This invention relates to the diversification of nucleic acid sequences by use of a nucleic acid molecule containing a region of sequence that acts as a template for diversification. The invention thus provides nucleic acid molecules to be diversified, those which act as the template region (TR) for directional, site-specific diversification and for encoding necessary enzymes, and methods of preparing, as well as using them.
Bordetella bacteriophages generate diversity in a gene that specifies host tropism for the host bacterium. This adaptation is produced by a genetic element that combines transcription, reverse transcription and integration with site-directed, adenine-specific mutagenesis. Necessary to this process is a reverse transcriptase-mediated exchange of information between two regions, one serving as a donor template region (TR) and the other as a recipient of variable sequence information, the variable region (VR).
Bordetella species that cause respiratory infections in mammals, including humans, serve as hosts for a family of bacteriophages that encode a diversity-generating system which allows the bacteriophage to use different receptor molecules on the bacteria for attachment and subsequent infection (Liu, M. et al. Reverse transcriptase-mediated tropism switching in Bordetella bacteriophage. Science 295, 2091-2094 (2002) and Liu, M. et al. Genomic and genetic analysis of Bordetella bacteriophages encoding reverse transcriptase-mediated tropism-switching cassettes. J. Bacteriol. 186, 1503-17 (2004)). The Bordetella cell surface is highly variable as a result of a complex program of gene expression mediated by the BvgAS phosphorelay, which regulates the organism's infectious cycle (Ackerley, B. J., Cotter P. A., & Miller, J. F. Ectopic expression of the flagellar regulon alters development of the Bordetella-host interaction. Cell 80, 611-620 (1995); Uhl, M. A. & Miller, J. F. Integration of multiple domains in a two-component sensor protein: the Bordetella pertussis BvgAS phosphorelay. EMBO J. 15, 1028-1036 (1996); Cotter, P. A. & Miller, J. F. Bordetella. In Principles of Bacterial Pathogenesis. E. Groisman, Ed. Academic Press, San Diego, Calif. pp. 619-674 (2000); and Mattoo, S., Foreman-Wykert, A. K., Cotter, P. A., Miller, J. F. Mechanisms of Bordetella pathogenesis. Front Biosci 6, E168-E186 (2001)).
Bacteriophage (“phage”) BPP-1 preferentially infects virulent, Bvg+ Bordetella bacteria due to differential expression of phage receptor, pertactin (Prn), on the bacterial outer membrane (see
Citation of the above documents is not intended as an admission that any of the foregoing is pertinent prior art. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicant and does not constitute any admission as to the correctness of the dates or contents of these documents.
The invention is based in part on the discovery that the agile tropism switching, that is switching the ability to infect specific bacteria, in Bordetella bacteriophages is mediated by a variability-generating cassette encoded in the phage genome (see
Thus in a first aspect, the invention provides for a nucleic acid molecule comprising a variable region (VR) which is operably linked to a template region (TR) wherein said TR is a template sequence that directs site-specific mutagenesis of said VR. The nucleic acid molecule may be recombinant, in the sense that it comprises nucleic acid sequences that are not found together in nature, such as sequences that are synthetic (non-naturally occurring) and/or brought together by use of molecular biology and genetic engineering techniques from heterologous sources. Alternatively, the nucleic acid molecule may be isolated, in the sense that it comprises naturally occurring sequences isolated from the surrounding biological factors or sequences with which they are found in nature.
An operable linkage between the VR and TR regions of a nucleic acid molecule of the invention refers to the ability of the TR to serve as the template for directional, site-specific mutagenesis or diversification of the sequence in the VR. Thus in one possible embodiment of the invention, a recombinant nucleic acid molecule may comprise a donor template region (TR) and a variable region (VR) that are physically attached in cis such that the TR serves as the template sequence to direct site-specific mutagenesis in the VR. The separation between the TR and VR regions may be of any distance so long as they remain operably linked. In another embodiment, the TR and VR may not be linked in cis, but the TR retains the ability to direct site specific mutagenesis of the VR. Thus the TR and VR regions may be operably linked in trans, such that the sequences of each region are present on separate nucleic acid molecules.
The invention thus also provides for a pair of nucleic acid molecules wherein a first molecule of the pair comprises a VR which is operably linked to a TR on a second molecule of the pair. As provided by the invention, the TR is a template sequence that directs site-specific mutagenesis of said VR. The nucleic acid molecules are optionally recombinant, in the sense that they may comprise nucleic acid sequences that are not found together in nature, such as sequences that are brought together by use of molecular biology and genetic engineering techniques from heterologous sources. Of course, sequences that are brought together may be synthetic (non-naturally occurring) sequences or those that are from naturally occurring sequences but isolated from the surrounding biological factors or sequences with which they are found in nature.
In embodiments of the invention wherein the VR and TR are in trans, the TR is operably linked to sequences encoding a reverse transcriptase (RT) activity as described below. As such, the VR and reverse transcriptase encoding sequence(s) are also present in trans to each other. In some embodiments, the TR and RT activity coding sequence are in cis to each other, optionally with the TR and RT coding sequence originating from the same organism. In other embodiments, the TR and RT coding sequence may be in trans to each other while remaining operably linked so that the TR still directs RT mediated changes in the operably linked VR. Of course, the TR and/or RT coding sequence may be altered as described below relative to the naturally occurring TR in the organism. Alternatively, the TR and RT coding sequence may be heterologous to each other in that they originate from, or are isolated from, different organisms, or one or the other or both are synthetic (non-naturally occurring) or synthesized (rather than isolated). Synthetic sequences include those which are derived from naturally occurring sequences.
The invention is also based in part on the discovery that sites of variability in the VR of Bordetella bacteriophages correspond to adenine residues in the generally homologous template region, TR, which itself is invariant and essential for tropism switching. The invention is also based in part on the discovery that (translationally) silent (or “synonymous”) substitutions in TR are transmitted to VR during switching, with TR supplying the raw sequence information for variability.
Thus the recombinant nucleic acid molecules of the invention include initial molecules wherein the TR region is identical to the VR, such that the adenine residues present in the TR will result in the mutagenesis or diversification of the corresponding positions in the VR sequence. Stated differently, the invention provides a recombinant nucleic acid molecule wherein the sequence of said TR is a perfect direct repeat of the sequence in said VR such that upon diversification of the VR region, one or more adenine residues in the VR, also found in the TR, will be mutated to another nucleotide, that is cytosine, thymine or guanine, without change in the TR sequence.
Alternatively, the invention provides recombinant nucleic acid molecules wherein the TR and VR regions are not identical such that as the TR region directs diversification of the VR. Such diversification may include the mutagenesis of nucleotide residues in the VR based upon the presence of corresponding adenine residues in the TR.
Without being bound by theory, and offered to improve the understanding of the invention, this ability is shown herein to be mediated by an RNA intermediate generated by a reverse transcription based mechanism in which a TR RNA transcript serves as a template for reverse transcription during which the nucleotides incorporated opposite the adenine residues of the TR RNA transcript are randomized in the resulting single-stranded cDNA. The TR-derived, mutagenized cDNA sequence is then used to replace all or part of the VR in a process termed “mutagenic homing.” Support for this mechanism is provided by the discovery that in Bordetella bacteriophages, the brt locus, which encodes a reverse transcriptase (RT), is essential for the generation of diversity. Additional support is provided by the discovery that mutagenesis occurs exclusively at sites occupied by adenines in the TR. Artificial substitution of an adenine in the TR with another nucleotide subsequently abolishes variation at that corresponding position in the VR, while introduction of an ectopic adenine subsequently produces a novel site of heterogeneity in the VR.
Thus in a further aspect, the invention provides for the diversification of VR sequences via the presence of adenine residues in the TR operably linked to the VR. The invention provides for a nucleic acid molecule wherein the TR region contains one or more adenine residues not found in the VR, such that the adenine residues present in the TR will result in the mutagenesis or diversification of the corresponding positions in the VR sequence. Stated differently, the invention provides a recombinant nucleic acid molecule wherein the sequence of said TR is an imperfect direct repeat of the sequence in said VR due to the substitution of one or more adenine residues for one or more non-adenine residues in said VR. This may be referred to as adenine-mediated diversification.
Alternatively, as compared to the VR, the TR contains one or more insertions of adenine, optionally with the insertion of additional nucleotides to maintain the correct reading frame. As a non-limiting example, groups of three nucleotides (including one or more adenines) may be inserted in-frame into the TR in order to direct the insertion of a variable codon into the VR.
In other embodiments, the invention provides for the diversification of VR sequences via the alternation of other of nucleotide residues in the TR operably linked to the VR. As a non-limiting example, the invention provides a TR that contains a deletion of one or more codons is used to direct the deletion of corresponding codons from the operably linked VR. As another example, the TR contains an insertion of one or more codons to direct the insertion of the inserted codon(s) into the operably linked VR. The TRs of the invention also include those where the TR contains a deletion or insertion of one or more nucleotides, relative to the operably linked VR, to alter the reading frame of the VR. The deletion or insertion of nucleotides in a TR to direct deletions or insertions in an operably linked VR may be used simultaneously, such as where one portion of the TR is used to direct deletion of nucleotides while another portion of the TR is used to direct insertion of nucleotides. This may be referred to as deletion/insertion mediated diversification.
In yet additional embodiments, the invention provides for diversification based upon non-adenine substitutions of residues in the TR. Thus a nucleotide in the TR may be substituted with a non-adenine residue such that the substitution is transferred to the corresponding position in the operably linked VR. As a non-limiting example, a cytosine (C) to guanine (G) substitution in a TR can be used to result in the same C to G substitution in the operably linked VR. This may be referred to as substitution-mediated diversification.
The invention also provides for the use of adenine-mediated, deletion/insertion mediated, and/or substitution-mediated diversification in any combination to alter the sequence of a VR.
In some nucleic acid molecules of the invention, an RT encoding region, and/or an atd region (or bbp7 region), in the vicinity of the 5′ end of a TR may also be present. These regions may be present in cis relative to the TR region. Thus in embodiments of the invention wherein the VR and TR are in trans to each other, the atd region may be in trans relative to the VR. In other embodiments, the atd region is absent or substituted by a functionally analogous region of sequence, such as a promoter sequence that regulates or directs the expression of the TR region and operably linked RT encoding sequence.
As explained above, one property of the diversity-generating system of the invention is the directional transfer of sequence information which accompanies mutagenesis. Thus one TR is able to direct sequence changes in one or more operably linked VRs. Although a VR is highly variable, the operably linked TR is maintained as an uncorrupted source of sequence information including the information to retain the basic structural integrity of the VR encoded protein molecule. The invention is further based on the identification of a nucleic acid sequence designated IMH (initiation of mutagenic homing), which functions in determining the direction of the TR to VR transfer of sequence information.
In some embodiments of the invention, the IMH sequences are those located at the 3′ end of each region in Bordetella bacteriophages and which comprise a 14 bp segment consisting of G and C residues followed by a 21 bp sequence. The IMH sequences at the 3′ end of the VR differ at 5 positions from the sequences in the corresponding TR region (see
These observations demonstrate that the sequence designated as IMH helps determine the direction of transfer of sequence information from the TR to the VR. They also support the use of the corresponding TR IMH-like sequence at the 3′ end of the TR to prevent corruption of TR while the IMH directs variability to VR. Furthermore, deletion analysis indicated that in VR, the 5′ boundary of information transfer is established by the extent of homology between VR and TR.
The recombinant nucleic acid molecules of the invention may thus contain an IMH sequence located at the 3′ end of the VR and an IMH-like sequence at the end of the TR, Alternatively, the molecules may contain an IMH sequence at the end of both the VR and the TR such that the sequence of the TR may also vary to result in a “super-diversity” generating system.
