SUBSTITUTED PYRAZOLOPYRIMIDINES AND SUBSTITUTED PURINES AND THEIR USE AS UBIQUITIN-SPECIFIC-PROCESSING PROTEASE 1 (USP1) INHIBITORS

Abstract

The present disclosure provides compounds having Formula I:

Description

BACKGROUND OF THE DISCLOSURE

Field of the Invention

The present disclosure provides substituted pyrazolopyrimidines and substituted purines as ubiquitin-specific-processing protease 1 (USP1) inhibitors, and therapeutic methods of treating conditions and diseases wherein inhibition of USP1 provides a benefit. In particular, the present disclosure provides methods of treating cancer by administering a USP1 inhibitor.

Background

Ubiquitin is a small (76 amino acid) protein that is post-transcriptionally attached to target proteins. The consequence of ubiquitination is determined by the number and linkage topology of ubiquitin molecules conjugated to the target protein. For example, proteins exhibiting lysine 48-linked poly-ubiquitin chains are generally targeted to the proteasome for degradation, while mono-ubiquitination or poly-ubiquitin chains linked through other lysines regulate non-proteolytic functions, such as cell cycle regulation, DNA damage repair, transcription, and endocytosis. Ubiquitination is a reversible process, and enzymes called deubiquitinases remove ubiquitin from target proteins.

USP1 is a deubiquitinase that plays a role in DNA damage repair. USP1 interacts with UAF1 (USP1-associated factor 1) to form a complex that is required for the deubiquitinase activity. The USP1/UAF1 complex deubiquitinates mono-ubiquitinated PCNA (proliferating cell nuclear antigen) and mono-ubiquitinated FANCD2 (Fanconi anemia group complementation group D2), which are proteins that play important functions in translesion synthesis (TLS) and the Fanconi anemia (FA) pathway, respectively. The USP1/UAF1 complex also deubiquitinates Fanconi anemia complementation group I (FANCI). These two pathways are essential for repair of DNA damage induced by DNA cross-linking agents, such as cisplatin and mitomycin C (MMC).

Safe and effective treatments targeting deubiquitinases are unknown, not yet commercially available, or have not yet been clinically developed.

BRIEF SUMMARY OF THE DISCLOSURE

In one aspect, the present disclosure relates to compounds, or a pharmaceutically acceptable salt or solvate thereof, having Formula I (also referred to herein as Compounds of the Disclosure):

wherein:

each of X¹ and X² is independently selected from N and CR²;

each of R¹ and R² is independently selected from hydrogen, halo, cyano, optionally substituted alkyl, optionally substituted alkenyl, and optionally substituted alkynyl;

R³ is an optionally substituted phenyl, optionally substituted pyridyl, optionally substituted pyrimidinyl, optionally substituted pyrazinyl, optionally substituted pyridazinyl, or optionally substituted pyrazolyl;

each of X¹¹ and X¹² is independently selected from N and CH;

R^5′ is independently selected from hydrogen, optionally substituted (C₁-C₆) alkyl, optionally substituted (C₂-C₆) alkenyl, optionally substituted (C₂-C₆) alkynyl, optionally substituted (C₁-C₆) alkoxy, (C₁-C₆) haloalkyl, (C₁-C₆) haloalkoxy, (C₁-C₆) hydroxyalkyl, cyano, halo, sulfonamido, —C(═O))R²³, —C(═O)OR²⁴, —NR^32aR^32b, —NR^31aC(═O)R²⁵, —NR^31aC(═O))NR^31aR^31b, —C(═O))NR^31a R^31b, —S(O)₂R²⁷, —NR^31aSO₂R²⁷, optionally substituted (C₆-C₁₄) aryl, optionally substituted (C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted heteroaryl, optionally substituted heteroar-(C₁-C₂) alkyl, optionally substituted (C₃-C₈) cycloalkyl, optionally substituted ((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted heterocyclo, optionally substituted heterocyclo-(C₁-C₂) alkyl, optionally substituted —O—(C₆-C₁₄) aryl, optionally substituted —O—(C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted —O-heteroaryl, optionally substituted —O-heteroar-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₈) cycloalkyl, optionally substituted —O—((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted —O-heterocyclo, and optionally substituted —O-heterocyclo-(C₁-C₂) alkyl;

R⁵ is independently selected from optionally substituted (C₁-C₆) alkyl, optionally substituted (C₂-C₆) alkenyl, optionally substituted (C₂-C₆) alkynyl, optionally substituted (C₁-C₆) alkoxy, (C₁-C₆) haloalkyl, (C₁-C₆) haloalkoxy, (C₁-C₆) hydroxyalkyl, cyano, halo, sulfonamido, —C(O)R²³, —C(O)OR²⁴, —NR^32aR^32b, —NR^31aC(═O)R²⁵, —NR^31aC(═O)NR^31aR^31b, —C(═O))NR^31aR^31b, —S(O)₂R²⁷, —NR^31aSO₂R²⁷, optionally substituted (C₆-C₁₄) aryl, optionally substituted (C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted heteroaryl, optionally substituted heteroar-(C₁-C₂) alkyl, optionally substituted (C₃-C₈) cycloalkyl, optionally substituted ((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted heterocyclo, optionally substituted heterocyclo-(C₁-C₂) alkyl, optionally substituted —O—(C₆-C₁₄) aryl, optionally substituted —O—(C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted —O-heteroaryl, optionally substituted —O-heteroar-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₈) cycloalkyl, optionally substituted —O—((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted —O-heterocyclo, and optionally substituted —O-heterocyclo-(C₁-C₂) alkyl; or

one of R⁵ and one of R^5′ on adjacent atolls are taken together with the atoms to which they are attached to form an optionally substituted (C₆-C₁₄) aryl ring or one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atolls to which they are attached to form an optionally substituted heteroaryl ring; or one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted (C₃-C₈) cycloalkyl ring; or one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted heterocycloalkyl ring; or one of R⁵ and one of R^5′ on adjacent atoms on the same atom to which they are attached are taken together to form an optionally substituted spirocycloalkyl ring; or one of R⁵ and one of R^5′ on adjacent atoms on the same atom to which they are attached are taken together to form an optionally substituted spiroheterocycloalkyl ring;

each of R⁶ and R⁷ is independently selected from hydrogen, halo, cyano, optionally substituted alkyl, optionally substituted alkenyl, and optionally substituted alkynyl;

R²³ is selected from the group consisting of hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, amino, alkylamino, diallylamino, cycloalkylamino, hydroxyalkyl, (amino)alkyl, (al ylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (cycloalkyl)alkyl, aralkyl, (heterocyclo)alkyl, (heteroaryl)alkyl, (amino)(hydroxy)alkyl, (aralkylamino)alkyl, optionally substituted heterocyclo, optionally substituted heteroaryl, optionally substituted aryl, and optionally substituted cycloalkyl;

R^31a and R^31b are each independently selected from the group consisting of hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, alkoxyalkyl, cycloalkyl, (cycloalkyl)alkyl, (heterocyclo)allyl, aralkyl, and (heteroaryl)alkyl; and

each of R²⁴, R²⁵, R²⁷, R^32a, and R^32b is independently selected from the group consisting of hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, amino, alkylamino, dialkylamino, cycloalkylamino, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (cycloalkyl)alkyl, aralkyl, (heterocyclo)alkyl, (heteroaryl)alkyl, (amino)(hydroxy)alkyl, (aralkylamino)alkyl, alkoxyalkyl, optionally substituted heterocyclo, optionally substituted heteroaryl, optionally substituted aryl, and optionally substituted cycloalkyl.

