Selective Vpac2 Receptor Peptide Agonists

Information

  • Patent Application
  • 20080085860
  • Publication Number
    20080085860
  • Date Filed
    August 11, 2005
    21 years ago
  • Date Published
    April 10, 2008
    18 years ago
Abstract
The present invention encompasses PEGylated peptides that selectively activate the VPAC2 receptor and are useful in the treatment of diabetes.
Description
EXAMPLE 1
Preparation of the Selective VPAC2 Receptor Peptide Agonists by Solid Phase t-Boc Chemistry

Selective VPAC2 receptor peptide agonists may be prepared using the following method and then PEGylating using one of the methods described in Examples 7, 8 and 9.


Approximately 0.5-0.6 grams (0.38-0.45 mmole) Boc Pro-MBHA resin is placed in a standard 60 mL reaction vessel. Double couplings are run on an Applied Biosystems ABI430A peptide synthesizer. The following side-chain protected amino acids (2 mmole cartridges of Boc amino acids) are obtained from Midwest Biotech (Fishers, Ind.) and are used in the synthesis:


Arg-Tosyl (TOS), Asp-δ-cyclohexyl ester(OcHx), Glu-δ-cyclohexyl ester (OcHx), His-benzyloxymethyl(BOM), Lys-2-chlorobenzyloxycarbonyl (2Cl-Z), Ser-O-benzyl ether (OBzl), Thr-O-benzyl ether (OBzl), Trp-formyl (CHO) and Tyr-2-bromobenzyloxycarbonyl (2Br-Z) and Boc Gly PAM resin. Trifluoroacetic acid (TFA), di-isopropylethylamine (DIEA), 0.5 M hydroxybenzotriazole (HOBt) in DMF and 0.5 M dicyclohexylcarbodiimide (DCC) in dichloromethane are purchased from PE-Applied Biosystems (Foster City, Calif.). Dimethylformamide (DMF-Burdick and Jackson) and dichloromethane (DCM-Mallinkrodt) is purchased from Mays Chemical Co. (Indianapolis, Ind.).


Standard double couplings are run using either symmetric anhydride or HOBt esters, both formed using DCC. At the completion of the syntheses, the N-terminal Boc group is removed and the peptidyl resins are treated with 20% piperidine in DMF to deformylate the Trp side chain if Trp is present in the sequence. For the N-terminal acylation, four-fold excess of symmetric anhydride of the corresponding acid is added onto the peptide resin. The symmetric anhydride is prepared by diisopropylcarbodiimde (DIC) activation in DCM. The reaction is allowed to proceed for 4 hours and monitored by ninhydrin test. After washing with DCM, the resins are transferred to a TEFLON reaction vessel and are dried in vacuo.


Cleavages are done by attaching the reaction vessels to a BF (hydrofluoric acid) apparatus (Penninsula Laboratories). 1 mL m-cresol per gram/resin is added and 10 mL HF (purchased from AGA, Indianapolis, Ind.) is condensed into the pre-cooled vessel. 1 mL DMS per gram resin is added when methionine is present. The reactions are stirred one hour in an ice bath. The HF is removed in vacuo. The residues are suspended in ethyl ether. The solids are filtered and are washed with ether. Each peptide is extracted into aqueous acetic acid and either is freeze dried or is loaded directly onto a reverse-phase column.


Purifications are run on a 2.2×25 cm VYDAC C18 column in buffer A (0.1% Trifluoroacteic acid in water, B: 0.1% TFA in acetonitrile). A gradient of 20% to 90% B is run on an HPLC (Waters) over 120 minutes at 10 mL/minute while monitoring the UV at 280 nm (4.0 A) and collecting one minute fractions. Appropriate fractions are combined, frozen and lyophilized. Dried products are analyzed by HPLC (0.46×15 cm METASIL AQ C18) and MALDI mass spectrometry.