In embodiments of the invention wherein a sequence of interest (or “desired VR”) to be diversified is not operably linked to the necessary TR region, an IMH sequence can be operably located at the 3′ of the desired VR followed by operable linkage to an appropriate TR with its IMH-like 3′-region. A non-limiting example of such a system is seen in the case of a desired VR which is all or part of a genomic sequence of a cell wherein insertion of an appropriate IMH and introduction of a TR containing construct with the appropriate corresponding IMH-like region, optionally with a cis linked RT coding sequence, is used to diversify the desired VR. The TR may simply be a direct repeat of the desired VR sequence to be diversified or mutagenized via the adenines present in the TR. Alternatively, the TR may contain ectopic adenines, deletions/insertions, and/or substitutions at positions corresponding to those specific sites of VR where diversity is desired. The length of homology between TR and VR can be used to functionally define the desired VR to be diversified.
The desired VR of the invention may be any nucleic acid sequence of interest for mutagenesis or diversification by use of the instant invention. In some embodiments, the sequence is all or part of a sequence encoding a binding partner of a target molecule. Target molecules may be any cellular factor or portion thereof which is of interest to a skilled person practicing the invention. Non-limiting examples include polypeptides, cell surface molecules, carbohydrates, lipids, hormones, growth or differentiation factors, cellular receptors, a ligand of a receptor, bacterial proteins or surface components, cell wall molecules, viral particles, immunity or immune tolerance factors, MHC molecules (such as Class I or II), tumor antigens found in or on tumor cells, and others as desired by a skilled practitioner and/or described herein. The binding partner (encoded at least in part by the desired VR) may be any polypeptide which, upon expression, binds to the target molecule, such as under physiological conditions or laboratory (in vivo, in vitro, or in culture) conditions.
In some embodiments of the invention, the binding partner is a bacteriocin (including a vibriocin, pyocin, or colicin), a bacteriophage protein (including a tail component that determines host specificity), capsid or surface membrane component (including those that determine physiologic, pharmacologic, or pharmaceutical properties), a ligand for a cell surface factor or an identified drug or diagnostic target molecule, or other molecules as desired and/or described herein.
Any portion, or all, of the coding region for a binding partner can be used as the desired VR. In some embodiments of the invention, however, the desired VR is the 3′ portion of said sequence encoding said binding partner. The 3′ portion of a coding sequence ends at the last codon. In other embodiments of the invention, the desired VR is located within about 50, about 100, about 150, about 200, about 250, about 300, or about 350 or more codons of the last codon in a coding sequence to be diversified. Stated differently, the desired VR may contain about 20, about 50, about 100, about 150, about 200, about 250, about 300, about 400, about 450, about 500, about 550, about 600, about 650, about 700, about 750, about 800, about 900, about 950, about 1000, about 1500, about 2000, about 2500, or about 3000 or more nucleotides from the last nucleotide of the coding region. In some embodiments, the IMH is not part of the translated portion of the VR, and as such may optionally be in an intron. Stated differently, some embodiments of the invention provide for an IMH which is transcribed, but not translated, or not transcribed or translated, while the VR and the larger sequence containing the VR may be transcribed and translated and encode a polypeptide.
In additional embodiments, the binding partner may be part of a fusion protein such that it is produced as a chimeric protein comprising another polypeptide. The other polypeptide member of the fusion protein may be heterologous to the binding partner. Alternatively, it may be another portion of the same binding partner such that the fusion protein is a recombinant molecule not found in nature.
In other embodiments, the desired VR for site specific mutagenesis is a non-translated, and optionally non-transcribed, regulatory region. The invention may be utilized to diversify such regulatory sequences to modify their function. In the case of 5′ regulatory elements, as a non-limiting example, the invention may be used to derive regulatory regions that direct expression more strongly (e.g. a stronger promoter) or less strongly (e.g. a weaker promoter). Alternatively, the regulatory regions may be diversified to increase or decrease their sensitivity to regulation (e.g. more tightly or less tightly regulated). In the case of 3′ regulatory elements, the invention may be used to derive regions that increase or decrease the stability of expressed RNA molecules. Other regulatory sequences may be similarly diversified.
As described above, the invention also provides for isolated nucleic acid molecules derived from naturally occurring sequences. Such an isolated nucleic acid molecule may be described as comprising a donor template region (TR) and a variable region (VR) wherein said TR is a template sequence operably linked to said VR to direct site specific mutagenesis of said VR. These isolated nucleic acid molecules may comprise the coding sequence containing the VR and TR as well as other components necessary to direct site specific mutagenesis of the VR in a heterologous system. Non-limiting examples of additional sequences from naturally occurring sequences are those that encode an RT activity and those that function as an IMH, to provide directionality to the transfer of sequence information from a TR to a VR, or an IMH-like sequence to prevent or reduce the frequency of changes in the TR sequence. Molecules containing these VR and TR regions with these other components are termed diversity generating retroelements (DGRs) of the invention.
These isolated nucleic acid molecules may also serve as a source of additional IMH sequences, RT coding regions, and atd regions for use in the practice of the instant invention. Non-limiting examples of isolated nucleic acid molecules include those shown in
In some embodiments, the invention provides an isolated nucleic acid molecule comprising a donor template region (TR) and an operably linked RT coding sequence. Such a molecule is preferably not from Bvg+ tropic phage-1 (BPP-1), Bvg− tropic phage-1 (BMP-1), or Bvg indiscriminate phage-1 (BIP-1) bacteriophage. The isolated molecule may be from a bacteriophage, a prophage of a bacterium, a bacterium, or a spirochete.
Of course, cells comprising the nucleic acid molecules of the invention are also provided. Such cells may be prokaryotic or eukaryotic, and are capable of supporting site-specific mutagenesis as described herein. Cells that are not capable of supporting such mutagenesis may still be used to replicate nucleic acid molecules of the invention or to generate their encoded protein molecules for subsequent use. In the case of eukaryotic cells, the nucleic acids of the invention may be modified for their use in a eukaryotic environment. These modifications include the use of promoter sequences recognized by a eukaryotic RNA polymerase; the introduction of intron sequences in the TR-brt to facilitate export of RNA transcripts from nucleus to cytoplasm for translation of the brt, and the presence of a nuclear localization signal (NLS) coding sequence as part of the RT coding sequence such that the RT polypeptide contains a NLS to direct its transport to, and/or retention in, the eukaryotic nucleus. In some embodiments, the NLS is located at the N or C terminus of the RT polypeptide.
In an additional aspect, the invention provides a method of site-specific mutagenesis of a nucleic acid sequence of interest present as a VR of the invention. Such a method would comprise the use of a nucleic acid molecule as described herein wherein the VR comprises said nucleic acid sequence of interest and the TR is a direct repeat of the VR or the sequence of interest. Thus, mutagenesis will be limited to the adenine residues present in the TR. Alternatively, a non-identical TR, such as a repeat of the VR or the sequence of interest containing ectopic adenine residues, insertions, deletions, or substitutions may be used. The method would further include the expression of such nucleic molecules in a cell such that one or more nucleotide positions of the VR or sequence of interest is substituted by a different residue.
Such methods of the invention may be performed to allow more than one nucleotide position of the VR or the sequence of interest to be substituted. As noted above, the VR or sequence of interest may encode all or part (such as the 3′ portion) of a binding partner of a target molecule. These methods of the invention may, of course, be used to alter the binding properties of a binding partner such that its interaction with a target molecule will be changed. Non-limiting examples of such alternations include changing the specificity or binding affinity of a binding partner. The methods may be used to modify a particular binding partner such that it will bind a different target molecule. A non-limiting example of this aspect of the invention is the modification of a phage tropism determinant such that it will bind a heterologous bacterial surface component of interest. A bacteriophage that is made to express such a derivative would thus be infectious for a heterologous bacterium. This may be advantageously used as a means of creating phage or phage parts capable of binding to, infecting and/or killing (e.g. via lysis or dissipation of membrane potential) a particular strain of bacteria not normally affected by phage expressing the progenitor tropism determinant. The invention may also be used as a means of broadening or expanding the bacteriophage host range, or the binding range of a part or parts thereof, to include target molecules, species, or strains not commonly bound or infected by the parent phage or any phage. Another non-limiting example is modification of a sequence to restore or alter a binding or enzymatic activity, such as restoration of a phosphotransferase activity.
As described herein, site-specific mutagenesis of a known bacteriophage protein also may be practiced by the use of an isolated nucleic acid molecule containing a naturally occurring combination of VR and TR as described herein. Non-limiting examples of such molecules include those from Vibrio harveyi ML phage, Bifidobacterium longum, Bacteroides thetaiotaonicron, Treponema denticola, or a DGR from cyanobacteria. Non-limiting examples of such cyan bacteria include Trichodesmium erythraeum #1, Trichodesmium erythraeum #2, Nostoc PPC ssp. 7120 #1, Nostoc PPC ssp. 7120 #2, or Nostoc punctiforme.
In a further aspect, the invention provides a method of preparing a recombinant nucleic acid molecule as described herein by operably linking a first nucleic acid molecule comprising said VR to a second nucleic acid molecule comprising said TR such that said TR acts as a template sequence that directs site-specific mutagenesis of said VR. In the case of a linkage in cis between the VR and the TR, the first and second nucleic acid molecules would be covalently ligated together in a operative fashion as described herein. In the case of a linkage in trans, the first and second nucleic acid molecules would be placed in the same cellular environment or an in vitro reaction mix for site-specific mutagenesis in an operative fashion.
In yet another aspect, the invention provides a method of identifying additional RT coding sequences, IMH and IMH-like sequences, and corresponding TR and VR sequences. The method is based upon use of identified binding motifs of the RT activity of the invention to identify additional RT coding sequences in other organisms. The region near a putative additional RT coding sequence is then searched for nearby IMH type sequences which 1) are linked to putative TR sequences or 2) used to find VR linked IMH sequences.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein the sequence of said TR is an imperfect direct repeat of the sequence in said VR due to the substitution of one or more adenine nucleotides in said TR, or substitution of one or more non-adenine nucleotides in VR by adenines in TR, or substitution of VR adenine nucleotides by non-adenine nucleotides in TR.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said VR is all or part of a sequence encoding a binding partner of a target molecule.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said VR is all or part of a sequence encoding a binding partner of a target molecule, further comprising all of the sequence encoding said binding partner, wherein said VR is optionally the 3′ portion of said sequence encoding said binding partner.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said VR is all or part of a sequence encoding a binding partner of a target molecule, wherein said binding partner binds a cell surface molecule, a hormone, a growth or differentiation factor, a receptor, a ligand of a receptor, a bacterial cell wall molecule, a viral particle, an immunity or immune tolerance factor, or an MHC molecule.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said VR is all or part of a sequence encoding a binding partner of a target molecule, wherein said binding partner is a bacteriocin.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said TR and RT coding sequence are transcribed under the control of a heterologous promoter.
In another aspect the invention provides a cell containing a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other.
In another aspect the invention provides a method of preparing a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, said method comprising operably linking a first nucleic acid molecule comprising said VR to a second nucleic acid molecule comprising said TR such that said TR is a template sequence that directs site specific mutagenesis of said VR.
In another aspect the invention provides a method of preparing a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said TR and RT coding sequence are transcribed under the control of a heterologous promoter, said method comprising operably linking a heterologous promoter sequence to a nucleic acid molecule comprising said TR and RT coding sequence.
In another aspect the invention provides a method of site-specific mutagenesis of a nucleic acid sequence of interest, said method comprising: obtaining a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said VR comprises said nucleic acid sequence of interest and said TR is an imperfect or perfect repeat of said sequence of interest, wherein said TR is a template sequence operably linked to said sequence of interest to direct site-specific mutagenesis of the sequence, and wherein said TR is an imperfect repeat due to the substitution of one or more adenine nucleotide for a non-adenine nucleotide in said sequence of interest or visa versa; and allowing said nucleic acid molecule to be expressed in a cell such that one or more nucleotide positions of said sequence of interest is substituted by a different nucleotide.