In some embodiments, the Compounds of the Disclosure exhibit improved solubility, e.g., as measured by an ADME solubility assay as disclosed herein.

In some embodiments, the Compounds of the Disclosure exhibit improved metabolic stability, e.g., as measured by liver microsome and hepatocyte metabolic stability assays as disclosed herein.

In other embodiments, the Compounds of the Disclosure exhibit improved duration of action and oral exposure in vivo.

In some embodiments, a Compound of the Disclosure is a compound having Formula I, wherein R^5′ is selected from hydrogen, halo, and optionally substituted (C₁-C₆) alkyl.

In some embodiments, a Compound of the Disclosure is a compound having Formula I, wherein at least one of X¹¹ and X¹² is N. In some embodiments, X¹¹ is N. In some embodiments, X¹² is N.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein at least one of X¹¹ and X¹² is CH. In some embodiments, X¹¹ is CH. In some embodiments, X¹² is CH.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of X¹¹ and X¹² is N.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of X¹¹ and X¹² is CH.

In some embodiments, one of X¹¹ and X¹² is N and the other of X¹¹ and X¹² is CH. In one embodiment X¹¹ is N and X¹² is CH. In another embodiment, X¹¹ is CH and X¹² is N.

In some embodiments

In some embodiments,

is selected front

In some embodiments, the optional substituents on R³ are independently selected from hydrogen, halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, heteroaryloxy, aralkyl aralkyloxy, allylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, (cycloalkylamino)alkyl, (C_1-4 haloalkoxy)alkyl, and (heteroaryl)alkyl, or

two of the optional substituents on R³ are taken together with the carbon or nitrogen atoms to which they are attached to form an optionally substituted cycloalkyl, optionally substituted heterocyclo, optionally substituted ail, or optionally substituted heteroaryl group.

In some embodiments, R³ is an optionally substituted phenyl, wherein the phenyl is optionally substituted at the 2-position, optionally substituted at the 6-position, optionally disubstituted at the 2- and 6-positions, or optionally disubstituted at the 2- and 3-positions.

In some embodiments, R³ is an optionally substituted pyrid-3-yl or optionally substituted pyrid-4-yl, wherein the pyrid-3-yl is optionally substituted at the 2-position, optionally substituted at the 4-position, or optionally disubstituted at the 2- and 4-positions; and wherein the pyrid-4-yl is optionally substituted at the 3-position, optionally substituted at the 5-position, or optionally disubstituted at the 3- and 5-positions.

In some embodiments, R³ is an optionally substituted pyrimidin-5-yl, wherein the pyrimidin-5-yl is optionally substituted at the 4-position, optionally substituted at the 6-position, optionally disubstituted at the 4- and 6-positions, or optionally trisubstituted at the 2-, 4-, and 6-positions.

In some embodiments, R³ is an optionally substituted pyrazol-5-yl, wherein the pyrazol-5-yl is optionally substituted at the 1-position, optionally substituted at the 4-position, or optionally disubstituted at the 1- and 4-positions.

In some embodiments, R³ is substituted and the substituents are independently selected from methoxy, deuteromethoxy, ethoxy, isopropoxy, t-butoxy, difluoromethoxy, 2-fluoroethoxy, 2-methoxyethoxy, cyclopropoxy, cyclobutoxy, (tetrahydrofuran-3-yl)oxy, benzyloxy, methyl, ethyl, isopropyl, 2-fluoroisopropyl, t-butyl, cyclopropyl, cyclobutyl, methylcyclopropyl, pyrrolidin-1-yl, azetidin-1-yl, methylamino, dimethylamino, cyano, halo, methylthio, methylsulfonyl, and ethylsulfonyl.

In some embodiments, R³ is selected from the group consisting of:

In some embodiments, the optional substituents on R⁵ are independently selected from hydrogen, halo, nitro, cyano, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, alkoxy, hydroxy, carboxy, carboxyalkyl, amino, alkylamino, dialkylamino, cycloalkylamino, heterocycloalkylamino, aralkylamino, heteroaralkylamino, alkylthio, haloalkyl, haloalkoxy, hydroxyalkyl, hydroxyalkylamino, alkoxyalkyl, (alkoxyalkyl)amino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (carboxamido)alkyl, mercaptoalkyl, (cyano)alkyl, (cycloalkyl)alkyl, aralkyl, aralkyloxy, alkylcarbonyl, arylcarbonyl, (heterocyclo)alkyl, (heteroaryl)alkyl, (amino)(hydroxy)alkyl, (aralkylamino)alkyl, (C_1-4 haloalkoxy)alkyl, optionally substituted heterocyclo, optionally substituted heteroaryl, optionally substituted aryl, optionally substituted cycloalkyl, carboxamido, sulfonyl, sulfonamido, sulfamido, allylsulfonyl, alkylsulfonamido, alkylsulfamido, arylsulfonyl, aryloxy, heteroaryloxy, —C(S)R²³, —C(O)OR²⁴, —C(═O)NR^31a R^31b, —NR^31a C(═O)R²⁵, —NR^31aC(═O)OR²⁶, —NR^31a C(═O)NR^31aR^31b, —NR^31aSO₂R²⁷, —OC(O)R²⁸, —OC(═O)OR²⁹, —OC(═O)NR^31aR^31b, —OSO₂R³⁰, and —NR^32aR^32b; or

two of the optional substituents on R⁵ are taken together with the carbon or nitrogen atoms to which they are attached to form a cycloalkyl, heterocyclo, aryl, or heteroaryl group; and

each of R²⁴, R²⁵, R²⁶, R²⁷, R²⁸, R²⁹, R³⁰, R^32a, and R^32b is selected from the group consisting of hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, amino, alkylamino, dialkylamino, cycloalkylamino, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (cycloalkyl)alkyl, aralkyl, (heterocyclo)alkyl, (heteroaryl)allyl, (amino)(hydroxy)alkyl, (aralkylamino)alkyl, alkoxyalkyl, optionally substituted heterocyclo, optionally substituted heteroaryl, optionally substituted aryl, and optionally substituted cycloalkyl.