EXAMPLE 2
Preparation of the Selective VPAC2 Receptor Peptide Agonists by Solid Phase FMoc Chemistry

Selective VPAC2 receptor peptide agonists may be prepared using the following method and then PEGylating using one of the methods described in Examples 7, 8 and 9.


Approximately 114 mg (50 mMole) FMOC-Rink amide resin (purchased from GlycoPep, Chicago, Ill.) is placed in each reaction vessel. The synthesis is conducted on a Rainin Symphony Peptide Synthesizer. Analogs with a C-terminal amide are prepared using 75 mg (50 μmole) Rink Amide AM resin (Rapp Polymere. Tuebingen, Germany).


The following FMOC amino acids are purchased from GlycoPep (Chicago, Ill.), and NovaBiochem (La Jolla, Calif.): Arg-2,2,4,6,7-pentamethyldihydrobenzofuran-5-sulfonyl (Pbf), Asn-trityl (Trt), Asp-β-t-Butyl ester (tBu), Glu-δ-t-butyl ester (tBu), Gln-trityl (Trt), His-trityl (Trt), Lys-t-butyloxycarbonyl (Boc), Ser-t-butyl ether (OtBu), Thr-t-butyl ether (OtBu), Trp-t-butyloxycarbonyl (Boc), Tyr-t-butyl ether (OtBu).


Solvents dimethylformamide (DMF-Burdick and Jackson), N-methylpyrrolidone (NMP-Burdick and Jackson), dichloromethane (DCM-Mallinkrodt) are purchased from Mays Chemical Co. (Indianapolis, Ind.).


Hydroxybenzotrizole (HOBt), di-isopropylcarbodiimde (DIC), di-isopropylethylamine (DEA), and piperidine (Pip) are purchased from Aldrich Chemical Co (Milwaukee, Wis.).


All amino acids are dissolved in 0.3 M in DMF. Three hour DIC/HOBt activated couplings are run after 20 minutes deprotection using 20% Piperidine/DMF. Each resin is washed with DMF after deprotections and couplings. After the last coupling and deprotection, the peptidyl resins are washed with DCM and are dried in vacuo in the reaction vessel. For the N-terminal acylation, four-fold excess of symmetric anhydride of the corresponding acid is added onto the peptide resin. The symmetric anhydride is prepared by diisopropylcarbodiimde (DIC) activation in DCM. The reaction is allowed to proceed for 4 hours and monitored by ninhydrin test. The peptide resin is then washed with DCM and dried in vacuo.


The cleavage reaction is mixed for 2 hours with a cleavage cocktail consisting of 0.2 mL thioanisole, 0.2 mL methanol, 0.4 mL triisopropylsilane, per 10 mL trifluoroacetic acid (TFA), all purchased from Aldrich Chemical Co., Milwaukee, Wis. If Cys is present in the sequence, 2% of ethanedithiol is added. The TFA filtrates are added to 40 mL ethyl ether. The precipitants are centrifuged 2 minutes at 2000 rpm. The supernatants are decanted. The pellets are resuspended in 40 mL ether, re-centrifuged, re-decanted, dried under nitrogen and then in vacuo.


0.3-0.6 mg of each product is dissolved in 1 mL 0.1% TFA/acetonitrile (ACN), with 20 μL being analyzed on HPLC [0.46×15 cm METASIL AQ C18, 1 mL/min, 45° C., 214 nM (0.2 A), A=0.1% TFA, B=0.1% TFA/50% ACN. Gradient=50% B to 90% B over 30 minutes].


Purifications are run on a 2.2×25 cm VYDAC C18 column in buffer A (0.1% trifluoroacteic acid in water, B: 0.1% TFA in acetonitrile). A gradient of 20% to 90% B is run on an HPLC (Waters) over 120 minutes at 10 mL/minute while monitoring the UV at 280 nm (4.0 A) and collecting 1 minute fractions. Appropriate fractions are combined, frozen and lyophilized. Dried products are analyzed by HPLC (0.46×15 cm METASIL AQ C18) and MALDI mass spectrometry.