In another aspect the invention provides a method of site-specific mutagenesis of a nucleic acid sequence of interest, said method comprising: obtaining a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said VR comprises said nucleic acid sequence of interest and said TR is an imperfect or perfect repeat of said sequence of interest, wherein said TR is a template sequence operably linked to said sequence of interest to direct site-specific mutagenesis of the sequence, and wherein said TR is an imperfect repeat due to the substitution of one or more adenine nucleotide for a non-adenine nucleotide in said sequence of interest or visa versa; and allowing said nucleic acid molecule to be expressed in a cell such that one or more nucleotide positions of said sequence of interest is substituted by a different nucleotide, wherein more than one nucleotide position of said sequence of interest is substituted.
In another aspect the invention provides a method of site-specific mutagenesis of a nucleic acid sequence of interest, said method comprising: obtaining a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said VR comprises said nucleic acid sequence of interest and said TR is an imperfect or perfect repeat of said sequence of interest, wherein said TR is a template sequence operably linked to said sequence of interest to direct site-specific mutagenesis of the sequence, and wherein said TR is an imperfect repeat due to the substitution of one or more adenine nucleotide for a non-adenine nucleotide in said sequence of interest or visa versa; and allowing said nucleic acid molecule to be expressed in a cell such that one or more nucleotide positions of said sequence of interest is substituted by a different nucleotide, wherein said sequence of interest encodes all or part of a binding partner of a target molecule.
In another aspect the invention provides a method of site-specific mutagenesis of a nucleic acid sequence of interest, said method comprising: obtaining a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said VR comprises said nucleic acid sequence of interest and said TR is an imperfect or perfect repeat of said sequence of interest, wherein said TR is a template sequence operably linked to said sequence of interest to direct site-specific mutagenesis of the sequence, and wherein said TR is an imperfect repeat due to the substitution of one or more adenine nucleotide for a non-adenine nucleotide in said sequence of interest or visa versa; and allowing said nucleic acid molecule to be expressed in a cell such that one or more nucleotide positions of said sequence of interest is substituted by a different nucleotide, wherein said sequence of interest encodes all or part of a binding partner of a target molecule, wherein the binding properties of said binding partner are altered.
In another aspect the invention provides an isolated nucleic acid molecule comprising a donor template region (TR) and an operably linked reverse transcriptase (RT) coding sequence, wherein the TR and RT coding sequence are heterologous to each other.
In another aspect the invention provides an isolated nucleic acid molecule comprising a donor template region (TR) and an operably linked reverse transcriptase (RT) coding sequence, wherein the TR and RT coding sequence are heterologous to each other, wherein the molecule is isolated from a bacteriophage, a prophage of a bacterium, a bacterium, or a spirochete.
In another aspect the invention provides a plurality or library of a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other.
In another aspect the invention provides a plurality or library of a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein the VR has undergone diversification directed by the TR.
In another aspect the invention provides a method of identifying initiation of mutagenic homing (IMH) sequences, said method comprising: identifying an RT coding sequence in a genome of an organism; searching the coding strand within about Skb of the RT ORF and identify an IMH-like sequence containing an 18-48 nucleotide stretch of adenine-depleted DNA; and a) using the putative IMH-like sequence to search genome-wide for a closely-related putative IMH and compare the DNA sequences located 5′ to the IMH-like and putative IMH sequences to find TR and VR regions, respectively; or b) using the sequence of the DNA located 100-350 base-pairs long 5′ to the IMH-like sequence to identify a putative TR, and use all or parts of this TR and IMH-like sequence to search genome-wide for a matching putative VR and IMH sequence.
In another aspect the invention provides a method of identifying initiation of mutagenic homing (IMH) sequences, said method comprising: identifying an RT coding sequence in a genome of an organism; searching the coding strand within about 5 kb of the RT ORF and identify an IMH-like sequence containing an 18-48 nucleotide stretch of adenine-depleted DNA; and a) using the putative IMH-like sequence to search genome-wide for a closely-related putative IMH and compare the DNA sequences located 5′ to the IMH-like and putative IMH sequences to find TR and VR regions, respectively; or b) using the sequence of the DNA located 100-350 base-pairs long 5′ to the IMH-like sequence to identify a putative TR, and use all or parts of this TR and IMH-like sequence to search genome-wide for a matching putative VR and IMH sequence, wherein said RT coding sequence is identified by searching for one or both amino acid sequences IGXXXSQ or LGXXXSQ; or wherein the IMH-like, or IMH, sequence contain a conserved sequence selected from TCGG, TTTTCG, or TTGT; or wherein the identified TR and VR sequences can be between about 100-350 base-pairs long and should be more than about 80% homologous, with the majority of differences being at the locations of the adenines bases in the TR.
In another aspect the invention provides a method of site-specific mutagenesis of a nucleic acid sequence of interest, said method comprising: obtaining a nucleic acid molecule comprising a donor template region (TR) and a variable region (VR), wherein said TR or VR or operably linked reverse transcriptase (RT) coding region is isolated from Vibrio harveyi ML phage, Bifidobacterium longum, Bacteroides thetaiotaonicron, Treponema denticola, or a cyanobacterial diversity generating retroelements (DGRs), and allowing said nucleic acid molecule to be expressed in a cell such that one or more nucleotide positions of said VR is substituted by a different nucleotide.
In another aspect the invention provides a method of site-specific mutagenesis of a nucleic acid sequence of interest, said method comprising: obtaining a nucleic acid molecule comprising a donor template region (TR) and a variable region (VR), wherein said TR or VR or operably linked reverse transcriptase (RT) coding region is isolated from Vibrio harveyi ML phage, Bifidobacterium longum, Bacteroides thetaiotaonicron, Treponema denticola, or a cyanobacterial diversity generating retroelements (DGRs), and allowing said nucleic acid molecule to be expressed in a cell such that one or more nucleotide positions of said VR is substituted by a different nucleotide, wherein said DGR is isolated from Trichodesmium erythraeum #1, Trichodesmium erythraeum #2, Nostoc PPC ssp. 7120 #1, Nostoc PPC ssp. 7120 #2, or Nostoc punctiforme.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein the 3′ end of the VR comprises about a 14 base pair element consisting of G and C residues, not not A residues.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein the 3′ end of the VR comprises about a 14 base pair element consisting of G and C residues, not not A residues, wherein about 4 to about 12 base pairs of the VR 5′ upstream, of and within about 350 base pairs of the base pair element have sequence homology with about 4 to about 12 base pairs of the TR.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein the VR comprises an initiation of mutagenic homing (IMH) sequence at its 3′ end.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein the TR consists essentially of about 10 to about 19 base pairs at its 5′ end and about 38 base pairs at its 3′ end.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein the TR is further extended upstream of the TR comprising the 3′ end of an atd region and the nucleotides between the TR and atd region; and the TR is further extended downstream of the TR comprising the 5′ end of a brt region and the nucleotides between the TR and brt region.
In another aspect the invention provides a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein the TR comprises an initiation of mutagenesis homing-like (IMH*) sequence at its 3′ end.
In another aspect the invention provides a method of site-specific mutagenesis of a nucleic acid sequence of interest, said method comprising: obtaining a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said VR comprises said nucleic acid sequence of interest and said TR is an imperfect or perfect repeat of said sequence of interest, wherein said TR is a template sequence operably linked to said sequence of interest to direct site-specific mutagenesis of the sequence, and wherein said TR is an imperfect repeat due to the substitution of one or more adenine nucleotide for a non-adenine nucleotide in said sequence of interest or visa versa; and allowing said nucleic acid molecule to be expressed in a cell such that one or more nucleotide positions of said sequence of interest is substituted by a different nucleotide, wherein the function of the TR comprises an RNA intermediate.
In another aspect the invention provides a method of site-specific mutagenesis of a nucleic acid sequence of interest, said method comprising: obtaining a single recombinant nucleic acid molecule or pair of nucleic acid molecules comprising: a variable region (VR) operably linked to a donor template region (TR), wherein said TR is operably linked to a reverse transcriptase (RT) coding sequence and is a template sequence that directs site-specific mutagenesis of said VR, and wherein the TR and RT coding sequence are heterologous to each other, wherein said VR comprises said nucleic acid sequence of interest and said TR is an imperfect or perfect repeat of said sequence of interest, wherein said TR is a template sequence operably linked to said sequence of interest to direct site-specific mutagenesis of the sequence, and wherein said TR is an imperfect repeat due to the substitution of one or more adenine nucleotide for a non-adenine nucleotide in said sequence of interest or visa versa; and allowing said nucleic acid molecule to be expressed in a cell such that one or more nucleotide positions of said sequence of interest is substituted by a different nucleotide, which is RecA-independent.
The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will be apparent from the drawings, detailed description and from the claims.
a to 1d show tropism switching by Bordetella bacteriophage. In
a and 2b show diversity-generating retroelements (DGRs) in bacterial and bacteriophage genomes.
a-3c show the results of multiple substitution experiments. In
a and 4b show mosaic VR sequences result from mutagenic homing. In
DGR homing assays were performed following BPP-1d single-cycle lytic infection of RB50 or RB50ArecA cells transformed with the indicated plasmids. TG1c/SMAA, RT-deficient mutant of pMX-TG1c (
This invention provides nucleic acid molecules and methods for their use in site specific mutagenesis of a sequence of interest which is in whole or in part the VR in a operative linkage between the VR and a homologous repeat (TR) that directs the diversification of the sequence of interest at positions occupied by adenines within the TR. The extent of diversity that can be generated by the invention is not equal to the number of adenine positions that are capable of directing substitutions in the VR. Instead, each adenine in TR can result at that position in 3 different nucleotide substitutions in the VR, many of which will result in a substituted amino acid at the corresponding position encoded by the VR. As a non-limiting example, the presence of 23 adenine nucleotides in the practice of the invention is theoretically capable of generating over 1012 distinct polypeptide sequences.
Thus the invention provides for the presence of up to 23 or more adenine nucleotides in a given TR of the invention to direct mutagenesis in the corresponding VR. The presence of adenine residues may be due to natural occurrence in the TR or the result of deliberate insertion or substitution into the TR as described herein. In the case of naturally occurring adenine nucleotides in the TR, mutagenesis may be allowed to occur or may be avoided by a substitution of the adenine nucleotide to a non-adenine nucleotide without changing the encoded amino acid (silent substitution). In the case of deliberate insertion or substitution, the invention provides for the introduction of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20 or more adenine nucleotides into a TR.
As described herein, the invention provides recombinant and isolated nucleic acid molecules comprising a variable region (VR) which is operable linked to a template region (TR), wherein the VR and TR sequences are in the same molecule or separate molecules, and wherein said TR is a template sequence operably linked to said VR in order to direct site specific mutagenesis of said VR. Preferably, however, the molecule is not a derivative, containing only one or more deletion mutations, of the major tropism determinant (mtd) gene, the atd region, and/or the brt coding sequence, of Bvg+ tropic phage-1 (BPP-1) bacteriophage.
The VR and TR regions may be physically and operably linked in cis or operably linked in trans as described herein. The separation between the two regions when linked in cis can range from about 100 base pairs or less to about 1200 base pairs or more. When associated via a cis or trans configuration, expression of the TR and operably linked RT coding sequence may be under the control of an endogenous or heterologous promoters. When associated in trans, expression of the TR and operably linked RT coding sequences may be under the control of an endogenous or heterologous, regulatable promoter or promoters.
