plasmid copy number determination). Unless otherwise stated, from each culture 2×47 ml were collected for preparation of extracellular proteins by TCA-precipitation of proteins from culture supernatant) (see 3.7.1 SDS-PAGE of bacterial lysates and secreted proteins).
2.12. Methods to Measure the Immune Response Elicited by JMU-SalVac-100 Strains
2.12.1 Preparation of Immunization Aliquots
Immunization aliquots of S. typhi Ty21a ΔtyrS-strains harboring one of the pSalVac Ax_By ΔKan vaccine plasmids were prepared as follows: Bacteria were cultivated in 500 ml TS-Medium (2 liter flask Duran, baffled) supplemented with 0.001% Galactose (Merck) at 37° C. with shaking until they reach mid-log phase (OD600: about 1.5, Eppendorf BioPhotometer). Subsequently, strains were cooled down on ice for 30 min and then harvested by centrifugation in a Beckmann-Coulter centrifuge, JA 10 Rotor, 4° C., 30 min, 10,000 rpm. The pellets were resuspended and washed with approximately 40 ml 1× in ice-cold 1×DPBS (Gibco): 100% Glycerin (Roth) (4:1). The bacterial suspensions were then transferred into 50 ml Greiner tubes and centrifuged for 30 min, 4° C. (Hereaus, Megafuge 1.0). Subsequently, the cell pellets were resuspended in 5 ml 1×DPBS (Gibco): 100% Glycerin (Roth) (4:1) (concentration factor: about 100-fold) and aliquoted in 500-1000 ml portions for storage at −80° C.
Immunization aliquots of S. typhimurium SL7207 strains harboring one of our pSalVac Ax_By KanR vaccine plasmids were prepared as follows: Bacteria were cultivated in 500 ml TS-Medium (2 liter flask Duran, baffled) containing appropriate antibiotics for at least 12 h at 37° C. with shaking until they reach late-log phase (OD600: about 5, Eppendorf BioPhotometer). Subsequently, strains were cooled down on ice for 30 min and then harvested by centrifugation in a Beckmann-Coulter centrifuge, JA 10 Rotor, 4° C., 30 min, 10,000 rpm. The Pellets were resuspended and washed with approximately 40 ml 1× in ice-cold 1×DPBS (Gibco): 100% Glycerin (Roth) (4:1). The bacterial suspensions were then transferred into 50 ml Greiner tubes and centrifuged for 30 min, 4° (Hereaus, Megafuge 1.0). Subsequently, the cell pellets were resuspended in 5 ml 1×DPBS (Gibco): 100% Glycerin (Roth) (4:1) (concentration factor: about 100-fold) and aliquoted in 500-1000 ml portions for storage at −80° C.
Aliquots were stored at −80° C. for at least 24 h before the CFU was determined by plating serial dilutions on BHI agar plates. The number of live colonies was determined by plating 100 μl of serial dilutions (10−6 to 10−8, each in duplicate) on TS agar plates without any antibiotic selection. Plating was performed using a sterile Drigalski-spatule. After incubation o/n at 37° C. colonies were counted. For counting, at least two agar-plates per serial dilution were counted, where the colony number is between 20 and 500 colonies. The CFU per ml per dilution series were calculated using the formula: CFU=(counts*dilution factor)×10.