EXAMPLE 3
In Vitro Potency

DiscoveRx: A CHO—S cell line stably expressing human PEGylated VPAC2 receptor in a 96-well microtiter plate is seeded with 50,000 cells/well the day before the assay. The cells are allowed to attach for 24 hours in 200 μL culture medium. On the day of the experiment, the medium is removed. Also, the cells are washed twice. The cells are incubated in assay buffer plus BMX for 15 minutes at room temperature. Afterwards, the stimuli are added and are dissolved in assay buffer. The stimuli are present for 30 minutes. Then, the assay buffer is gently removed. The cell lysis reagent of the DiscoveRx cAMP kit is added. Thereafter, the standard protocol for developing the cAMP signal as described by the manufacturer is used (DiscoveRx Inc., USA). EC50 values for cAMP generation are calculated from the raw signal or are based on absolute cAMP levels as determined by a standard curve performed on each plate. In the case of VPAC1 and PAC1 receptors, CHO—PO cells are transiently transfected with human VPAC1 or PAC1 receptor DNA using commercially available transfection reagents (Lipofectamine from Invitrogen). The cells are seeded at a density of 10,000/well in a 96-well plate and are allowed to grow for 3 days in 200 mL culture medium. At day 3, the assay described above for the PEGylated VPAC2 receptor cell line is performed.


Results for each agonist are the mean of two independent runs. VPAC1 and PAC1 results are only generated using the DiscoveRx assay. The typically tested concentrations of peptide are: 1000, 300, 100, 10, 1, 0.3, 0.1, 0.01, 0.001, 0.0001 and 0 nM.


Alpha screen: Cells are washed in the culture flask once with PBS. Then, the cells are rinsed with enzyme free dissociation buffer. The dissociated cells are removed. The cells are then spun down and washed in stimulation buffer. For each data point, 50,000 cells suspended in stimulation buffer are used. To this buffer, Alpha screen acceptor beads are added along with the stimuli. This mixture is incubated for 60 minutes. Lysis buffer and Alpha screen donor beads are added and are incubated for 60 to 120 minutes. The Alpha screen signal (indicative of intracellular cAMP levels) is read in a suitable instrument (e.g. AlphaQuest from Perkin-Elmer). Steps including Alpha screen donor and acceptor beads are performed in reduced light. The EC50 for cAMP generation is calculated from the raw signal or is based on absolute cAMP levels as determined by a standard curve performed on each plate.


Results for each agonist are, at minimum, from two analyses performed in a single run. For some agonists, the results are the mean of more than one run. The tested peptide concentrations are: 10000, 1000, 100, 10, 3, 1, 0.1, 0.01, 0.003, 0.001, 0.0001 and 0.00001 nM. The activity (EC50 (nM)) for the human PEGylated VPAC2, VPAC1, and PAC1 receptors is reported in Table 1.













TABLE 1






Human
Human
Human




VPAC2
VPAC2
VPAC1
Human PAC1



Receptor:
Receptor:
Receptor:
Receptor:


Agonist #
DiscoveRx1
Alpha Screen2
DiscoverRx1
DiscoverRx1



















VIP (SEQ
0.70
1.00
0.02
15.4


ID NO: 1)


PACAP-
0.84
2.33
0.05
0.06


27


VPAC1
179.29
n.d.
n.d.
n.d.


P1


P136
n.d.
8.68
n.d.
n.d.






1EC50 (nM); Mean of two independent runs




2EC50 (nM); Single result from two analyses performed in a single run



Mean of separate results for the given assay


n.d. = not determined






EXAMPLE 4
Selectivity

Binding assays: Membrane prepared from a stable VPAC2 cell line (see Example 3) or from cells transiently transfected with human VPAC1 or PAC1 are used. A filter binding assay is performed using 125I-labeled VIP for VPAC1 and VPAC2 and 125I-labeled PACAP-27 for PAC1 as the tracers.


For this assay, the solutions and equipment include:


Presoak solution: 0.5% Polyethyleneamine in Aqua dest.