The nucleic acid molecules of the invention may also contain an RT encoding region in cis with the TR region. Non-limiting examples of RT coding sequences include those from Vibrio harveyi ML phage, Bifidobacterium longum, Bacteroides thetaiotaonicron, Treponema denticola, or a DGR from cyanobacteria, such as Trichodesmium erythrism, the genus Nostoc, or Nostoc punctiforme as provided herein. The relevant RT econding sequences from these sources are all publicly accessible and available to the skilled person. Additionally, some nucleic acid molecules may contain an atd region (or bbp7 region) immediately 5′ of the TR. Without being bound by theory, and offered to improve the understanding of the invention, the atd region is believed to participate in regulating transcription of the TR and so may be augmented by use of a heterologous promoter.
In embodiments of the invention comprising the use of a heterologous promoter, the promoter may be any that is suitable for expressing the TR and RT coding sequence under the conditions used. As a non-limiting example, when a prokaryotic cell is used with the VR and TR regions, the promoter may be any that is suitable for use in the prokaryotic cell. Non-limiting examples include the filamentous haemagglutinin promoter (fhaP), lac promoter, tac promoter, trc promoter, phoA promoter, lacUV5 promoter, and the araBAD promoter. When the conditions are those of a eukaryotic cell, non-limiting examples of promoters include the cytomegalovirus (CMV) promoter, human elongation factor-1E promoter, human ubiquitin C (UbC) promoter, SV40 early promoter; and for yeast, Gal 11 promoter and Gal 1 promoter. Of course, the VR may remain under the control of an endogenous promoter, if present, or be under the control of another heterologous promoter independently selected from those listed above or others depending on whether a prokaryotic or eukaryotic cell is used. If a cell-free system is used in the practice of the invention, then the promoter(s) will be selected based upon the source of the cellular transcription components, such as RNA polymerase, that are used.
The nucleic acid molecules of the invention may also contain an IMH sequence or a functional analog thereof. The function of the IMH has been described above, and the invention further provides for the identification, isolation, and use of additional functionally analogous sequences, whether naturally occurring or synthetic. In the case of naturally occurring functional analogs, they may be used with heterologous VR and TR sequences in the practice of the instant invention.
Non-limiting examples of IMH and IMH-like sequences for use in the practice of the invention include those shown in the following Table. An IMH or IMH-like sequence may contain the GC-rich region through the 3′ end.
TR GCGAACA-
VR GCGTTCT-
TCGG-GGCGCGCGGCGTCTGTG (21 nt)
ACCACCTGA
B. Longum
TR TGGAACA-
TCGG-GGGCCGC (91% GC)
ATATCC
VR TGGCACC-
TCGG-GGGCCGC (11 nt)
CTTTCT
Bacteriodes T.
TR ACAACAA-
TCGG-GCGTACGGGTTTGGG (68% GC)
G
VR ACTACTC-
TCGG-GCGTGCGGGTTTGGG (19 nt)
T
Vibrio Harveyi
TR AATAGCA-
TCGG-TTTTCGCCCCGCT (65% GC)
CTTGA
TCGG
-TTTTCGCCCCGCT (17 nt)
TTCTT
T. denticola
TR GACAACAA-
TCTT-GGCTTCCGCTTGGCTTG (57% GC)
VR TGCAGCGA-
TCTT-GGCTTCCGCCTGGCTTG (21 nt)
Trichodesmium
Erythraeum #2
TR CGAGTCA-
TCTCGTCTTCCCCGGTGGTTTCTGGCTTTCATTCCTAGTATTCTT
VR CGAGTCA-
TCTCCTCTTCCCCGGTGGTTTCTGGCTTTCATTCCtagTATTCTT
Trichodesmium
Erythraeum #1
TR CAACAATA-
TTGGTTTTCGT-CTTGT-GAGTTTCCCCCCCAG (52% GC)
VR1 CATCAATT-
TTGGTTTTCGT-CTTGT-GAGTTTCCCCCCCAG (31 nt)
VR2 CGACTTTG-
TTGGTTTTCGT-CTTGT-GAGTTTCCCCCCCAG
Nostoc spp. 7120 #1
TR AACAATA-
TTGGTTTTCGT-GTTGT-CTGCGCGTTCGGGAG (55% GC)
TACTC
VR1 TACAGTT-
TTGGTTTTCGT-GTTGT-CTGCGCGTTCGGGAG (31 nt)
GATTC
TTCAGtag
VR2 TACGCTG-
TTGGTTTTCGT-GTTGT-CTGCGCGTTCGGGAG
GACTT
Nostoc Punctiforme
TR AACAATA-
TTGGTTTTCGT-GTTGT-CTGCGCGTTCGGGA (53% GC)
TGTC
TCTTCA
VR1 AGCAATG-
TTGGTTTTCGT-GTTGT-CTGCGCGTTCGGGA (30 nt)
GGAT
TCTTCAGtag
VR2 AGCACTC-
TTGGTTTTCGT-GTTGT-CTGCGCGTTCGGGA
GGAT
TCTTCAGtag
Nostoc spp. 7120 #2
TR CAACGTA-
VR GCGCGTG-
Chlorobium
phaeobacterodies
TR AACAATA-
VR1 GGCGTTA-
TCTTTTGtgaTTATCTGAT
VR2 TACGGTT-
TCTTTTGtgaTTATCTGATAC
Pelodictyon
phaeoclathratiforme
TR AACAATA-
VR GGCAATG-
TCTTCCtgaTCTTCTGTCTTTCT
Prosthecochloris
aestuarii
TR ACAACAA-
VR1 ACGACGT-
VR2 ACGACGA-
In yet another aspect, the invention provides a method of identifying additional RT coding sequences, IMH and IMH-like sequences, TR sequences, and VR sequences. In one embodiment, the invention provides a method of identifying relevant RT coding sequences by searching sequences for the presence of one or both of a conserved nucleotide binding site motif including amino acid sequences IGXXXSQ or LGXXXSQ, where “X” represents any naturally occurring amino acid. Any suitable methodology for searching sequence information may be used. Non-limiting examples include the searching of protein sequence databases with BLAST or PSI-BLAST.
The invention also provides a method of identifying IMH sequences, said method comprising identifying an RT coding sequence in a genome of an organism, optionally as described above, search the coding strand within about 5 kb of the RT ORF and identify an IMH-like sequence containing an 18-48 nucleotide stretch of adenine-depleted DNA; and
A potential VR region may be optionally selected for further analysis if present within coding sequence(s) or putative coding sequence(s). A potential TR may be optionally selected based on location in an intergenic region near the RT coding sequence. Of course sequence alignments of potential TR and VR regions may also be used to confirm their operative linkage, especially if sequence differences occur mainly at adenines. As a non-limiting example, the sequences may be more than about 80%, more than about 85%, more than about 90%, or more than about 95% homologous, with the majority of differences being at the locations of the adenines bases in the TR. As an additional option, the identification of the TR or VR sequences may include searching or identification of sequences that are about 100 to about 350 base-pairs long or longer.
With respect to identifying the IMH-like, or IMH, sequence, searching for a conserved sequence selected from TCGG, TTTTCG, or TTGT at the 3′ ends of possible TR and VR regions may be used.
Conserved sequence patterns have been identified as following the 3′-most nucleotides that vary between TR and VR pairs. Comparison of the regions following the VR region (up to or slightly past the position of the VR-containing genes stop codons) revealed several common features, including 1) the length of the regions range from about 18 to about 44 nucleotides (average length of about 38); 2) regions had no or few adenine nucleotides; 3) nearly all (19/23) begin with a TC or TT followed by a sub-region rich in mono- and di-nucleotide runs; 4) all have one or more mismatches near the 3′ end (up to 5 mismatches in a 9 nucleotide stretch); and 5) the majority (13/23) have a TCTT motif and others (5/23) a similar motif near the 3′ end of the region. Thus IMH and IMH-like sequences of the invention may be designed to possess one or more of these features.
The above methods may be in the form of a bioinformatic algorithm to identify DGRs and IMHs. As would be recognized by the skilled person, the above methods may be embodied in the form of a computer readable medium (such as software).
As one alternative, the BPP1 brt protein sequence may be used to search for homologs in the protein database using PSI-BLAST. Brt homologs from previously identified, putative DGRs may be used for a second iteration search, and top hits may be examined further for TR and IMH-like sequences in the vicinity of the RT coding sequence. In some embodiments, genomic regions of about 2000 to 5000 bp upstream and downstream from the RT coding sequence in the genomes of organisms with closely related RT genes may be searched for direct repeats, such as for <4 repeats of >50 nt long. Potential TR and VR regions may be identified if repeats occurred at the 3′-end of an upstream gene and in the intergenic region upstream of the RT gene. Sequence alignment of putative TR and VR regions identified putative DGRs if sequence differences occurred mainly at adenines. The 3′ ends of the putative TR and VR regions may be examined for conserved IMH and IMH-like sequence motifs as described above.
The invention further provides at least two pattern classes derived from alignments of the non-varying 3′ ends of TRs and VRs. Cyanobacterial sequences form a highly similar sub-group, while other TR/VR pairs have conserved sequence motifs at one or both the ends of the regions with dissimilar internal sequences (see
Non-limiting examples of sequences for site-specific mutagenesis according to the invention are those encoding all or part of a binding partner of a target molecule. Non-limiting examples of binding partners include amylin, THF-γ2, adrenomedullin, insulin, VEGF, PDGF, echistatin, human growth hormone, MMP, fibronectin, integrins, calmodulin, selectins, HBV proteins, HBV antigens, HBV core antigens, tryptases, proteases, mast cell protease, Src, Lyn, cyclin D, cyclin D kinase (Cdk), p16INK4, SH2/SH3 domains, SH3 antagonists, ras effector domain, farnesyl transferase, p21WAF, Mdm2, vinculin, components of complement, C3b, C4 binding protein (C4BP), receptors, urokinase receptor, tumor necrosis factor (TNF), TNFα receptor, antibodies (Ab) and monoclonal antibodies (MAb), CTLA4 MAb, interleukins, IL-1, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-1, IL-12, IL-13, IL-17, interferons, LIF, OSM, CNTF, GCSF, interleukin receptors, IL-1 receptor, c-MpI, erythropoietin (EPO), the EPO receptor, T cell receptor, CD4 receptor, B cell receptor, CD30-L, CD40L, CD27L, leptin, CTLA-4, PF-4, SDF-1, M-CSF, FGF, EGF.
In some embodiments of the invention, the binding partner is a bacteriocin (including a vibriocin, pyocin, or colicin), a bacteriophage protein (including a tail component that determines host specificity), capsid or surface membrane component, a ligand for a cell surface factor or an identified drug or diagnostic target molecule.
In additional embodiments, the binding partner may be part of a fusion protein such that it is produced as a chimeric protein comprising another polypeptide. The other polypeptide member of the fusion protein may be selected from the following non-limiting list: bacteriophage tail fibers, toxins, neurotoxins, antibodies, growth factors, chemokines, cytokines, neural growth factors.
In additional embodiments, the binding partner may be a nucleic acid, part of a nucleic acid molecule, or an aptamer.
As described above, the invention also provides for isolated nucleic acid molecules derived from naturally occurring sequences. Such an isolated nucleic acid molecule may be described as comprising a donor template region (TR) and a variable region (VR) wherein said TR is a template sequence operably linked to said VR in order to direct site specific mutagenesis of said VR. Preferably, the molecule is from a bacteriophage but not from Bvg+ tropic phage-1 (BPP-1), Bvg− tropic phage-1 (BMP-1), or Bvg indiscriminate phage-1.