2.12.2 Tolerability Study in Mice
Adult female BALB/c mice were randomly allocated to experimental groups and allowed to acclimatise for one week. The vaccine strains of Salmonella typhi and Salmonella typhimurium were prepared directly from the glycerol stocks as described (2.12.1). The adequate number of cryotubes of respective strains were thawed on ice, with each tube vortexed for 5 seconds at full speed every 30 seconds. Once fully thawed, the samples were vortexed again for 5 seconds. Immediately afterwards the adequate volumes of bacterial stocks were pipetted into a new, sterile 1.5 ml Eppendorf Safe-Lock Tube which were subsequently centrifuged at 14,000 rpm, 2 min, 4° C. Supernatants were discarded quantitatively by pipetting and pellets resuspended in an initial volume of 1×PBS by pipetting up and down at least 10 times. The exact volume of bacterial suspension was determined with the pipette and, if required, additional 1×PBS was added to achieve the desired bacterial concentration. Bacterial suspension was vortexed again at full speed for 5 seconds before being administered. For Salmonella typhi strains 30 μl of the suspension was applied intranasally per mouse (15 μl per nare). For Salmonella typhimurium, 200 μl were applied per oral per mouse. The remaining bacterial suspension was used to determine the actual dose by carrying out back plating. Serial dilutions were set up in duplicates for each of the bacterial strains.
All animals were observed for signs of ill health throughout the study. From Day 0 until the end of the experiment, animals were weighed three times each week. Animals with a bodyweight loss greater than fifteen percent (15%) of their initial (Day 0) bodyweight were culled.
2.12.3 Immunization of Mice
Intranasal Immunization with S. typhi Ty21a ΔtyrS Vaccine Strains.
The frozen immunization aliquots of S. typhi Ty21a ΔtyrS vaccine strains were thawed on ice, centrifuged, resuspended in PBS and adjusted to 1×107 CFU per 30 μl. For intranasal immunization, adult BALB/c mice were anesthetized with isoflurane. Under the magnifying lamp, 10 μl of inoculant solution containing 1×107 CFU of the S. typhi Ty21a ΔtyrS vaccine strain were applied to the nostrils of the mouse using a 20 μl pipette. To avoid aspiration of the infectious solution, the mouse was not returned to the cage until it has awakened.
Oral Immunization with S. typhimurium aroA SL7207 Vaccine Strains.
The frozen immunization aliquots of S. typhimurium aroA SL7207 vaccine strains were thawed on ice, centrifuged, resuspended in PBS and adjusted to 5×1010 CFU per 200 μl. This solution was first placed on ice and taken up into a 1 ml syringe and administered by gavage (22 G feeding needle).
At termination, bronchoalveolar lavage (BAL) and terminal blood samples were taken. Blood was processed to serum, and serum and BAL were analyzed by ELISA with antigens: Salmonella LPS (positive control), SARS-CoV-2: S-protein, N-protein.
2.12.4 ELISA
ELISA was used to detect IgM and IgG antibodies directed against the SARS-CoV 2 Spike 1 receptor binding domain (RBD) and the Nucleocapsid N Protein by ELISA kits (Alpha Diagnostic International). Samples were thawed on ice diluted with working sample solution. Immunoassays were performed according to the manufacturer's instructions and plates were analyzed on a microplate reader (TECAN MPlex) at wavelength 405 nm.
2.13.5 ELISpot
The ELISpot assay was used to determine the number of interferon-gamma (IFN-γ) secreting T cells from a given number of splenic leukocytes. The spleen cells of immunized and sham-immunized mice were restimulated with appropriate vaccine protein in vitro and thus used to demonstrate the formation of IFN-γ. This was demonstrated by a specific color reaction of the IFN-γ producing cells (spots) on a support membrane. PHA-M or PMA/Ionomycin was used as positive control for ELISpot readout, SARS-CoV-2 S-protein and N-protein as specific stimuli. Cell were left unstimulated as negative control for ELISpot readout.