Buffer for flushing filter plates: 25 mM HEPES pH 7.4


Blocking buffer: 25 mM HEPES pH 7.4; 0.2% protease free BSA


Assay buffer: 25 mM HEPES pH 7.4; 0.5% protease free BSA


Dilution and assay plate: PS-Microplate, U form


Filtration Plate Multiscreen FB Opaque Plate; 1.0 μM Type B Glasfiber filter


In order to prepare the filter plates, the presoak solution is aspirated by vacuum filtration. The plates are flushed twice with 200 μL flush buffer. 200 μL blocking buffer is added to the filter plate. The filter plate is then incubated with 200 μL presoak solution for 1 hour at room temperature.


The assay plate is filled with 25 μL assay buffer, 25 μL membranes (2.5 μg) suspended in assay buffer, 25 μL compound (agonist) in assay buffer, and 25 μL tracer (about 40000 cpm) in assay buffer. The filled plate is incubated for 1 hour with shaking.


The transfer from assay plate to filter plate is conducted. The blocking buffer is aspirated by vacuum filtration and washed two times with flush buffer. 90 μL is transferred from the assay plate to the filter plate. The 90 μL transferred from assay plate is aspirated and washed three times with 200 μL flush buffer. The plastic support is removed. It is dried for 1 hour at 60° C. 30 μL Microscint is added. The count is performed.


The selectivity (IC50) for human PEGylated VPAC2, VPAC1, and PAC1 is reported in Table 2.












TABLE 2






Human VPAC2
Human VPAC1
Human PAC1


Agonist #
Receptor Binding
Receptor Binding
Receptor Binding


















VIP (SEQ ID
5.06
3.28
>25000


NO: 1)


PACAP-27
2.76
3.63
9.1


P136
0.90
617.41
2257.3









Values given are the result of a single or the mean of two or more experiments









TABLE 3







In vitro potency using DiscoveRx (see Example 3).


CHO-PO cells are transiently transfected with rat VPAC1


or VPAC2 receptor DNA. The activity (EC50 (nm)) for


these receptors is reported in the table below.












Rat VPAC 2 Receptor
Rat VPAC 1 Receptor



Agonist #
DiscoveRx
DiscoveRx















VIP
0.79
0.02



PACAP-27
n.d.
0.07



P136
n.d.
15.00










EXAMPLE 5
In Vivo Assay

Glucose lowering in diabetic ZDF rats. ZDF rats, 8-9 weeks old with fed glucose levels of approximately 300 mg/dl are used for this experiment. The animals are randomised into control (vehicle) and treatment group(s) on the day of the experiment and are conscious throughout the experiment. The compound is injected intravenously at the start of the experiment and blood samples are drawn from the tail vein immediately prior to compound injection and then 0.5, 1, 2, 3, 4 and 24 h after compound injection. The animals are deprived of food during the first 2 or 4 h of the experiment. The blood samples are collected in EDTA tubes, aprotinin added and immediately put on ice pending insulin and glucose analysis using standard methods.









TABLE 4







Glucose lowering in conscious food-deprived ZDF rats









Time after


P136
injection















(μg/kg)
Analyte
0 h
0.5 h
1 h
2 h
3 h
4 h
24 h


















Vehicle
glucose
298
n.d.
332
253
219
215
366



(mg/dl)


Vehicle
insulin
17.1
n.d.
13.0
10.5
9.3
10.6
10.3



(ng/ml)


100
glucose
347
n.d.
333
280
212
207
400



(mg/dl)


100
insulin
19.1
n.d.
21.3
18.0
16.0
16.1
9.3



(ng/ml)





Animals are given access to food after the 4 h timepoint






EXAMPLE 6
Rat Serum Stability Studies

In order to determine the stability of PEGylated VPAC2 receptor peptide agonists in rat serum, obtain CHO-VPAC2 cells clone #6 (96 well plates/50,000 cells/well and 1 day culture), PBS 1× (Gibco), the peptides for the analysis in a 100 μM stock solution, rat serum from a sacrificed normal Wistar rat, aprotinin, and a DiscoveRx assay kit. The rat serum is stored at 4° C. until use and is used within two weeks.