In some embodiments, R⁵ is selected from optionally substituted (C₁-C₆) alkyl, optionally substituted (C₂-C₆) alkenyl, optionally substituted (C₂-C₆) alkynyl, optionally substituted (C₁-C₆) alkoxy, (C₁-C₆) haloalkyl, (C₁-C₆) haloalkoxy, (C₁-C₆) hydroxyalkyl, cyano, halo, sulfonamido, —C(═O)R²³, —C(═O)OR²⁴, —NR^32aR^32b, —NR^31aC(═O)R²⁵, —NR^31aC(O)NR^31aR^31b, —C(═O)NR^31aR^31b, —S(O)₂R²⁷, and —NR^31aSO₂R²⁷, optionally substituted —O—(C₆-C₁₄) aryl, optionally substituted —O—(C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted —O-heteroaryl, optionally substituted —O-heteroar-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₈) cycloalkyl, optionally substituted —O—((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted —O-heterocyclo, optionally substituted —O-heterocyclo-(C₁-C₂) alkyl.

In some embodiments, R⁵ is selected from optionally substituted (C₆-C₁₄) aryl, optionally substituted (C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted heteroaryl, optionally substituted heteroar-(C₁-C₂) alkyl, optionally substituted (C₃-C₈) cycloalkyl, optionally substituted ((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted heterocyclo, optionally substituted heterocyclo-(C₁-C₂) alkyl.

In some embodiments, R⁵ is an optionally substituted pyrrolyl, optionally substituted imidazolyl, optionally substituted pyrazolyl, optionally substituted triazolyl, or optionally substituted tetrazolyl.

In some embodiments, R⁵ is an optionally substituted imidazolyl.

In some embodiments, R⁵ is an optionally substituted pyrazoyl.

In some embodiments, R⁵ is an optionally substituted triazolyl.

In some embodiments, R⁵ is an optionally substituted heteroaryl, such as imidazolyl, pyrazolyl or triazolyl, where the substituents are independently selected from halo, methyl, ethyl, isopropyl, cyclopropyl, cyclobutyl, methoxy, ethoxy, triazolyl, cyano, optionally substituted alkyl, amino, alkylamino, dialkylamino, difluoromethyl, trifluoromethyl, methylsulfonyl, oxetan-3-yl, and methylazetidinyl.

In some embodiments, R⁵ is selected from the group consisting of:

In some embodiments, the compound has Formula II:

wherein X¹ is selected from N and CR¹⁰; X⁴ is selected from N and CR¹¹, X⁵ is selected from N and CR¹²; and

each of R⁸, R⁹, R¹⁰, R¹¹, and R¹² is independently selected from the group consisting of hydrogen, halo, nitro, cyano, hydroxy, amino, alkylamino, diallylamino, haloalkyl, hydroxyalkyl, al oxy, haloalkoxy, aryloxy, heteroaryloxy, aralkyl aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, (cycloalkylamino)alkyl, (C_1-4 haloalkoxy)alkyl, or (heteroaryl)alkyl. In some embodiments, the Compounds of the Disclosure has Formula III, Formula IV, Formula V. Formula VI, or Formula VIa:

wherein each of X¹, X², R¹, R⁵, R⁶, R⁷, R⁸, R⁹, and R¹¹ are as defined above for Formula II.

In some embodiments, R⁵ is:

wherein X⁶ is selected from NR¹³ and CR¹⁸; X⁷ is selected from NR¹⁴ and CR¹⁹; X⁸ is selected from NR¹⁵ and CR²⁰; X⁹ is selected from NR¹⁶ and CR²¹; X¹⁰ is selected from NR¹⁷ and CR²²; and

each of R¹³, R¹⁴, R¹⁵, R¹⁶, and R¹⁷ is absent, or independently selected from hydrogen, halo, methyl, ethyl, isopropyl, cyclopropyl, methoxy, triazolyl, cyano, optionally substituted alkyl, amino, alkylamino, dialkylamino, difluoromethyl, trifluoromethyl, methylsulfonyl, and methylazetidinyl.

each of R¹⁸, R¹⁹, R²⁰, R²¹, and R²² is independently selected from hydrogen, halo, methyl, ethyl, isopropyl, cyclopropyl, methoxy, triazolyl, cyano, optionally substituted alkyl, amino, alkylamino, dialkylamino, difluoromethyl, trifluoromethyl, methylsulfonyl, and methylazetidinyl.

In some embodiments, the Compounds of the Disclosure has Formula VII, Formula VIII, Formula IX, Formula X, Formula XI, or Formula XII:

wherein each of X¹, X², R¹, R³, R⁶, R⁷, R¹⁵, R¹⁶, R¹⁷, R²⁰, R²¹, and R²² are as defined above for Formula II.

In another aspect, the present disclosure relates to Compounds of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof, having Formula XIII:

wherein:

each of X^1a and X^2a is independently selected from N, and CR^2a;

R^2a is independently selected from hydrogen, halo, cyano, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl alkoxy, alkoxyalkyl, alkylsulfonyl, alkylthio, aryl, heteroaryl, and heterocyclo; and

each of the remaining substituents is defined as disclosed herein.

In some embodiments, the Compound of the Disclosure is one of the specific compounds listed in the detailed description, or a pharmaceutically acceptable salt or solvate thereof.

In some embodiments, the Compound of the Disclosure inhibits a USP1 protein.

In some embodiments, the Compound of the Disclosure inhibits a USP1 protein with an IC₅₀ value of less than about 1 μM in a Ub-Rho deubiquitinating assay.

In some embodiments, the Ub-Rho deubiquitinating assay is the assay disclosed in Example 26.

In one aspect, the present disclosure relates to a method of treating cancer in a patient comprising administering to the patient a therapeutically effective amount of a Compound of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof.

In one aspect, the present disclosure relates to a pharmaceutical composition comprising a Compound of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure relates to a pharmaceutical composition for use in treatment of cancer.

In some embodiments, the present disclosure relates to a Compound of the Disclosure for use in treatment of cancer.

In some embodiments, the present disclosure relates to a use of a Compound of the Disclosure for the manufacture of a medicament for treatment of cancer.

In one aspect, the present disclosure relates to a kit comprising a Compound of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof, or a pharmaceutical composition comprising a Compound of the Disclosure, and instructions for administering the compound, or a pharmaceutically acceptable salt or solvate thereof, or the pharmaceutical composition to a patient having cancer.

In one aspect, the present disclosure relates to a method of treating cancer in a patient comprising administering to the patient a Compound of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof, or a pharmaceutical composition comprising a Compound of the Disclosure.

In some embodiments, the cancer is selected from the group consisting of a hematological cancer, a lymphatic cancer, and a DNA damage repair pathway deficient cancer.

In some embodiments, the cancer comprises cancer cells with a mutation in a gene encoding p53. In some embodiments, the mutation in a gene encoding p53 is a germline mutation. In some embodiments, the mutation in a gene encoding p53 is a somatic mutation. In some embodiments, the cancer comprises cancer cells with a loss of function mutation in a gene encoding p53.

In some embodiments, the cancer is selected from the group consisting of lung cancer, non-small cell lung cancer (NSCLC), colon cancer, bladder cancer, osteosarcoma, ovarian cancer, and breast cancer.

In some embodiments, the cancer is non-small cell lung cancer (NSCLC).

In some embodiments, the cancer is colon cancer.