3. Results
3.1 in Silico Design of Vaccine Antigens
Predictions for SARS-CoV-2 antigens and adjuvants were performed as described (2.2) and the results are shown in table 2 and table 3, respectively. Proteins (full length, partial) with an average antigenic propensity score of greater than 0.9 were considered for vaccine construction. The various fusion protein subunits were designed by adding an adjuvant and an antigenic unit connected by specific linkers to provide adequate separation. EAAAK linker (Srivastava et al., 2020) was used to join the adjuvant and the adjacent sequence to facilitates domain formation and improve the adjuvant effect. If applicable, intra HTL, CTL, and B-cell epitopes were joined using GPGPG, AAY, and KK (Kalita et al., 2020), respectively to provide adequate separation of epitopes in vivo. (
Java Codon Adaptation Tool (JCAT) (http://www.jcat.de/) (Grote et al., 2005) was used for codon optimization of the NsiI- and SalI-fragments to S. enterica Typhi (strain ATCC 700931/Ty2). The codon-optimized sequence for the CtxB adjuvant and the S-protein RBD are shown in
3.2 Generation of the Basic Vector pSalVac 001 A0_B0 KanR
For the generation of pSalVac 001 A0_B0 KanR, the plasmid pMKhly1ΔIS2 Plac-liketyrS CtxB-PSA (Gesser, 2010) was digested with NsiI (FastDigest Mph1103I, Thermo Fisher Scientific). The 1017 bp-CtxB-PSA-NsiI-Fragment was cut out and the remaining plasmid backbone pMKhly1ΔIS2 Plac-liketyrS was religated resulting in pSalVac 001 A0_B0 KanR (Table 9).
pSalVac 001 A0_B0 KanR, clone 2 was isolated from E. coli DH5 α and the correct sequence was confirmed by PCR using primer pair Nr. 4 and 6 (Table 8). DNA sequence of the entire plasmid was further analysed by sequencing (Microsynth). The map of the plasmid is shown in
3.3 Generation of Plasmids of the pSalVac Ax_By-100 Series
pSalVac 001 A0_B0 KanR provides the basis of our various antigen delivery plasmids of the pSalVac Ax_By-100 series. It is derived from pBR322 and has a pMB1 origin of replication. For selection in vitro it has a kanamycin resistance expression cassette (KanR) that is flanked by two sites of flippase recognition targets (FRT-Sites).
Functional features of the pSalVac Ax_By plasmid 100 series are two independent expression cassettes for the expression of different combinations of adjuvant-antigen-fusion proteins.
The first expression cassette, named A-Site consists of the transcription enhancer sequence hlyR, the structural genes hlyC, hlyB and hlyD and two short residual sequences of the hlyA gene separated by an NsiI-restriction site (
The second expression cassette for Adjuvant-Antigen-fusion proteins, named B-site, is integrated into the unique SalI site of pSalVac 001 A0_B0 KanR.
For the generation of the different plasmids of the pSalVac Ax_By-100 series the NsiI-fragments were cloned into the A-(NsiI)-expression site, whereas the SalI-fragments were cloned into the B-(SalI)-expression site of the pSalVac 001 A0_B0 KanR vector.
In brief, the pSalVac 001 A0_B0 KanR vector or its derivates were digested with either NsiI (FastDigest Mph1103I, ThermoFisher Scientific) or with SalI (FastDigest SalI, ThermoFisher Scientific). Successful linearization of the plasmid was confirmed by agarose gel electrophoresis. Subsequently, Thermo Scientific™ FastAP™ Thermosensitive Alkaline Phosphatase (Thermo Fisher Scientific) was added for dephosphorylation of the vector DNA to prevent recircularization during ligation.
The respective pMK or pMA-Vector carrying the synthetic NsiI-fragments, respectively SalI-fragments (Table 6) (GeneArt Gene Synthesis, ThermoFisher scientific) were also digested with NsiI (FastDigest Mph1103I, ThermoFisher Scientific), respective with SalI (FastDigest SalI, ThermoFisher Scientific). After separation by agarose (Agarose NEEO ultra-quality, Roth) gel electrophoresis the fragments were cut out and purified with QIAquick Gel Extraction Kit (Qiagen) following the manufacturer's recommendations. The purified NsiI-, respective SalI-fragments were then ligated into the NsiI-, respectively SalI-digested, AP-treated vector plasmid. For ligation, T4 DNA-Ligase from ThermoFisher Scientific was used following manufacturer's instructions.