The nucleic acid molecules of the invention may be part of a vector or a pair of vectors that is/are introduced into cells that permit site-specific mutagenesis of the VR and/or support replication of the molecules. Non-limiting examples of vectors include plasmids and virus based vectors, including vectors for phage display that may be used to express a diversified VR sequence. Other non-limiting embodiments are vectors containing VR sequences that have been subjected to the methods of the instant invention and then removed from an operably linked TR, including by preventing the expression of TR, so as to produce without further diversification quantities of the VR-encoded protein for uses including as a diagnostic, prognostic, or therapeutic product.
The instant invention also provides for a “diversified collection” of more than one VR sequence, per se or in the context of a vector, wherein at least two of the VR sequences differ from each other in sequence. In some embodiments, the difference in sequence results in the encoding of a different polypeptide by the VR sequence, but the difference may also be silent or synonymous (different codon encoding the same amino acid) and optionally used in cases where codon optimization is needed to improve expression of the encoded polypeptide. A “diverse collection” may also be referred to as a library or a plurality of VR sequences, per se or in the context of a vector. Thus the invention also provides a plurality or library of nucleic acid molecules as described herein. The plurality or library of molecules may include those wherein the VR has undergone diversification directed by the operably linked TR.
Non-limiting examples of cells that contain the nucleic acids of the invention include bacterial cells that support site-specific mutagenesis of bacteriophages as described herein or eukaryotic cells of any species origin that support mutagenesis and/or production and processing of recombinant mutagenized protein. In some embodiments, yeast or fungal cells may be used. In other embodiments, higher eukaryotic cells may be used.
Using a Bordetella bacteriophage DGR as a model, we demonstrated that homing occurs through a TR-containing RNA intermediate and is RecA-independent. Marker transfer studies showed that cDNA integration at the 3′ end of VR occurs within a (G/C)14 element, and deletion analysis demonstrated that the reaction was independent of 5′-end cDNA integration. cDNA integration at the 5′ end of VR required only short stretches of sequence homology. We have demonstrated that homing occurs through a target DNA-primed reverse transcription (TPRT) mechanism that precisely regenerated target sequences. This non-proliferative, “copy and replace” mechanism enabled repeated rounds of protein diversification and optimization of ligand-receptor interactions.
Based on the requirement for an RT activity, homing was hypothesized to occur through an RNA intermediate (Liu, M. et al., Science, 295:2091-2094 (2002); Medhekar, B. and Miller, J. F., Curr. Opin. Microbiol., 10:388-395 (2007)). Using a plasmid donor system expressing the BPP-1 atd, TR, and brt loci in trans (Xu et al., unpublished data), we have shown that TR accommodated insertions of heterologous sequences and that adenine mutagenesis occurred efficiently during transfer of inserted sequences to VR. By engineering a self-splicing group I intron into TR, we provided conclusive evidence that DGR homing occurs via an RNA intermediate and was RT-dependent. We also identified regions of the TR-containing RNA transcript that are important for homing. Interestingly, although VR and TR share significant homology, homing was found to be RecA-independent, preferably a marker coconversion assay showed that cDNA initiation occurs within the (G/C)14 element of VR, and further analysis demonstrated that cDNA initiation does not have VR sequences upstream of the (G/C)14 region, but has IMH. cDNA integration upstream of the (G/C)14 element had short stretches of homology between VR and cDNA, and was otherwise sequence-independent. On the basis of these and other results, we conclusively demonstrated that DGR homing initiated via a specialized target DNA-primed reverse transcription (TPRT) mechanism. This approach rendered mechanistic insights into the non-proliferative, “copy and replace” pathway of DGR homing, and accounted for the ability of the DGR to regenerate target sequences in a manner that enabled repeated rounds of homing and VR diversification. Our results provided new approaches for DGR-based genetic engineering.
We initially set out to tag the BPP-1 TR with a self-splicing group I intron, which could then be used to determine whether DGR homing occurs through an RNA intermediate. Intron tagging is a classic method for verifying retrotransposition of mobile genetic elements (Boeke, J. D. et al., Cell, 40:491-500 (1985); Cousineau, B. et al., Cell, 94:451-462 (1998); Guo, H. et al., Science, 289:452-457 (2000); Moran, J. V. et al., Cell, 87:917-927 (1996)). As a prerequisite, the ability of TR to tolerate DNA insertions was first assessed. We inserted a 36 bp fragment at three different positions in TR on plasmid pMX1b, which expressed atd, TR, and brt from the BvgAS activatedjhaB promoter (
Using primer pairs P1/P4, and P2/P3, we detected PCR products of predicted sizes resulting from complementation with all of the constructs containing TG1 (
DGR Homing Occurred through an RNA Intermediate
To demonstrate that DGR homing occurred through a TR-containing RNA intermediate, we used a modified group I intron, tdΔ1-3, which lacked most of the intron ORF but retained self-splicing activity (Cousineau, B. et al., Cell, 94:451-462 (1998); Guo, H. et al., Science, 289:452-457 (2000)). Plasmid pMX-td contains the modified td intron inserted into TR at position 84 (
The td intron was verified to be capable of RNA splicing in Bordetella through both reverse transcription-polymerase chain reaction (RT-PCR) and primer extension-termination assays (
Consistent with a retrohoming process, detection of ligated-exon products required a functional td intron, as splicing-defective mutants (P6M3 and ΔP7.1-2a;
To identify sequence requirements for the RNA intermediate involved in homing, we constructed a series of donor constructs containing deletions within TR and a 32 bp tag (TG2) at the deletion junctions (
Preferably there are no mutations at positions 8-11 of TR, and in the (G/C)14 and IMH* elements (
RecA is involved in repairing UV-induced DNA damage and homologous recombination (Courcelle, J. and Hanawalt, P. C., Annu. Rev. Genet, 37:611-646 (2003)). Considering the extent of TR/VR homology, it was important to evaluate the role of RecA in DGR homing. We generated a B. bronchiseptica RB50ΔrecA strain by allelic exchange. The recA knockout was verified by PCR, sequencing, and loss of RecA-dependent DNA repair in a UV-sensitivity assay (data not shown). We analyzed the ability of donor plasmids pMX-TG1c, pMX-td, and their RT-deficient mutants to complement BPP-1d in wild-type RB50 and its isogenic recA-deficient derivative (
As DGR homing occurred through an RNA intermediate and was RecA-independent, we predicted that cDNA integration at the 3′ end of VR might occur through a TPRT reaction as opposed to homologous recombination following cDNA synthesis. To identify potential priming site(s) for TPRT, we determined that there was a specific boundary at the 3′ end of TR for sequence transfer to VR (
Nineteen donor constructs, with C to T substitutions at TR positions upstream or downstream of the TG1 insertion, were generated and tested for homing into the VR of BPP-1d (
Substitutions in the 5′ region of TR displayed a more diffuse pattern of marker transfer. The marker immediately upstream of TG1 (C81T) was transmitted with 100% efficiency. This was expected, since PCR homing assays selected for TG1 transfer with nearby sequences subjected to co-selection. At greater distances upstream of the tag, coconversion was observed for the majority of clones, with the exception of the marker at position 1. The observation that markers at positions 6, 11, 16, 22 and 43 were partially transferred indicated that cDNA integration occurred before extending to the 5′ end of TR.
Sequences from PCR assays displayed adenine mutagenesis, confirming their assignment as DGR homing products.
cDNA Integration at the 3′ End of VR Was Independent of 5′-End Integration
Results from marker coconversion assays indicated that homing took place in a sequential manner, with cDNA integration at the 3′ end of VR occurring first through a TPRT reaction, followed by cDNA integration at the 5′ end mediated by VR/TR homology. We determined that cDNA integration at the 3′ end of VR occurred independently of 5′-end integration by deleting all VR sequences upstream of the (G/C)14 and IMH elements, creating prophage BPP-1dΔVR1-99 which lacked the first 99 bp of VR (
The td intron-tagged pMX-td (
Taken together, these results demonstrated that cDNA integration at the 3′ end of VR can occur independently of 5′-end integration, demonstrating that DGR homing initiated through a TPRT mechanism. cDNA initiation at the 3′ end of VR had IMH, but was independent of VR sequences or VR/TR homology upstream of the (G/C)14 element.
cDNA Integration at the 5′ End of VR
We showed that cDNA integration at the 5′ end of VR had TR/VR homology upstream of the (G/C)14 and IMH elements, as opposed to specific sequences. We determined that the homing defect resulting from the VR1-99 deletion was rescued by inserting a 50 bp segment of mtd (M50), derived from sequences upstream of VR, into the TR of plasmid pMX-ΔTR23-84 (
As shown in
Sequence analysis of clones from band 2 revealed two products of the same size. One (
When tested in BPP-1dΔVR1-99 lysogens, pMX-ΔTR23-84 did not generate detectable homing products (
DGRs are a family of retroelements that use RT-mediated mobility to generate diversity in protein-encoding DNA sequences (Doulatov, S. et al., Nature, 431:476-481 (2004)). Our results demonstrate that DGRs have evolved an adaptation of TPRT which was site-specific, and capable of precisely regenerating target sequences. This “copy and replace” pathway allowed continuous rounds of protein diversification and the creation of new binding specificities for ligand-receptor interactions.
We demonstrated that the BPP-1 TR can accommodate sequence insertions at multiple sites. Inserted sequences were not only transferred to VR, but they also underwent adenine mutagenesis. The observation that heterologous sequences can be diversified by a DGR has practical applications as discussed below. In the course of these experiments, we developed a sensitive and selective PCR assay that allowed the identification and characterization of VR sequences that have specifically undergone mutagenic homing.
By engineering a self-splicing group I intron into the BPP-1 DGR TR, we showed that homing occurs through a TR-containing RNA intermediate. This conclusion is based on the observation that precisely spliced, adenine-mutagenized exons were transferred to VR. Initially used in yeast to demonstrate retrotransposition of Ty1 (Boeke, J. D. et al., Cell, 40:491-500 (1985)), intron tagging has become a “gold standard” for identifying retrotransposition (Cousineau, B. et al., Cell, 94:451-462 (1998); Guo, H. et al., Science, 289:452-457 (2000); Moran, J. V. et al., Cell, 87:917-927 (1996)). Further experiments revealed sequence requirements for the RNA intermediate. Deletion analysis showed that internal sequences in TR are nonessential, with only ˜10 bp at the 5′ end and ˜38 bp at the 3′ end required for homing. The 10 bp at the 5′ end of TR formed part of an essential RNA structure and/or provided homology for cDNA integration into VR. The 3′-end requirements were composed of the (G/C)14 and IMH* elements. Although sequences internal to TR were dispensable, regions of the RNA transcript important for homing extended upstream and downstream of TR. Synonymous mutations used here (
Mechanisms of cDNA Integration
We developed a marker coconversion assay, based on the introduction of single-nucleotide markers in TR, to genetically map cDNA integration sites at the 3′ and 5′ ends of VR. Sequence analysis of homing products revealed a narrow boundary for marker coconversion at the 3′ end, occurring within the (G/C)14 element (
Our results demonstrated a sequential process in which cDNA integration initially occurred within the (G/C)14 element, followed by 5′-end integration driven by TR/VR homology. To test this we generated a recipient phage lacking the first 99 bp of VR. This deletion included all VR sequences located upstream of the (G/C)14 and IMH elements. PCR homing assays detected 3′-, but not 5′-end integration products, indicating that cDNA integration at the 3′ end of VR was independent of integration at the 5′ end. The ability to detect 3′-end integration was IMH-dependent, indicating that IMH dictated the unidirectional nature of sequence transfer by mediating 3′-end cDNA initiation. As no 5′-end integration products were identified, the 3′ integration products resulted from amplification of cDNA intermediates “trapped” in the homing reaction.