In some embodiments, the cancer is bladder cancer.

In some embodiments, the cancer is ovarian cancer or breast cancer.

In some embodiments, the cancer is ovarian cancer.

In some embodiments, the cancer is breast cancer.

In some embodiments, the cancer is triple negative breast cancer.

In some embodiments, the cancer comprises cancer cells with elevated levels of RAD18.

In some embodiments, the elevated levels of RAD18 are elevated RAD18 protein levels.

In some embodiments, the elevated levels of RAD18 are elevated RAD18 mRNA levels.

In some embodiments, the elevated levels of RAD18 have been detected prior to the administration.

In another aspect, the present disclosure relates to a method that further comprises detecting RAD18 levels in a cancer sample obtained from the subject.

In some embodiments, the cancer is selected from the group consisting of bone cancer, including osteosarcoma and chondrosarcoma; brain cancer, including glioma, glioblastoma, astrocytoma, medulloblastoma, and meningioma; soft tissue cancer, including rhabdoid and sarcoma; kidney cancer; bladder cancer; skin cancer, including melanoma; and lung cancer, including non-small cell lung cancer: colon cancer, uterine cancer; nervous system cancer: head and neck cancer; pancreatic cancer; and cervical cancer.

In some embodiments, the cancer is a DNA damage repair pathway deficient cancer.

In some embodiments, the cancer comprises cancer cells with a mutation in a gene encoding p53. In some embodiments, the mutation in a gene encoding p53 is a germline mutation. In some embodiments, the mutation in a gene encoding p53 is a somatic mutation. In some embodiments, the cancer comprises cancer cells with a loss of function mutation in a gene encoding p53.

In some embodiments, the cancer is a BRCA1 mutant cancer. In some embodiments, the BRCA1 mutation is a germline mutation. In some embodiments, the BRCA1 mutation is a somatic mutation. In some embodiments, the BRCA1 mutation leads to BRCA1 deficiency.

In some embodiments, the cancer is a BRCA2 mutant cancer. In some embodiments, the BRCA2 mutation is a germline mutation. In some embodiments, the BRCA2 mutation is a somatic mutation. In some embodiments, the BRCA2 mutation leads to BRCA2 deficiency.

In some embodiments, the cancer is a BRCA1 mutant cancer and a BRCA2 mutant cancer.

In some embodiments, the cancer is a BRCA1 deficient cancer.

In some embodiments, the cancer is a BRCA2 deficient cancer.

In some embodiments, the cancer is a BRCA1 deficient cancer and a BRCA2 deficient cancer.

In some embodiments, the cancer is a Poly (ADP-ribose) polymerase (“PARP”) inhibitor refractory or resistant cancer. In some embodiments, the cancer is a PARP inhibitor resistant or refractory BRCA1, BRCA2, or BRCA1 and BRCA2 mutant cancer.

In some embodiments, the cancer is a P ARP inhibitor resistant or refractory BRCA1, BRCA2, or BRCA1 and BRCA2-deficient cancer.

In some embodiments, the cancer has a mutation in the gene encoding ataxia telangiectasia mutated (ATM) protein kinase. In some embodiments the ATM mutation is a germline mutation. In some embodiments the ATM mutation is a somatic mutation. In some embodiments the cancer is an ATM-deficient cancer.

In some embodiments the cancer has a mutation in the gene encoding at least two of p53, BRCA1, BRCA2, and ATM.

In another aspect, the present disclosure relates to a method of treating a USP1 protein mediated disorder comprising administering to a patient in need thereof a Compound of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof, or a pharmaceutical composition comprising a Compound of the Disclosure, in an effective amount to treat the USP1 protein mediated disorder.

In some embodiments, the USP1 protein comprises the amino acid sequence of SEQ ID NO:1.

In another aspect, the present disclosure relates to a method of inhibiting a USP1 protein comprising contacting a USP1 protein with a Compound of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof, or a pharmaceutical composition comprising a Compound of the Disclosure.

In some embodiments, the contacting occurs in vitro.

In some embodiments, the contacting occurs in vivo.

In another aspect, the present disclosure relates to a method of treating cancer in a patient comprising administering to the subject a USP1 inhibitor, wherein the cancer comprises cancer cells with a mutation in a gene encoding p53.

In some embodiments, the mutation in a gene encoding p53 has been detected prior to the administration.

In some embodiments, the method further comprises detecting the mutation in the gene encoding p53 in a cancer sample obtained from the patient.

In another aspect, the present disclosure relates to a method of selecting a patient with cancer for treatment with a USP1 inhibitor, comprising detecting whether the cancer comprises cancer cells with a mutation in a gene encoding p53, wherein if the cancer comprises cancer cells with a mutation in a gene encoding p53, the patient is selected for treatment with a USP1 inhibitor.

In another aspect, the present disclosure relates to a USP1 inhibitor for use in the treatment of cancer in a patient, wherein the cancer comprises cancer cells with a mutation in a gene encoding p53.

In some embodiments, the patient is identified to be responsive to the treatment with the USP1 inhibitor by detecting cancer cells with a mutation in a gene encoding p53 in a cancer sample obtained from the patient, wherein cancer cells with a mutation in a gene encoding p53 in the cancer sample identify the patient to be responsive to the treatment with an USP1 inhibitor.

In another aspect, the present disclosure relates to a USP1 inhibitor for use in the treatment of cancer in a subject identified to be responsive to the treatment with the USP1 inhibitor by cancer cells with a mutation in a gene encoding p53 in a cancer sample obtained from the subject, wherein cancer cells with a mutation in a gene encoding p53 in the cancer sample identify the patient to be responsive to the treatment with an USP1 inhibitor.

In some embodiments, the LISP inhibitor is not administered to a subject in case a mutation in a gene encoding p53 is not detected in a cancer sample obtained from the subject.

In another aspect, the present disclosure relates to an in vitro method for identifying a subject with cancer to be responsive to the treatment with an USP1 inhibitor, comprising detecting a mutation in a gene encoding p53 in a cancer sample obtained from the subject, wherein a mutation in a gene encoding p53 in the cancer sample is indicative for the patient to be responsive to the treatment with an USP1 inhibitor.

In another aspect, the present disclosure relates to an in vitro use of at least one agent capable of specifically detecting a mutation in a gene encoding p53, for identifying a subject with cancer to be responsive to the treatment with an USP1 inhibitor.

In some embodiments, the mutation in the gene encoding p53 is a loss of function mutation.

In another aspect, the present disclosure relates to a method of treating cancer in a patient comprising administering to the subject a USP1 inhibitor, wherein the cancer comprises cancer cells with a mutation in a gene encoding BRCA1.

In some embodiments, the mutation in a gene encoding BRCA1 has been detected prior to the administration.

In some embodiments, the method further comprises detecting the mutation in the gene encoding BRCA1 in a sample (e.g., a cancer sample or blood sample) obtained from the patient.

In another aspect, the present disclosure relates to a method of selecting a patient with cancer for treatment with a USP1 inhibitor, comprising detecting whether the cancer comprises cancer cells with a mutation in a gene encoding BRCA1, wherein if the cancer comprises cancer cells with a mutation in a gene encoding BRCA1, the patient is selected for treatment with a USP1 inhibitor.