Clones were screened by PCR using priming pairs 4/6, 4/45, 68/69 and/or 6/23 for integration and orientation of NsiI-fragments into the A-site (
3.4 Generation of the Balanced-Lethal Stabilized Vaccine Strains
In pSalVac 001/101 Ax_By KanR-plasmids, the kanamycin resistance gene is flanked by two Flippase (FLP) recognition target sites (FRT)-sites. This feature allows the excision by the site-specific enzyme FLP recombinase, which acts on the direct repeats of the FRT-sites. The FLP recombinase is encoded on the temperature-sensitive helper plasmid pCP20 and its temporal synthesis is induced by temperature. The vector that is inherited stably at temperatures of 30° C. and lower contains furthermore an ampicillin and chloramphenicol resistance gene for selection (Cherepanov et al., 1995, Datsenko et al., 2000).
For generation of the balanced-lethal stabilized vaccine strains, the flp-encoding helper plasmid pCP20 was electroporated into electrocompetent cells of S. typhi Ty21a (ΔtyrS (tyrS Cm)+, clone 120 and incubated for 2 days at 30° C. Subsequently a single clone (clone 1) was selected and used to make electrocompetent cells. This clone represents our BLS-(R)-recipient strain (Table 10).
Electrocompetent cells of BLS-R were then transformed with one of our tyrS-complementing antigen expressing plasmids of the pSalVac Ax_By KanR-100 series. After 1 h incubation at 30° C. in LB broth without antibiotic pressure, kanamycin/ampicillin/chloramphenicol triple resistant transformants were selected at 30° C. on LB agar plates containing 25 μg/ml kanamycin and 100 μg/ml ampicillin.
In contrast to the method described by Datsenko and Wanner (Datsenko et al., 2000) not only the FRT-flanking fragment in the chromosome but also the FRT-flanking kanamycin resistance gene fragment in the plasmid had to be eliminated. To assure elimination of all FRT flanked sequences we established a modified protocol for the elimination step.
In brief, BLS-intermediate strains (e.g. S. enterica serovar Typhi Ty21a ΔtyrS (tyrS Cm)+ harbouring pCP20 and one of our pSalVac 001/101 Ax_By KanR plasmids) were cultivated at 30° C. with rigorous shaking (180-200 rpm) in LB-broth containing 25 μg/ml kanamycin and 100 μg/ml ampicillin. The next day, the cultures were diluted 1:1000 into fresh LB-broth containing 100 μg/ml ampicillin to ensure selective pressure on the maintenance of the FLP helper plasmid pCP20. The diluted cultures were then subjected to temperature shifts starting with 1 h at 37° C. (flippase expression and induction), 1 min on ice and then 1 h at 30° C. (to allow replication of FLP helper plasmid pCP20). These temperature shifts were repeated 4 times resulting in an overall incubation time of about 8 h. After the last incubation step at 30° C., the cultures were grown on LB-agar plates supplemented with 100 μg/ml ampicillin to obtain single colonies. The plates were incubated at 30° C. until colonies were clearly visible. Then 4 to 10 single colonies were individually transferred to fresh LB-agar plates supplemented with 100 μg/ml ampicillin and incubated at 30° C. The same colonies were tested in parallel for the loss of the kanamycin resistance gene by growing them on TS-Agar supplemented with 25 μg/ml kanamycin and on TS-Agar-plates without any antibiotic as growth control. The TS-Agar plates were incubated over night at 37° C. Kanamycin sensitive (loss of resistance on pSalVac 001/101 Ax_By plasmid;
3.5 Characterization of the Vaccine Strains
3.5.1. Expression of Antigens
The expression of antigens was tested by SDS-PAGE and Western blotting of bacterial lysates and supernatants (see 2.5 and 2.6). All strains of the JMU-SalVac-102 to 108 expressed the adjuvant-antigen fusions of the A site (
Expression of the antigens in the A- and B-sites was also determined by qRT-PCR (method 2.10;
These results show that the bacteria of the invention can be used to achieve high antigen expression, which is expected to be advantageous for effective immunization in humans.