Complete homing into a BPP-1 derivative missing the first 99 bp of VR was restored by inserting a 50 bp homologous segment of mtd into TR (
As expected, transposition of the mtd segment from TR to VR was accompanied by efficient adenine mutagenesis of the heterologous sequences. RecA-mediated homologous recombination machinery was not required for DGR function, as a recA deletion had no effect on mutagenic homing or phage tropism switching. In this respect, DGR homing resembled group II intron homing in Escherichia coli and cDNA-mediated gene conversion by the Ty1 retroelement in Saccharomyces cerevisiae, which occur in the absence of RecA or its yeast homologs Rad51, Rad55 and Rad57, respectively (Cousineau, B. et al., Cell, 94:451-462 (1998); Derr, L. K., Genetics, 148:937-945 (1998)).
Our results support the DGR-mediated diversity generation outlined in
cDNA integration into VR sequences upstream of the (G/C)14 element was homology-dependent and occurred through template switching or strand displacement (
Our results revealed several key features of the mutagenesis process. Sequence analysis of RT-PCR products derived from precisely spliced RNA transcripts of pMX-td, a functional donor plasmid containing a group I intron inserted in TR, demonstrated the presence of intact adenines in the RNA intermediate required for mutagenic homing. This, and the lack of identifiable sequences in DGRs that could potentially encode RNA modifying enzymes, argued against RNA editing as the basis for adenine mutagenesis. In contrast, analysis of cDNA intermediates shown in
Our models for TPRT at the 3′ end of VR, and short homology-mediated cDNA integration at the 5′ end, bore similarities to the site-specific retrotransposition mechanism of the R2 element of Bombyx moil (R2Bm) (Eickbush, D. G. et al., Mol. Cell. Biol., 20:213-223; Eickbush, T. H., Origin and Evolutionary Relationships of Retroelements, In The Evolutionary Biology of Viruses, S. S. Morse, ed. (New York: Raven Press, Ltd.), pp. 121-157 (1994)). A seminal difference, however, was that retrotransposition of R2Bm and similar elements led to destruction of their target sites. In contrast, DGR activity precisely regenerated sequences essential for both 3′- and 5′-end cDNA integration, thus preserved the ability to undergo repeated cycles of mutagenic homing and protein diversification. To date, over 40 DGRs have been identified in bacterial, phage and plasmid genomes, and it appeared that nature has adapted these elements to perform a diverse array of functions (Medhekar, B. and Miller, J. F., Curr. Opin. Microbiol., 10:388-395 (2007)). We have demonstrated that the Bordetella phage DGR was flexible and tolerated sequence insertions in TR. Most importantly, transposition of heterologous sequences was accompanied by efficient adenine mutagenesis. Furthermore, cDNA initiation at the 3′ end of VR was sequence-specific and had the (G/C)14 and IMH elements, while cDNA integration upstream of these elements was homology-driven, but sequence independent. These properties indicated that DGR-mediated targeted evolution could be directed to desirable heterologous sequences by placing them upstream of the (G/C)14 and IMH elements and by appropriately constructing hybrid TRs. As DGRs were continually capable of generating vast amounts of diversity, they provided significant advantages over synthetic library-based approaches for generating diverse protein repertoires and new protein functions.
Having now generally described the invention, the same will be more readily understood through reference to the following examples which are provided by way of illustration, and are not intended to be limiting of the present invention, unless specified.
Bacterial strains, phage and plasmids.
B. bronchiseptica strains were derived from the sequenced RB50 strain (Uhl et al. and Parkhill, J. et al. Comparative analysis of the genome sequences of Bordetella pertussis, Bordetella parapertussis and Bordetella bronchiseptica. Nat Genet. 35, 32-40 (2003)) and BPP-1 was induced from a rabbit isolate of B. bronchiseptica (Liu et al. 2002). BMP-1 was isolated from BPP-1 using the tropism switch assay (see below). Plate lysates were prepared using the soft-agar overlay method (Adams, M. H. Bacteriophages. (Interscience Publishers Inc, New York, N.Y., 1959) and tropism switch assays were performed as described previously (Liu et al. 2002). Bacterial and phage constructs were generated using allelic exchange (Edwards, R. A., Keller, L. H., Schifferli, D. M. Improved allelic exchange vectors and their use to analyze 987P fimbria gene expression. Gene 207, 149-157 (1998) and Figurski, D. H. & Helinski, D. R. Replication of an origin-containing derivative of plasmid RK2 dependent on a plasmid function provided in trans. Proc Natl Acad Sci USA 76, 1648-1652 (1979).
Multiple Substitution Constructs.
BPP-MS1 and BMP-MS1 (
In Vitro Variability Assays.
In vitro variability assays select for transfer, from TR to VR, of single nucleotide substitutions that confer resistance to restriction enzyme cleavage. Lysogens were induced with mitomycin C and VR sequences were amplified by PCR and digested with the appropriate restriction enzymes. The amplification-restriction cycle was repeated with nested primers until no further cutting was observed and the products were cloned into pBluescript KS+ vector (Stratagene) for sequencing. Variability in TR due to “self-homing” (
Bioinformatics.
Annotated BPP-1 sequence is available under GenBank accession number AY029185. Database entries containing the conserved reverse transcriptase catalytic domain (Pfam 00078 rvt) were compiled and phylogenetic profiles were constructed using PHYLIP software package (at evolution.genetics.washington.edu/phylip.html). Entries that grouped together with Brt were searched for the presence of direct repeats proximal to the RT using REPuter program (Kurtz, S. et al. REPuter: the manifold applications of repeat analysis on a genomic scale Nucleic Acids Res. 29, 4633-2642 (2001)). Artemis software was used to collect data and facilitate annotation (Rutherford, K. et al. Artemis: sequence visualization and annotation. Bioinformatics 16:944-945 (2000)).
A genetic strategy for tracking events that give rise to sequence variants was designed based on the observation that conservative nucleotide substitutions in TR are incorporated into VRs of phages that have switched tropism. By introducing multiple synonymous substitutions positioned along TR, the portion of TR transferred during a switching event can be determined by recording the pattern of substitutions appearing in VR. Mechanistic events that underlie tropism switching can then be reconstructed from the resulting “haplotype” profiles.
Information was observed as not being transmitted evenly across VR.
Because the sequence determinants that govern receptor specificity are unclear, tropism switching assays are inherently biased by a powerful, yet poorly defined, set of selective pressures. Substitution patterns were therefore recorded using PCR-based in vitro assays that select for variability at single, precisely defined positions, with no selection for tropism switching or phage infectivity. These assays are based on the loss of restriction sites in parental VR sequences that result from the transmission of synonymous substitutions in TR.
As shown in
Despite the lack of selection for mutagenesis, all of the VR sequences in
The system surprisingly accommodated these rather extreme selections. Both mutant phages were able to switch tropism while avoiding the transmission of frameshift mutations, generating transmission histograms that are essentially mirror images (
Selection at a single position, as imposed by in vitro restriction enzyme-based assays, tends to isolate shorter variable sequences centered around the point of selection. More complex selections for novel receptor specificity select for larger segments of transferred, mutagenized sequence (
These conditions could be satisfied by a mechanism in which site-specific homing, initiated at IMH, is followed by random gene conversion due to recombination or repair. According to this model, a heteroduplex is formed at VR during the variability generating process (
A consequence of the diversity-generating mechanism is that variability is introduced into the mtd locus in a highly targeted manner. Diversification exclusively occurs within the boundaries of the variable repeat, it only occurs at positions corresponding to adenine residues in TR, and it can be limited to the subset of bases that are subject to selection. This “focusing” of variability has the potential to be highly adaptive as it provides a means to efficiently respond to selective pressures while minimizing the accumulation of unnecessary or deleterious substitutions. The repair step may be essential given the high rate of adenine-mutagenesis, and it allows optimization of receptor specificity through iterative rounds of selection (Wrighton, N. C. et al. Small peptides as potent mimetics of the protein hormone erythropoietin. Science 273, 458-64 (1996) and Fairbrother, W. J. et al. Novel peptides selected to bind vascular endothelial growth factor target the receptor-binding site. Biochemistry 37, 17754-17764 (1998)).
The ability to diversify protein domains involved in ligand-receptor interactions has extremely broad utility. The invention thus provides elements homologous to the Bordetella phage retroelement as discovered from other sources in nature. To identify related sequences, open reading frames (ORFs) of bacterial origin containing conserved RT domains were compiled. A subset clustered phylogenetically with Brt (
Further annotation revealed an array of cassettes which we now designate as putative diversity generating retroelements (DGRs). Although RT domains are highly related, and DGRs share an overall conservation of structural features (
In every case VR analogs differ from their cognate TRs almost exclusively at positions corresponding to adenines (
Comparison of the 3′ ends of cognate VRs and TRs also suggests the presence of analogous sequences to the Bordetella phage IMH site (
In addition, several cyanobacterial species contain multiple DGRs which are not homologous and have, therefore, been independently acquired. Although the Bordetella and V. harveyi cassettes are present on prophage genomes, there is no evidence of phage association for the remaining sequences. On the basis of the data in
Retroelements such as group II introns (Bonen, L. & Vogel, J. The ins and outs of group II introns. Trends Genet. 17, 322-331 (2001)), retrotransposons (Bushman, F. D. Targeting survival: integration site selection by retroviruses and LTR retrotransposons Cell 115, 135-138 (2003)), retroviruses (Gifford, R. & Tristem, M. The evolution, distribution and diversity of endogenous retroviruses. Virus Genes 26, 291-315 (2003)), and human LINEs (Kazazian, H. H. Jr. & Goodier, J. L. LINE drive: retrotransposition and genome instability Cell 110, 277-280 (2002)) share related characteristics.
Bordetella strain 61-11(RB50 BPP-1 Δbrt, see
DNA fragments containing various components of the DGR were amplified by PCR from the intact RB50 BPP-1 lysogen, digested with restriction enzymes and cloned into the vector pBBRmcsF carrying an fha promoter. Two of the plasmids, pfhaP-atd-TR-brt and pfhaP-TR-brt, are shown in Table 1 and schematically in
The resulting constructs are listed in Table 2.
After transformation of plasmids into strain 61-11, tropism switching was assayed by inducing lysogenic cells with mitomycin C and plating the phage lysate directly onto RB53 (a Bvg+ strain) or RB54 (a Bvg− strain) to observe plaque formation (see
Induced lysate from cells harboring the pfhaP-atd-TR-brt was plated directly on RB53(Bvg+) or RB54(Bvg−). Eighteen (18) plaques from RB53 plates were isolated and, after PCR amplification, their VR regions were sequenced and found to have changes at positions corresponding to adenines in the TR. From 100 μl of lysate, an average of 15 plaques were seen by plating directly on RB54 (efficiency compared to plating on RB53 is about 10−3).
In parallel, induced lysate from cells harboring the pfhaP-TR-brt was also directly plated on RB53(Bvg+) or RB54(Bvg−). Phages from 10 plaques from RB53 plates were isolated, their VR regions amplified by PCR and sequenced. All had changes in VR regions corresponding to adenines in the TR. From 100 μl of lysate, an average of 15 plaques were seen by plating directly on RB54 (efficiency compared to plating on RB53 is about 10−3).
Because the VR regions of all of the phages, even those that did not switch tropism, contained nucleotide changes corresponding to adenine residues in the TR, the frequency of mutagenesis was effectively 100% with the use of a strong heterologous promoter.
Similar experiments with pfhaP-brt and pfhaP-atd-TR showed no tropism switching.
The results show that the minimal unit for complementation of the brt deletion, restoring the ability to switch tropism, is the TR-brt region, in which:
The results further suggest that the trans acting construct was able to direct the mutagenesis of a proviral copy of the phage VR sequence.
The ability of trans expression of TR-brt to alter the VR sequence of a (chromosomal) prophage was determined in the absence of phage induction. In the uninduced lysogen 61-11 harboring the plasmid pfhaP-atd-TR-brt, PCR amplification was performed on an overnight culture and DNA products were cloned into a sequencing vector.