In another aspect, the present disclosure relates to a USP1 inhibitor for use in the treatment of cancer in a patient, wherein the cancer comprises cancer cells with a mutation in a gene encoding BRCA1.

In some embodiments, the patient is identified to be responsive to the treatment with the USP1 inhibitor by detecting a mutation in a gene encoding BRCA1 in a sample (e.g., a cancer sample or a blood sample) obtained from the patient, wherein a mutation in a gene encoding BRCA1 in the sample identifies the patient to be responsive to the treatment with a USP1 inhibitor.

In another aspect, the present disclosure relates to a USP1 inhibitor for use in the treatment of cancer in a subject identified to be responsive to the treatment with the USP1 inhibitor by cancer cells with a mutation in a gene encoding BRCA1 in a sample (e.g., a cancer sample or a blood sample) obtained from the subject, wherein cancer cells with a mutation in a gene encoding BRCA1 in the sample identify the patient to be responsive to the treatment with an USP1 inhibitor.

In some embodiments, the USP1 inhibitor is not administered to a subject in case a mutation in a gene encoding BRCA1 is not detected in a sample (e.g., a cancer sample or a blood sample) obtained from the subject.

In another aspect, the present disclosure relates to an in vitro method for identifying a subject with cancer to be responsive to the treatment with an USP1 inhibitor, comprising detecting a mutation in a gene encoding BRCA1 in a sample (e.g., a cancer sample or a blood sample) obtained from the subject, wherein a mutation in a gene encoding BRCA1 in the sample is indicative for the patient to be responsive to the treatment with an USP1 inhibitor.

In another aspect, the present disclosure relates to an in vitro use of at least one agent capable of specifically detecting a mutation in a gene encoding BRCA1, for identifying a subject with cancer to be responsive to the treatment with an USP1 inhibitor.

In some embodiments, the mutation in the gene encoding BRCA1 is a loss of function mutation.

In another aspect, the present disclosure relates to a method of treating cancer in a patient comprising administering to the subject a USP1 inhibitor, wherein the cancer comprises cancer cells with a mutation in a gene encoding BRCA2.

In some embodiments, the mutation in a gene encoding BRCA2 has been detected prior to the administration.

In some embodiments, the method further comprises detecting the mutation in the gene encoding BRCA2 in a sample (e.g., a cancer sample or a blood sample) obtained from the patient.

In another aspect, the present disclosure relates to a method of selecting a patient with cancer for treatment with a USP1 inhibitor, comprising detecting whether the cancer comprises cancer cells with a mutation in a gene encoding BRCA2, wherein if the cancer comprises cancer cells with a mutation in a gene encoding BRCA2, the patient is selected for treatment with a USP1 inhibitor.

In another aspect, the present disclosure relates to a USP1 inhibitor for use in the treatment of cancer in a patient, wherein the cancer comprises cancer cells with a mutation in a gene encoding BRCA2.

In some embodiments, the patient is identified to be responsive to the treatment with the USP1 inhibitor by detecting a mutation in a gene encoding BRCA2 in a sample (e.g., a cancer sample or a blood sample) obtained from the patient, wherein a mutation in a gene encoding BRCA2 in the sample identifies the patient to be responsive to the treatment with an USP1 inhibitor.

In another aspect, the present disclosure relates to a USP1 inhibitor for use in the treatment of cancer in a subject identified to be responsive to the treatment with the USP1 inhibitor by cancer cells with a mutation in a gene encoding BRCA2 in a sample (e.g., a cancer sample or a blood sample) obtained from the subject, wherein cancer cells with a mutation in a gene encoding BRCA2 in the sample identify the patient to be responsive to the treatment with an USP1 inhibitor.

In some embodiments, the USP1 inhibitor is not administered to a subject in case a mutation in a gene encoding BRCA2 is not detected in a sample (e.g., a cancer sample or a blood sample) obtained from the subject.

In another aspect, the present disclosure relates to an in vitro method for identifying a subject with cancer to be responsive to the treatment with an USP1 inhibitor, comprising detecting a mutation in a gene encoding BRCA2 in a sample (e.g., a cancer sample or a blood sample) obtained from the subject, wherein a mutation in a gene encoding BRCA2 in the sample is indicative for the patient to be responsive to the treatment with an USP1 inhibitor.

In another aspect, the present disclosure relates to an in vitro use of at least one agent capable of specifically detecting a mutation in a gene encoding BRCA2, for identifying a subject with cancer to be responsive to the treatment with an USP1 inhibitor.

In some embodiments, the mutation in the gene encoding BRCA2 is a loss of function mutation.

In another aspect, the present disclosure relates to a method of treating cancer in a patient comprising administering to the subject a USP1 inhibitor, wherein the cancer comprises cancer cells with a mutation in a gene encoding ATM.

In some embodiments, the mutation in a gene encoding ATM has been detected prior to the administration.

In some embodiments, the method further comprises detecting the mutation in the gene encoding ATM in a sample obtained from the patient.

In another aspect, the present disclosure relates to a method of selecting a patient with cancer for treatment with a USP1 inhibitor, comprising detecting whether the cancer comprises cancer cells with a mutation in a gene encoding ATM, wherein if the cancer comprises cancer cells with a mutation in a gene encoding ATM, the patient is selected for treatment with a USP1 inhibitor.

In another aspect, the present disclosure relates to a USP1 inhibitor for use in the treatment of cancer in a patient, wherein the cancer comprises cancer cells with a mutation in a gene encoding ATM.

In some embodiments, the patient is identified to be responsive to the treatment with the USP1 inhibitor by detecting cancer cells with a mutation in a gene encoding ATM in a cancer sample obtained from the patient, wherein cancer cells with a mutation in a gene encoding ATM in the cancer sample identify the patient to be responsive to the treatment with an USP1 inhibitor.

In another aspect, the present disclosure relates to a USP1 inhibitor for use in the treatment of cancer in a subject identified to be responsive to the treatment with the USP1 inhibitor by cancer cells with a mutation in a gene encoding ATM in a cancer sample obtained from the subject, wherein cancer cells with a mutation in a gene encoding ATM in the cancer sample identify the patient to be responsive to the treatment with an USP1 inhibitor.

In some embodiments, the USP1 inhibitor is not administered to a subject in case a mutation in a gene encoding ATM is not detected in a cancer sample obtained from the subject.

In another aspect, the present disclosure relates to an in vitro method for identifying a subject with cancer to be responsive to the treatment with an USP1 inhibitor, comprising detecting a mutation in a gene encoding ATM in a cancer sample obtained from the subject, wherein a mutation in a gene encoding ATM in the cancer sample is indicative for the patient to be responsive to the treatment with an USP1 inhibitor.

In another aspect, the present disclosure relates to an in vitro use of at least one agent capable of specifically detecting a mutation in a gene encoding ATM, for identifying a subject with cancer to be responsive to the treatment with an USP1 inhibitor.