3.5.2. Growth Behavior of JMU-SalVac 100 Strains
Since the JMU-SalVac 100 strains produced large amounts of antigen the growth behavior was tested as described (2.9). There was no significant difference in growth behavior of the strains that produced the different antigens indicating that antigen production has no adverse effect on the Salmonella vaccine stains (
3.5.3. Stability of the JMU-SalVac 100 plasmids
The stability of JMU-SalVac 100 plasmids was tested in the absence of antibiotics selection as described (2.11). There was a clear difference between the strains harboring plasmids with antibiotic resistance genes but without BLS and those with only the BLS and without antibiotics genes (
3.5.4. Characterization of the Selected Vaccine Strains
Based on the antigen expression (3.5.1.), bacterial growth (3.5.2.), and plasmid stability studies (3.5.3.), the S. typhi Ty21a vaccine strains JMU-SalVac-101 (control), JMU-SalVac-102 and JMU-SalVac-104 as well as S. typhimurium SL7207 with the respective plasmids pSalVac 001 A0_B0 (STM-pSalVac 001 A0_B0 KanR), pSalVac 101 A1_B0 KanR (STM-pSalVac 101 A1_B0) and pSalVac 101 A1_B3 KanR (STM-pSalVac 101 A1_B3) were selected for efficacy testing in mouse models. Immunization aliquots were prepared (2.12.1) and tested for expression and secretion of antigens. All strains expressed and secreted antigens as expected (
3.6 Tolerability Study with the Vaccine Strains in Mouse Models
Following acclimatization, the animals were treated according to the schedule found below.
Salmonella
typhimurium SL7207
Salmonella
typhimurium SL7207
Salmonella
typhimurium SL7207
Salmonella
typhimurium SL7207
Following administrations of bacterial strains, animals were monitored for any signs of adverse effects for 10 days. Oral treatments with Salmonella typhimurium showed no adverse effects, with the proposed dose of 5×1010 well tolerated (
The tolerated doses reported in the present Example indicate that the vaccines of the present invention are safe in mice. Furthermore, combined oral and intranasal testing of attenuated Salmonella-based vaccines in mice is an accepted tolerability test with predictive value for the safety of such vaccines in humans (see, for instance, Reddy et al., 2021). The tolerated doses which are reported in the present application indicate that the vaccines of the invention are also safe in humans, at doses which are expected to be efficacious in humans.
3.7 Humoral and Cellular Immune Response to JMU-SalVac 100 Strains
S. Tm SL7207 pSalVac 101 A0_B0 (vector control), S. Tm SL7207 pSalVac 101 A1_B0, S. Tm SL7207 pSalVac 101 A1_B3f, and S. Tm SL7207 pSalVac 101 A1_B5f were used for peroral immunization as described in chapter 2.12.3 In addition, JMU-SalVac 101 (A0_B0), -102 (A1_B0), -104 (A1_B3f) and -106 (A1_B5f) were applied intranasally as described in 2.12.3 All the strains expressing the RBD of the S-protein elicited a significant IgG response as measured by ELISA (2.12.4). The response against the N-protein was higher against the B3f antigen compared to the B5f antigen (e.g. strains S. Tm SL7207 pSalVac 101 A1_B3f: JMU-SalVac 104).
ELISpot assays revealed increased IFN-7 responses in S- and N-protein stimulated splenocytes in mice immunized with antigen-expressing S. typhimurium and S. typhi strains, indicative of a T cell response.
In view of these results, it is expected that the vaccines of the invention will provide effective protection against the respective corona viruses in humans.
Number | Date | Country | Kind |
---|---|---|---|
20 191 142.7 | Aug 2020 | EP | regional |