In one experiment, one colony was picked and grown by overnight culture in LB medium at 37° C. The VR region of 511 overnight culture was PCR amplified and cloned into a sequencing vector (pBluesriptII). 20 plasmids were sequenced, with 2 (thus 10%) having changes in the VR corresponding to adenines in the TR. In another experiment, 5 colonies were picked and individually grown via overnight culture in LB medium at 37° C. The VR region of 511 of each overnight culture was PCR amplified and cloned into a sequencing vector (pBluesriptII). Three (3) plasmids from each plating were sequenced, with 5 of 15 (thus 30%) having changes in the VR corresponding to adenines in the TR.
Thus, fha promoter-directed transcription of the TR-brt region results in elevated levels of VR mutagenesis, demonstrating that:
Using site-directed mutagenesis, 3 adenines were substituted for nucleotides 59-61 of the TR region. The corresponding VR nucleotides encoded non-variable Mtd residue A356. Using homologous recombination, the TR with 3 adenines substituted was introduced into strain 6405 (RB54 BMP-1 lysogen). Successful modification of the 6405 TR was confirmed by sequencing and restriction digestion, generating strain 6405AAA (see below).
Strain 6405AAA was induced, VR regions of the resulting phage mixture were PCR amplified and digested with a restriction enzyme (MboII) that cuts the parental VR sequence 3′ to the AAA substitution. The in vitro selection was for diversification of the parental MboII recognition sequence without assessing its effect on the encoded polypeptide. Re-amplification of VR sequences undigested by MboII followed by cloning and sequencing demonstrated that the newly introduced TR adenine residues were transmitted to VR and diversified.
Placement of a stop codon into atd does not eliminate mutagenesis. This indicates that the atd does not encode a protein for mutagenesis.
Using site-directed mutagenesis, a stop codon was substituted for the 9th amino acid of the postulated accessory tropism determinant (atd) ORF. Using homologous recombination, the atd with a stop codon was introduced into lysogen strain 6405. Successful modification of the 6405 was confirmed by sequencing.
After induction and an additional round of propagation, phages able to plaque on either BVG+ and BVG− Bordetella bronchiseptica were isolated. Therefore, the phage maintained the ability to switch tropism. In addition, the primary induction of phage produced variants. This was shown by selecting for variants in the primary lysate using altered sensitivity to restriction digest in a restriction enzyme/PCR selection method.
Combined with the results of Example 5 above, one can conclude that an atd encoded polypeptide is not required for tropism switching and the atd sequence can be entirely substituted by a heterologous promoter.
A kanamycin resistance gene encoding aminoglycoside-3′-phosphotransferase-II (APH(3′)-IIa) with its own promoter was isolated from plasmid pZS24*luc using restriction enzymes SacI and XbaI and cloned into plasmid pBBRmcs (
The amino acid sequence of APH(3′)—IIa is 264 residues long and is as follows: M I E Q D G L H A G S P A A W V E R L F G Y D W A Q Q T I G C S D A A V F R L S A Q G R P V L F V K T D L S G A L N E L Q D E A A R L S W L A T T G V P C A A V L D V V T E A G R D W L L L G E V P G Q D L L S S H L A P A E K V S I M A D A M R R L H TL D P A T C P F D H Q A K H R I E R A R T R M E A G L V D Q D D L D E E H Q G L A P A E L F A R L K A R M P D G E D L V V T H G D A C L P N I M V E N G R F S G F I D C G R L G V A D R Y Q D I A L A T R D I A E E L G G E W A D R F L V L Y G I A A P D S Q R I A F Y R L L D E F F.
The Leu residue at position 243 is shown with emphasis.
A stop codon (taa) was introduced into position 243 by using site-directed mutagenesis. The mutation eliminated kanamycin resistance in a host harboring the plasmid pBBR-Kan. Plasmid pZS24*luc is from: Lutz, R. & Bujard, H. (1997) Nucleic Acids Res. 25, 1203-1210.
The kanamycin resistance gene was PCR-amplified and digested with restriction enzymes (KpnI and HindIII). The DNA fragment was placed 5′ to the atd-TR-brt region in the plasmid pfhaP-atd-TR-brt. The resulting plasmid is pKan-atd-TR-brt, which carries a deletion of the transcription terminator structure upstream of the atd. (see
The designed VR region for the kanamycin resistance gene (APH(3′)—IIa includes the last 75 bp in the gene (encoding 25 residues ending with Phe) followed by a stop codon tga and 55 bp from the end of gene mtd. (see
The designed TR′ region for kanamycin resistance gene is shown below in alignment with its cognate VR region. A 130 bp region corresponding to the VR is shown with the codon corresponding to Leu243 capitalized. The last 55 bp is the same as the TR region in the BPP-1 DGR region and is capitalized for emphasis.
The TR′ region for the kanamycin resistance gene in plasmid pKan-IMH-atd-TR-brt was made by modified site-directed mutagenesis. The final plasmid is pKan-IMH-atd-TR′-brt (
The plasmid was transformed into lysogen 61-11. The lysogen with plasmid pKan-TR′ grew normally in the presence of kanamycin.
Selection of kanamycin resistance with pKan243-TR′ was as follows. A culture of lysogen 61-11 carrying plasmid pKan243-TR′ was grown overnight followed by serial dilution. The dilutions were plated on LB plates with 40 μg/ml kanamycin. The 61-11 hosts harboring kanamycin resistant plasmids that have “repaired” the amber stop codon by adenine-specific mutagenesis, would be expected to form colonies in the presence of kanamycin. Two robust colonies, 243resis1VR and 243resis2VR, from the plate of hosts harboring pKan243-TR′ were isolated, and, their VR regions were amplified and sequenced.
The results are as shown in the box immediately above, where 243resis1VR contained a taa to tac(Tyr) change; tac is the same codon sequence as that in TR′. This indicates that the TR′ sequence was used to substitute for the VR sequence. Stated differently, the change was the result of sequence substitution from the TR′ to the VR.
In 243resis2VR, taa was changed to ttc(Phe), the result of 2 mutations in the same codon. One of the 2 mutagenic events was an A to T change resulting from diversification of the corresponding A in TR′ while the A to C change was a substitution (or homing) from the TR′ template as seen for 243resis1VR. Phe and Tyr have very similar amino acid structures and are both hydrophilic, and the results show that a Tyr or Phe at position 243, which is Leu (also hydrophilic) in the native sequence, was able to restore kanamycin resistance. This suggests that position 243 tolerates a Leu to Tyr or Phe substitution for maintenance or restoration of phosphotransferase function.
As shown by Nurizzo et al. (J. Mol. Biol., 327:491-506, 2003), the C-terminal domain of the kanamycin resistant protein is involved in binding the kanamycin molecule. According to their published crystal structure, the L243 to amber mutation truncates the protein prior to alpha helices 7 and 8. This leads to loss of C-terminal residues 260-264, which form part of the kanamycin-binding pocket. Thus the sequence changes from a stop codon to those in 243resis1VR and 243resis2VR reflect restoration of the kanamycin binding domain of the phosphotransferase.
The above results also indicate that the IMH does not need to be translated for mutagenesis to occur because the IMH follows a tga stop codon in the above kanamycin phosphotransferase constructs. The above described results may also be performed with a trans construct which provides the TR and RT coding sequences under the control of a separate promoter on a second molecule.
Treponema denticola is a motile, anaerobic spirochete that colonizes the human oral cavity and has been associated with gum disease. There is a 134 base pair identified variable region (VR) located at the 3′ end of open reading frame TDE2269. A corresponding template region (TR) is located 199 base pairs downstream of the VR and 573 base pairs upstream of a reverse transcriptase coding sequence that bears homology (6e-39) to the Bordetella phage reverse transcriptase (brt). The VR and TR differ at 26 positions, with 23 of those differences occurring in the VR at positions that correspond to adenines within the TR. Two of the three positions that do not correspond to adenines may be a part of the IMH signal since they are the most 3′ positions of variability (see below). Also, TDE2269 has a lipoprotein signal sequence (underlined below) indicating that this protein may be exported to the outer membrane. The VR is shown in bolded text below.
MKNTNSKLKTKVLNRAISITALLLAAGVLLTGCPTGQGKSGGGESSEVTP
To confirm variation in the VR corresponding to adenines in the TR, the restriction enzyme HinCII was used in a variability assay to identify a T. denticola VR that differs from the sequenced VR at 25 nucleotide positions. Twenty-one of the 25 differences occur at positions that correspond to adenines within the TR, and one of the remaining four differences appears to be a direct nucleotide transfer (or homing) from the TR as shown below.
The HinCII recognition site is GTYRAC where Y is C or T; and R is A or G. TR stands for Template Region; VR stands for Variable Region; and IV stands for Identified Variant of Variable Region. A portion of presumptive IMH-like and IMH sequences of TR and VR, respectively, are shown in bold type.
For single-cycle lytic infection, B. bronchiseptica RB50 cells (Liu, M. et al., J. Bacteriol., 186:1503-1517 (2004)) transformed with appropriate donor plasmids were grown overnight at 37° C. in Luria-Bertani (LB) media containing 25 μg/ml of chloramphenicol (Cam), 20 μg/ml streptomycin (Str) and 10 mM nicotinic acid (NA). A 200 μl aliquot of cells was pelleted, rinsed, and resuspended in 1.2 ml Stainer Scholte (SS) medium (Stainer, D. W. and Scholte, M. J., J. Gen. Microbiol., 63:211-220 (1970)) containing 25 μg/ml Cam and 20 μg/ml Str (SS+Cam+Str). Cultures were grown for 3 hours at 37° C. to modulate bacteria to the Bvg+ phase, phages were added at a multiplicity of infection (MOI) of −2.0 and incubated at 37° C. for 1 hour to allow phage absorption. Infected cells were pelleted and resuspended in 1 ml fresh, pre-warmed SS+Cam+Str media and incubated at 37° C. for 3 hours total post phage addition to allow completion of a single cycle of phage development. Progeny phages were harvested through chloroform extraction.
For phage production from lysogens, RB50 derivatives carrying prophage and plasmids of interest were grown and modulated to the Bvg+ phase as in single-cycle lytic infections. Phage production was induced with 2 μg/ml mitomycin for 3 hours at 37° C. Progeny phages were harvested through chloroform extraction.
Sequence insertions in TR that are transferred to VR during DGR homing are used as tags for PCR-based detection of homing products. Standard assays were carried out in a volume of 50 μl containing 60 mM Tris-SO4 (pH 9.1), 18 mM (NH4)2SO4, 2 mM MgSO4, 200 μM dNTPs, 5% DMSO, 6 ng/μl each of appropriate primers, 0.5 μl Elongase Enzyme Mix (Invitrogen) and ˜2-50×105 copies of phage DNA. PCR reactions were performed as follows: 1× (94° C., 2 minutes); 30-35× (94° C., 30 seconds; 50-55° C., 30 seconds; 72° C., 1 minute); 1× (72° C., 10 minutes); 1× (4° C., hold). 5 to 20 μl samples were analyzed on 2% agarose gels.
Oligonucleotides: List of oligonucleotides used in this study:
B. bronchiseptica RB50, RB53 Cm, and RB54 have been previously described (Liu, 5M. et al., J. Bacteriol., 186:1503-1517 (2004)). Strain RB50ΔrecA was constructed by deleting the entire recA ORF via allelic exchange. The BPP-1d lysogen was constructed from an RB50 BPP-1 lysogen (ML6401) (Liu, M. et al., J. Bacteriol., 186:1503-1517 (2004)) by deleting sequences from the 5′ end of TR to position 882 of brt. BPP-1dΔVR1-99 and BPP-1dΔVR1-991MH* lysogens were constructed from BPP-1d, and both have a deletion of VR from position 1 to 99. In the latter construct, the IMH in VR was replaced by IMH* from TR. Phage BPP-1 has been described previously (Liu, M. et al., J. Bacteriol., 186:1503-1517 (2004)) and derivative phages are produced from the above lysogens.