In some embodiments, the mutation in the gene encoding ATM is a loss of function mutation.

In some embodiments, the USP1 inhibitor is a Compound of the Disclosure.

In one aspect (A1), the present disclosure provides a method of treating cancer in a subject comprising administering to the subject a USP1 inhibitor, wherein the cancer comprises cancer cells with elevated levels of RAD18.

In one aspect (A2), the present disclosure provides a method of treating a triple negative breast cancer in a subject comprising administering to the subject a USP1 inhibitor. In one aspect of A1 (A3), the cancer comprises cancer cells with elevated levels of RAD18.

In one aspect (A4) of A1 or A3, the elevated levels of RAD18 have been detected prior to the administration. In one aspect (A5) of A4, the method further comprises detecting RAD18 levels in a cancer sample obtained from the subject.

In one aspect (A5), the present disclosure provides a method of selecting a subject with cancer for treatment with a USP1 inhibitor comprising detecting whether the cancer comprises cells with elevated levels of RAD18, wherein if the cancer comprises cells with elevated levels of RAD18, the subject is selected for treatment with a USP1 inhibitor.

In one aspect (A6), the present disclosure provides a USP1 inhibitor for use in the treatment of cancer in a subject, wherein the cancer comprises cancer cells with elevated levels of RAD18.

In one aspect (A7), the present disclosure provides a USP1 inhibitor for use in the treatment of triple negative breast cancer in a subject.

In one aspect (A9) of A7 or A8, the subject is identified to be responsive to the treatment with the USP1 inhibitor by detecting RAD18 levels in a cancer sample obtained from the subject, wherein elevated levels of RAD18 in the cancer sample identify the patient to be responsive to the treatment with an USP1 inhibitor.

In one aspect (A10), the present disclosure provides a USP1 inhibitor for use in the treatment of cancer in a subject identified to be responsive to the treatment with the USP1 inhibitor by detecting elevated RAD18 levels in a cancer sample obtained from the subject, wherein elevated levels of RAD18 in the cancer sample identify the patient to be responsive to the treatment with an USP1 inhibitor.

In one aspect (A11), the present disclosure provides a USP1 inhibitor for use of any of A7-A10, wherein the USP1 inhibitor is not administered to a subject in case non-elevated RAD18 levels are detected in a cancer sample obtained from the subject.

In one aspect (A12), the present disclosure provides an in vitro method for identifying a subject with cancer to be responsive to the treatment with an USP1 inhibitor, comprising detecting RAD18 levels in a cancer sample obtained from the subject, wherein elevated levels of RAD18 in the cancer sample are indicative for the patient to be responsive to the treatment with an USP1 inhibitor.

In one aspect (A13), the present disclosure provides an in vitro use of at least one agent capable of specifically detecting RAD18, for identifying a subject with cancer to be responsive to the treatment with an USP1 inhibitor.

In one aspect (A14), the present disclosure provides a kit or kit-of-parts, comprising: (a) a pharmaceutical composition comprising a USP1 inhibitor and one or more pharmaceutically acceptable excipients, and (b) a diagnostic kit comprising at least one agent capable of specifically detecting RAD18.

In one aspect (A15) of A13 or A14, the at least one agent capable of specifically detecting RAD18 is capable of specifically hybridizing to RAD18 mRNA. In one aspect (A16) of A13 or A14, the at least one agent capable of specifically detecting RAD18 is capable of specifically binding to RAD18 protein.

In one aspect (A17) of A10, A12, or A13, the cancer is triple negative breast cancer.

In one aspect (A18) of A10, A12, A13, or A17, the cancer comprises cancer cells with elevated levels of RAD18.

In one aspect (A19), the present disclosure provides a method for classifying a cancer in a subject, comprising detecting elevated RAD18 levels in a cancer sample obtained from the subject.

In one aspect (A20) of any one of A1-A19, the cancer is not a BRCA1 mutant cancer. In one aspect (A21) of any one of A1-A19, the cancer is not a BRCA2 mutant cancer. In one aspect (A22) of any one of A1-A19, the cancer is not a BRCA1 mutant cancer or a BRCA2 mutant cancer.

In one aspect (A23) of any one of A1-A19, the cancer is not a homologous-recombination deficient cancer. In one aspect (A24) of any one of A1-A19, the cancer is a homologous-recombination deficient cancer.

In one aspect (A25) of any one of A1-A23, the cancer comprises cancer cells with a mutation in a gene encoding p53, optionally wherein the mutation in the gene encoding p53 is a loss of function mutation.

In one aspect (A26) of any one of A1, A3-A7, A9-A12, and A18-A25, the elevated levels of RAD18 are elevated RAD18 protein levels. In one aspect (A27) of A26, the detection of elevated RAD18 protein levels is by Western blot. In one aspect (A28) of A26, the detection of elevated RAD18 protein levels is by fluorescence-activated cell sorting (FACS). In one aspect (A29) of A26, the detection of elevated RAD18 protein levels is by immunohistochemistry.

In one aspect (A30) of any one of A1, A3-A7, A9-A12, and A18-A25, the elevated levels of RAD18 are elevated RAD18 mRNA levels. In one aspect (A31) of A30, the detection of elevated of RAD18 mRNA levels is by quantitative reverse transcriptase (RT)-polymerase chain reaction (PCR). RNA-Seq, or microarray.

In one aspect (A32) of any one of A1, A3-A7, A9-A12, and A18-A31, the elevated levels of RAD18 are at least as high as the RAD18 levels in ES2 cells. In one aspect (A33) of any one of A1, A3-A7, A9-A12, and A18-A31, the elevated levels of RAD18 are higher than the RAD18 levels in HEP3B217 cells.

In one aspect (A34) of any one of A1, A4-A7, A9-A16, and A18-A33, the cancer is an ovarian cancer. In one aspect (A35) of any one of A1, A4-A7, A9-A16, and A18-A33, the cancer is a breast cancer. In one aspect (A36) of A35, the breast cancer is a triple negative breast cancer.

In one aspect (A37) of any one of A1-A19 and A24-A36, the cancer is a BRCA1 mutant cancer. In one aspect (A38) of any one of A1-A19 and A24-A36, the cancer is a BRCA2 mutant cancer. In one aspect (A39) of any one of A1-A19 and A24-A36, the cancer is a BRCA1 mutant cancer and a BRCA2 mutant cancer.