On Day 0, two 100 μL aliquots of 10 μM peptide in rat serum are prepared by adding 10 μL peptide stock to 90 μL rat serum for each aliquot. 250 kIU aprotinin/mL is added to one of these aliquots. The aliquot is stored with aprotinin at 4° C. The aliquot is stored without aprotinin at 37° C. The aliquots are incubated for 18 hours.


On Day 3, after incubation of the aliquots prepared on day 0 for 72 hours, an incubation buffer containing PBS+1.3 mM CaCl2, 1.2 mM MgCl2, 2 mM glucose, and 0.25 mM IBMX is prepared. A plate with 11 serial 5× dilutions of peptide for the 4° C. and 37° C. aliquot is prepared for each peptide studied. 2000 nM is used as the maximal concentration if the peptide has an EC50 above 1 nM and 1000 nM as maximal concentration if the peptide has an EC50 below 1 nM from the primary screen (see Example 3). The plate(s) are washed with cells twice in incubation buffer. The plates are allowed to hold 50 μL incubation media per well for 15 minutes. 50 μL solution per well is transferred to the cells from the plate prepared with 11 serial 5× dilutions of peptide for the 4° C. and 37° C. aliquot for each peptide studied, using the maximal concentrations that are indicated by the primary screen, in duplicate. This step dilutes the peptide concentration by a factor of two. The cells are incubated at room temperature for 30 minutes. The supernatant is removed. 40 μL/well of the DiscoveRx antibody/extraction buffer is added. The cells are incubated on shaker (300 rpm) for 1 hour. Normal procedure with the DiscoveRx kit is followed. cAMP standards are included in column 12. EC50 values are determined from the cAMP assay data. The remaining amount of active peptide is estimated by the formula EC50, 4C/EC50, 37C for each condition.












TABLE 5








Rat Serum Stability



Peptide
(Estimated purity in % after 72 hours)









P136
34.4










EXAMPLE 7
PEGylation of Selective VPAC2 Receptor Peptide Agonist Using Thiol-Based Chemistry

Usually a thiol function is introduced into or onto a selective VPAC2 receptor peptide agonist by adding a cysteine or a homocysteine or a thiol-containing moiety at either or both termini or by inserting a cysteine or a homocysteine or a thiol-containing moiety into the sequence. Thiol-containing VPAC2 receptor peptide agonists are reacted with 40 kDa polyethylene glycol-maleimide (PEG-maleimide) to produce derivatives with PEG covalently attached via a thioether bond.


PEGylation reactions are run under conditions that permit the formation of a thioether bond. Specifically, the pH of the solution ranges from about 4 to 9 and the thiol containing peptide concentrations range from 1 to 10 molar excess of PEG-maleimide. A PEG-maleimide which may be used is methoxy-PEG2-MAL-40K, a bifurcated PEG maleimide (Lot # PT-06D-01, Nektar, Huntsville, Ala.). The PEGylation reactions are normally run at room temperature for 10 minutes to 40 hours. The PEGylated VPAC2 receptor peptide agonist is then isolated using reverse-phase HPLC or size exclusion chromatography (SEC). PEGylated peptide analogues are characterized using analytical RP-HPLC, HPLC-SEC, SDS-PAGE, and/or MALDI Mass Spectrometry.


EXAMPLE 8
PEGylation via Acylation on the Sidechain of Lysine

In order to achieve site-specific PEGylation of selective VPAC2 receptor peptide agonists, all the Lys residues are changed into Arg residues except for the Lys residues where PEGylation is intended. A PEG molecule which may be used is mPEG-SBA-20K (Nektar, Lot #: PT-04E-11). The PEGylation reaction us preferably performed at room temperature for 2-3 hours. The protein is purified by preparative HPLC.