Plasmid donors used in DGR homing assays were derived from pMX1, which expresses the BPP-1 atd, TR, and brt loci under control of an fhaB promoter (Xu et al., in preparation). pMX1 includes a pBBR1 replication origin and confers chloramphenicol resistance (Antoine, R. and Locht, C., Mot Microbiol, 6:1785-1799 (1992)). pMX1/SMAA is an RT-deficient mutant of pMX1 with the YMDD box in the brt ORF replaced with amino acid residues SMAA (Liu, M. et al., Science, 295:2091-2094 (2002)).
pMX1b is a derivative of pMX1 with the Sall restriction site in the polylinker between the jhaB promoter and atd eliminated via Sall restriction, filling-in by T4 DNA polymerase and religation. Plasmids pMX-TG1a, pMX-TG1b and pMX-TG1c are derivatives of pMX1b with a 36 bp sequence (5′-GTCGACGTTTTCTTGGGTCTACCGTTTAATGTCGAC) inserted at TR positions 19, 47 and 84, respectively. The 36 bp sequence includes 24 bp ligated exons of the phage T4 td group I intron flanked by Sall sites.
Plasmid pMX-td is derived from pMX-TG1c with the tdA 1-3 intron (a splicing-competent derivative of phage T4 td group I intron lacking most of the intron ORF) inserted between the exons (Cousineau, B. et al., Cell, 94:451-462 (1998)). The intron was inserted in the same orientation as that of TR. Plasmids pMX-td/P6M3 and pMX-td/ΔP7.1-2a are derivatives of pMX-td with splicing-defective td introns. pMX-td/P6M3 has G78C and C79G substitutions, while pMX-td/ΔP7.1-2a carries a A877-908 deletion (Mohr, G. et al., Cell, 69:483-494 (1992)). Plasmid pMX-td− has the td intron and its flanking exons inserted in the reverse orientation.
pMX-AvAp was constructed to facilitate introduction of mutations into TR and its flanking regions and was derived from pMX1b through site-directed mutagenesis. Sequences from atd position 336 to brt position 186 were replaced with the sequence 5′-CCTAGGCCGCGGGCCC to introduce AvrII and Apal sites. To eliminate the AvrII and Apal sites in the polylinker in front of the atd gene, sequence 5′-CCTAGGTACCGGGCCC was replaced with 5′-CCTAGATATCGGTCTC. Plasmid pMX-TG1c/AA was derived from pMX-AvAp and is essentially the same as pMX-TG1c, with the exception of Avrll and Apal sites in atd and brt which were introduced by silent mutations. Silent mutations were verified not to affect DGR homing (pMX-TG1c/AA in
Plasmids used for TR internal deletion analysis in
Additional TR internal deletion constructs pMX-ΔTR20-47, pMX-ΔTR20-84 and pMX-ΔTR48-84 were derived from pMX-TG1a, pMX-TG1b and pMX-TG1c, and contain deletions between the insertions of TG1a and TG1b, TG1a and TG1c, and TG1b and TG1c, respectively. At the deletion junctions, the 36 bp TG1 tag was inserted to facilitate DGR homing assays.
Plasmids for silent mutation scanning to determine regions of the RNA transcript important for DGR homing were constructed from pMX-AvAp and are identical to pMX-TG1c/AA except for the silent mutations. Plasmids pMX-A1, pMX-A2 and pMX-A3 contain silent mutations in the atd ORF and have the 3′-end atd sequences 5′-ATTGCCCGC, 5′-GTGAATCGC and 5′-GCTGGGAAA replaced by 5′-ATTGCGAGG, 5′-GTGAACAGG and 5′-GCAGGCAAG, respectively. The brt ORF can potentially be extended at the 5′ end to sequences upstream of atd. Plasmids pMX-T1, pMX-T2 and pMX-T3 contain silent mutations upstream of the brt ORF, and have the TR sequences 5′-CTGCTGCGC, 5′-TCGGGGCGC and 5′-CCCATCACC replaced by 5′-CTGCTCAGG, 5′-TCGGGAAGG and 5′-CCAATAACA, respectively. Plasmids pMX-T4, pMX-T5 and pMX-T6 contain silent mutations in sequences upstream of the brt ORF, and have the sequences 5′-CTTTCCTCA, 5′-ACGTCGATT and 5′-ACTTCTTCA in the spacer between TR and brt replaced by 5′-CTTAGTAGC, 5′-ACCAGCATA and 5′-ACTAGCAGC. Plasmids pMX-T7, pMX-T8 and pMX-T9 contain silent mutations in the brt ORF, and have the brt sequences 5′-AATCTGCTC, 5′-AAGCGCCGG and 5′-CTGCTGGCC replaced by 5′-AACCTCCTG, 5′-AAGAGAAGA and 5′-CTCCTCGCG.
Plasmids for marker transfer/coconversion studies were also constructed from pMX-AvAp and include pMX-TRC1T, pMX-TRC6T, pMX-TRC11T; pMX-TRC16T, pMX-TRC22T, pMX-TRC43T, pMX-TRC81T, pMX-TRC85T, pMX-TRC91T, pMX-TRC97T, pMX-TRC100T, pMX-TRC105T, pMX-TRC 107T, pMX-TRC109T, pMX-TRC112T, pMX-TRC115T, pMX-TRC120T and pMX-TRC125T. They are identical to pMX-TG1c/AA except for the C to T substitutions at the indicated TR positions.
Plasmid pMX-M50 was derived from pMX-ΔTR23-84 and contains a 50 bp mtd sequence upstream of VR (mtd positions 952 to 1001) inserted at the BgIII site downstream of TR position 22. Plasmid pMX-M50/SMAA is a Brt-deficient derivative of pMX-M50, with the essential YMDD box in the brt ORF replaced by SMAA.
To remove bacterial chromosomal and plasmid DNAs, phage lysates were treated with 50 μg/ml DNase I (Sigma) and 2.5 ng/ml micrococcal nuclease (Roche) in 10 mM Tris-HCl (pH 7.5), 1.0 mM CaCl2, and 10 mM MgCl2 at 37° C. overnight. Aliquots were titrated to determine phage concentrations. Reactions were terminated by the addition of 5.0 mM EGTA and 5 ng/ml protease K followed by incubation at 37° C. for >15 minutes. Protease K was heat-inactivated at 70° C. for >15 minutes. Samples were extracted with phenol-chloroform-isoamyl alcohol (Φ-CIA, 25:24:1) followed by chloroform extraction. For Mtd-defective phages, phage DNA concentrations were determined through quantitative PCR assays.
Total RNAs were isolated from RB50 cells transformed with appropriate plasmids following induction in Stainer Scholte (SS) media containing 25 μg/ml of chloramphenicol (Cam), 20 μg/ml streptomycin (Str) (SS+Cam+Str) for 6 hours to express donor constructs. RNAs were isolated with trizol/CHCl3 extraction and Φ-CIA (phenolchloroform-isoamyl alcohol; 25:24:1) extraction, followed by ethanol precipitation. Subsequently, RNA samples were treated with Turbo DNase I (0.033 u/μl; Ambion) in 1× Turbo DNase I buffer at 37° C. for 40 minutes to eliminate DNA contamination, Samples were then treated with protease K (17 μg/ml final concentration) at 37° C. for 5 minutes to eliminate Turbo DNase I. RNAs were prepared by Φ-CIA extraction and ethanol precipitation.
Analysis of td Intron RNA Splicing in B. bronchiseptica by RT-PCR and Primer-Extension-Termination Assays
To analyze td intron RNA splicing by RT-PCR, cDNA products were first generated with primer P8 in a 20 μl reaction containing 50 mM Tris-HCl (pH 8.3), 75 mM KCl, 3 mM MgCl2, 5 mM DTT, 5% DMSO, 5 μg total RNAs, 10 u/μl Superscript III RT (Invitrogen) and 1.85 u/μl RNase Inhibitor (Amersham) at 50° C. for 1 hour. Superscript III RT was then heat-inactivated at 70° C. for 15 minutes. Subsequently, 2 μl cDNA products were amplified by PCR in a 50 μl reaction containing 60 mM Tris-SO4 (pH 9.1), 18 mM (NH4)2SO4 and 2 mM MgSO4, 200 μM dNTPs, 5% DMSO, 6 ng/μl primers P9 and P10 each, and 0.5 μl Elongase Enzyme Mix (Invitrogen). PCR reactions were performed under the following condition: 1× (94° C., 2 minutes); 15× (94° C., 30 seconds; 50° C., 30 seconds; 72° C., 1 minute); 1× (72° C., 10 minutes); 1× (4° C., hold).
Relative amounts of precursor and spliced RNAs were measured through primer-extension-termination assay (Zhang, A. et al., RNA, 1:783-793 (1995)) using Superscript III RT (invitrogen) and a td exon 2 primer (tdE2).
Progeny phages for tropism switching assays were generated from phage BPP-1d through single-cycle lytic infection of B. bronchiseptica RB50 or RB50ΔrecA cells transformed with appropriate donor plasmids. To determine phage tropism switching frequencies, progeny phages were serially diluted and plaque-forming units on RB54 (Bvg−) and RB53 Cm (Bvg+) cells were determined. Phage tropism switching frequencies were defined as the ratio of plaque-forming units on RB54 cells (Bvg− tropism) vs. those on RB53 Cm cells (Bvg+ tropism).
BPP-1dΔVR1-99 and BPP-1dΔVR1-99IMH* lysogens transformed with donor plasmids were grown overnight, modulated to the Bvg+ phase, and induced with 2 μg/ml mitomycin for 2 hours. Cells were precipitated, resuspended in 10 mM Tris-HCl (pH 8.0), 100 mM NaCl, 1 mM EDTA and 0.1% SIDS. Total nucleic acids were purified by (D-CIA extraction followed by chloroform extraction and ethanol precipitation. Pellets were resuspended in 10 mM Tris-HCl (pH 7.5), 1 mM EDTA and 10 ng/μl protease K. Following incubation at 37° C. for 30 minutes, samples were extracted with (Φ-CIA and precipitated with ethanol.
All references cited herein are hereby incorporated by reference in their entireties, whether previously specifically incorporated or not. As used herein, the terms “a”, “an”, and “any” are each intended to include both the singular and plural forms.
Having now fully described this invention, it will be appreciated by those skilled in the art that the same can be performed within a wide range of equivalent parameters, concentrations, and conditions without departing from the spirit and scope of the invention and without undue experimentation. While this invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications. This application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure as come within known or customary practice within the art to which the invention pertains and as may be applied to the essential features hereinbefore set forth.
This application is a continuation-in-part application of U.S. application Ser. No. 11/197,219, titled: “SITE SPECIFIC SYSTEM FOR GENERATING DIVERSITY PROTEIN SEQUENCES,” filed Aug. 3, 2005, which claims benefit of priority from U.S. Provisional Patent Application Ser. No. 60/598,617, filed Aug. 3, 2004, each of which are hereby incorporated by reference in their entirety for all purposes.
This invention was made with U.S. Government support of Grant Nos. RO1 AI38417, AI061598 and A1071204, awarded by the NIH and 1999-02298, awarded by the USDA. The U.S. Government has certain rights in this invention.
| Number | Date | Country | |
|---|---|---|---|
| 60598617 | Aug 2004 | US |
| Number | Date | Country | |
|---|---|---|---|
| Parent | 11197219 | Aug 2005 | US |
| Child | 12368949 | US |