In one aspect (A40) of any one of A1-A18 and A20-A39, the USP1 inhibitor is selected from a small molecule, an siRNA, an antisense oligonucleotide, a peptide, or an aptamer. In one aspect (A41) of any one of A1-A18 and A20-A40, the USP1 inhibitor specifically binds USP1 protein. In one aspect (A42) of A41, the USP1 protein comprises the amino acid sequence

(SEQ ID NO: 1)
MPGVIPSESNGLSRGSPSKKNRLSLKFFQKKETKRALDFTDSQENEEKASE
YRASEIDQVVPAAQSSPINCEKRENLLPFVGLNNLGNTCYLNSILQVLYFC
PGFKSGVKHLFNIISRKKEALKDEANQKDKGNCKEDSLASYELICSLQSLI
ISVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQEVL
QCILGNIQETCQLLKKEEVKNVAELPTKVEEIPHPKEEMNGINSIEMDSMR
HSEDFKEKLPKGNGKRKSDTEFGNMKKKVKLSKEHQSLEENQRQTRSKRKA
TSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCS
LGKITTNQGVKGQSKENECDPEEDLGKCESDNTTNGCGLESPGNTVTPVNV
NEVKPINKGEEQIGFELVEKLFQGQLVLRTRCLECESLTERREDFQDISVP
VQEDELSKVEESSEISPEPKTEMKTLRWAISQFASVERIVGEDKYFCENCH
HYTEAERSLLFDKMPEVITIHLKCFAASGLEFDCYGGGLSKINTPLLTPLK
LSLEEWSTKPTNDSYGLFAVVMHSGITISSGHYTASVKVTDLNSLELDKGN
FVVDQMCEIGKPEPLNEEEARGVVENYNDEEVSIRVGGNTQPSKVLNKKNV
EAIGLLGGQKSKADYELYNKASNPDKVASTAFAENRNSETSDTTGTHESDR
NKESSDQTGINISGFENKISYVVQSLKEYEGKWLLFDDSEVKVTEEKDFLN
SLSPSTSPTSTPYLLFYKKL.

In one aspect (A43) of any one of A1-A18 and A20-A42, the USP1 inhibitor inhibits formation and/or activity of the USP1/UAF1 complex.

In one aspect (A44) of any one of A1-A18 and A20-A40, the USP1 inhibitor specifically binds to the USP1/UAF1 complex.

In one aspect (A45) of any one of A1-A18 and A20-A40, the USP1 inhibitor specifically binds USP1 mRNA.

In one aspect (A46) of any one of A1-A18 and A20-A45, the USP1 inhibitor increases mono-ubiquitinated PCNA.

In one aspect (A47) of any one of A1-A18 and A20-A46, the USP1 inhibitor increases mono-ubiquitinated FANCD2.

In one aspect (A48) of any one of A1-A18 and A20-A39, the USP1 inhibitor is a purinone. In one aspect (A49) of any one of A1-A18 and A20-A39, the USP1 inhibitor is GW7647. In one aspect (A50) of any one of A1-A18 and A20-A39, the USP1 inhibitor is Pimozide. In one aspect (A51) of any one of A1-A18 and A20-A39, the USP1 inhibitor is ML323.

In one aspect (A52) of any one of A1-A18 and A20-A51, the subject is human.

Additional embodiments and advantages of the disclosure will be set forth, in part, in the description that follows, and will flow from the description, or can be learned by practice of the disclosure. The embodiments and advantages of the disclosure will be realized and attained by means of the elements and combinations particularly pointed out in the appended claims.

It is to be understood that both the foregoing summary and the following detailed description are exemplary and explanatory only, and are not restrictive of the invention as claimed.

BRIEF DESCRIPTION OF THE FIGURES

FIG. 1 provides a USP1 dropout profile across approximately 500 cancer cell lines. A lower dropout score indicates a greater sensitivity to loss of USP1. Breast cancer cell lines are shown in white, and ovarian cancer cell lines are shown in black. Symbols indicate BRCA1/2 mutations or triple negative breast cancer (TNBC) status.

FIG. 2 provides a schematic of PCNA ubiquitination from Jacquemont C. and Taniguchi T., BMC Biochemistry 8 (Suppl 1):S10 (2007). The E3 ligase Rad18 mono-ubiquitinates PCNA. USP1 deubiquitnates mono-ubiquitinated PCNA.

FIG. 3 shows the distribution of Rad18 mRNA expression across approximately 500 cancer cell lines. The x-axis shows normalized Rad18 mRNA expression values, and y-axis shows the number of cell lines that have the expression value indicated on the x-axis. The 20 cell lines with the lowest USP1 dropout scores are shown in the dark bars reaching to the top of the graph.

FIG. 4 provides plots showing USP1 dropout scores across Rad 18 mRNA expression levels in breast cancer cell lines (top left), ovarian cancer cell lines (top right), and triple negative breast cancer cell lines (bottom).

FIG. 5 shows Rad18 mRNA levels in USP1 sensitive cell lines (59M and ES2) and insensitive cell lines (OVISE, JHH7, and HEP3B217) as measured by qRT-PCT, normalized to GAPDH expression, and normalized to OVISE.

FIG. 6 shows RAD18 protein levels in the USP1 sensitive cell lines (59M and ES2) and insensitive cell lines (OVISE, JHH7, and HEP3B217). The top panel shows the protein levels in a Western blot, and the bottom panel provides quantitation of the Western blot protein levels. “HCC1395” in the Western assay (top panel) was determined to be contaminated with another cell line and therefore not used in the quantitation (bottom panel).

FIG. 7. provides graphs demonstrating that deletion of Rad18 rescues deletion of USP1. The graphs show the relative cell viability in OR1A1 (negative control) knockout cells (left panel) or Rad18 knockout cells (right panel) with the addition of guides against OR1A1 negative control (“negative control”), EEF2 pan lethal positive control (“lethal control”), or 4 different USP1 guides (“USP1_1,” “USP1_2,” “USP1_3,” and “USP1_4”).

DETAILED DESCRIPTION OF THE DISCLOSURE

One aspect of the present disclosure is based on the use of Compounds of the Disclosure as inhibitors of a ubiquitin-specific-processing protease 1 (USP1) protein. In view of this property, the Compounds of the Disclosure are useful for inhibiting a USP1 protein and for treating diseases, disorders, or conditions, e.g., cancer, that are responsive to inhibition of a USP1 protein.

In some embodiments, the Compounds of the Disclosure exhibit improved solubility, e.g., as measured by an ADME solubility assay as disclosed herein.

In some embodiments, the Compounds of the Disclosure exhibit improved metabolic stability, e.g., as measured by liver microsome metabolic stability assays as disclosed herein.

In other embodiments, the Compounds of the Disclosure exhibit improved duration of action and oral exposure in vivo.