EXAMPLE 9
PEGylation via Pictet-Spengler Reaction

For PEGylation via Pictet-Spengler reaction to occur, a Trp residue with its free amine is needed to incorporate the PEG molecule onto the selective VPAC2 receptor peptide agonist. One approach to achieve this is to add a Lys residue onto the C-terminus of the peptide and then to couple a Trp residue onto the sidechain of Lys. The extensive SAR indicates that this modification does not change the properties of the parent peptide in terms of its in vitro potency and selectivity.


PEG with a functional aldehyde, for example mPEG2-ALD-40K (Nektar, Lot #: PT-6C-05), is used for the reaction. The site specific PEGylation involves the formation a tetracarboline ring between PEG and the peptide. PEGylation is conducted in glacial acetic acid at room temperature for 1 to 48 hours. A 1 to 10 molar excess of the PEG aldehyde is used in the reaction. After the removal of acetic acid, the PEGylated VPAC2 receptor peptide agonist is isolated by preparative RP-HPLC.


For the PEGylation of P118, CH3—(CH2)4—CO—HSDAVFTDNYTRLRKQVAAKKYLQSIKNSRTSPPPK(W)-NH2, (3.5 mg, 0.8 umol), 54 mg of mPEG2-ALD-40K (Nektar, Lot #: PT-6C-05) and 1 ml of glacial acetic acid are used. The P118 and the mPEG2-ALD-40K are dissolved in the acetic acid. The reaction is allowed to proceed for 18 hours. 40 mg of the PEGylated peptide (VPAC2-P136) is isolated by preparative RP-HPLC, characterised by SE-HPLC and tested for in-vitro activity.


Other modifications of the present invention will be apparent to those skilled in the art without departing from the scope of the invention.

Claims
  • 1-48. (canceled)
  • 49. A PEGylated VPAC2 receptor peptide agonist, comprising the amino acid sequence:
  • 50. The PEGylated VPAC2 receptor peptide agonist according to claim 49, wherein said C-terminal extension is an amino acid sequence selected from the group consisting of SRTSPPP (SEQ ID NO: 9), SRTSPPP-NH2 (SEQ ID NO: 10), SRTSPPPK(W) (SEQ ID NO: 23), SRTSPPPK(W)-NH2 (SEQ ID NO: 24), SRTSPPPC (SEQ ID NO: 25), and SRTSPPPC-NH2 (SEQ ID NO: 26).
  • 51. The PEGylated VPAC2 receptor peptide agonist according to claim 49, wherein said PEG molecule is branched.
  • 52. The PEGylated VPAC2 receptor peptide agonist according to claim 49, wherein said PEG molecule is linear.
  • 53. The PEGylated VPAC2 receptor peptide agonist according to claim 49, wherein said PEG molecule is 20,000, 40,000, or 60,000 daltons in molecular weight.
  • 54. The PEGylated VPAC2 receptor peptide agonist according to claim 49, wherein two PEG molecules are present, and each of said PEG molecules is 20,000 daltons in molecular weight.
  • 55. The PEGylated VPAC2 receptor peptide agonist according to claim 49, further comprising an N-terminal modification, wherein said N-terminal modification is the addition of a group selected from the group consisting of acetyl, hexanoyl, propionyl, 3-phenylpropionyl, and benzoyl.
  • 56. The PEGylated VPAC2 receptor peptide agonist according to claim 49, comprising the amino acid sequence:
  • 57. (canceled)
  • 58. A method of treating non-insulin-dependent diabetes or insulin-dependent diabetes in a mammal in need thereof, comprising administering to said mammal an effective amount of a PEGylated VPAC2 receptor peptide agonist according to claim 49.
  • 59. The method of claim 58, wherein said mammal is a human.
PCT Information
Filing Document Filing Date Country Kind 371c Date
PCT/US05/28531 8/11/2005 WO 00 2/19/2007
Provisional Applications (2)
Number Date Country
60602461 Aug 2004 US
60602350 Aug 2004 US