In one embodiment, Compounds of the Disclosure are compounds having Formula I:

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein:

each of X¹ and X² is independently selected from N and CR²;

each of R¹ and R² is independently selected from hydrogen, halo, cyano, optionally substituted alkyl, optionally substituted alkenyl, and optionally substituted alkynyl;

R³ is an optionally substituted phenyl, optionally substituted pyridyl, optionally substituted pyrimidinyl, optionally substituted pyrazinyl, optionally substituted pyridazinyl, or optionally substituted pyrazolyl;

R^5′ is selected from hydrogen, optionally substituted (C₁-C₆) alkyl, optionally substituted (C₂-C₆) alkenyl, optionally substituted (C₂-C₆) alkynyl, optionally substituted (C₁-C₆) alkoxy, (C₁-C₆) haloalkyl, (C₁-C₆) haloalkoxy, (C₁-C₆) hydroxyalkyl, cyano, halo, sulfonamido, —C(═O))R²³, —C(O)OR²⁴, —NR^32aR^32b, —NR^31aC(═O))R²⁵, —NR^31aC(═O))NR^31aR^31b, —C(═O))NR^31a R^31b, —S(O)₂R²⁷, —NR^31aSO₂R²⁷, optionally substituted (C₆-C₁₄) aryl, optionally substituted (C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted heteroaryl, optionally substituted heteroar-(C₁-C₂) alkyl, optionally substituted (C₃-C₈) cycloalkyl, optionally substituted ((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted heterocyclo, optionally substituted heterocyclo-(C₁-C₂) alkyl, optionally substituted —O—(C₆-C₁₄) aryl, optionally substituted —O—(C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted —O-heteroaryl, optionally substituted —O-heteroar-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₈) cycloalkyl, optionally substituted —O—((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted —O-heterocyclo, optionally substituted —O-heterocyclo-(C₁-C₂) alkyl;

R⁵ is selected from optionally substituted (C₁-C₆) alkyl, optionally substituted (C₂-C₆) alkenyl, optionally substituted (C₂-C₆) alkynyl, optionally substituted (C₁-C₆) alkoxy, (C₁-C₆) haloalkyl, (C₁-C₆) haloalkoxy, (C₁-C₆) hydroxyalkyl, cyan, halo, sulfonamido, —C(═O)R²³, —C(═O))OR²⁴, —NR^32aR^32b, —NR^31aC(═O)R²⁵, —NR^31aC(═O)NR^31aR^31b, —C(═O))NR^31aR^31b, —S(O)₂R²⁷, —NR^31aSO₂R²⁷, optionally substituted (C₆-C₁₄) aryl, optionally substituted (C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted heteroaryl, optionally substituted heteroar-(C₁-C₂) alkyl, optionally substituted (C₃-C₈) cycloalkyl, optionally substituted ((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted heterocyclo, optionally substituted heterocyclo-(C₁-C₂) alkyl, optionally substituted —O—(C₆-C₁₄) aryl, optionally substituted —O—(C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted —O-heteroaryl, optionally substituted —O-heteroar-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₈) cycloalkyl, optionally substituted —O—((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted —O-heterocyclo, optionally substituted —O-heterocyclo-(C₁-C₂) alkyl; or

one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted (C₆-C₁₄) aryl ring, or one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted heteroaryl ring or one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted (C₃-C₈) cycloalkyl ring or one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted heterocycloalkyl ring; or one of R⁵ and one of R^5′ on adjacent atoms on the same atom to which they are attached are taken together to form an optionally substituted spirocycloalkyl ring; or one of R⁵ and one of R^5′ on adjacent atoms on the same atom to which they are attached are taken together to form an optionally substituted spiroheterocycloalkyl ring;

each of R⁶ and R⁷ is independently selected from hydrogen, halo, cyano, optionally substituted alkyl, optionally substituted alkenyl, and optionally substituted alkynyl;

each of X¹¹ and X¹² is independently selected from N and CH:

R²³ is selected from the group consisting of hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, amino, alkylamino, dialkylamino, cycloalkylamino, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (cycloalkyl)alkyl, aralkyl, (heterocyclo)alkyl, (heteroaryl)alkyl, (amino)(hydroxy)alkyl, (aralkylamino)alkyl, optionally substituted heterocyclo, optionally substituted heteroaryl, optionally substituted aryl, and optionally substituted cycloalkyl;

R^31a and R^31b are each independently selected from the group consisting of hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (diallylamino)alkyl, alkoxyalkyl, cycloalkyl, (cycloalkyl)alkyl, (heterocyclo)alkyl, aralkyl, and (heteroaryl)alkyl; and

each of R²⁴, R²⁵, R²⁷, R^32a, and R^32b) is independently selected from the group consisting of hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, amino, alkylamino, dialkylamino, cycloalkylamino, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (cycloalkyl)alkyl, aralkyl, (heterocyclo)alkyl, (heteroaryl)alkyl, (amino)(hydroxy)alkyl, (aralkylamino)alkyl, alkoxyalkyl, optionally substituted heterocyclo, optionally substituted heteroaryl, optionally substituted aryl, and optionally substituted cycloalkyl.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of X¹ and X² is CR².

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein at least one of X¹ and X² is N. In some embodiments, X¹ is N. In some embodiments, X² is N.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein at least one of X¹ and X² is CR². In some embodiments, X¹ is CR². In some embodiments, X² is CR².

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of X¹ and X² is N.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R^5′ is selected from hydrogen, halo, and optionally substituted (C₁-C₆) alkyl.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein

is independently selected from:

In another embodiment,

In another embodiment,

In another embodiment,

In another embodiment,

In another embodiment,

is independently selected front

In another embodiment,

In another embodiment,

In another embodiment,

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of R¹ and R² is independently selected from hydrogen, halo, and cyano.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of R¹ and R² is independently selected from optionally substituted (C_1-4) alkyl, optionally substituted (C_2-4) alkenyl, and optionally substituted (C_2-4) alkynyl. In some embodiments, each of R¹ and R² is independently selected from optionally substituted (C_1-4) alkyl. In some embodiments, each of R¹ and R² is independently selected from optionally substituted (C_2-4) alkenyl. In some embodiments, each of R¹ and R² is independently selected from optionally substituted (C_2-4) alkynyl.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is an optionally substituted phenyl.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is an optionally substituted pyridy.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is an optionally substituted pyrimidinyl.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is an optionally substituted pyrimidinyl.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is an optionally substituted pyridazinyl.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is an optionally substituted pyrazoly.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein the optional substituents on R³ are independently selected from hydrogen, halo, nitro, cyan, hydroxy, amino, alkylamino, diallylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, heteroaryloxy, aralkyl aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, (cycloalkylamino)alkyl, (C_1-4 haloalkoxy)alkyl, and (heteroaryl)alky.

In another embodiment, the optional substituents on R³ are independently selected from hydrogen, halo, nitro, cyano, hydroxy, amino, (C₁-C₄) alkylamino, di-(C₁-C₄) alkylamino, halo-(C₁-C₄) alkyl, hydroxy-(C₁-C₄) alkyl, (C₁-C₄) alkoxy, halo-(C₁-C₄) alkoxy, (C₆-C₁₀) aryloxy, (C₃-C₆) heteroaryloxy, ar-(C₁-C₄) alkyl, ar-(C₁-C₄) alkyloxy, (C₁-C₄) alkylthio, carboxamido, sulfonamido, (C₁-C₄) alkylcarbonyl, (C₆-C₁₀) arylcarbonyl, (C₁-C₄) alkylsulfonyl. (C₆-C₁₀) arylsulfonyl, carboxy, carboxy-(C₁-C₄) alkyl, (C₁-C₄) alkyl, (C₁-C₄) alkenyl, (C₂-C₄) alkynyl, alkoxy-(C₁-C₄) alkyl, (amino)-(C₁-C₄) alkyl, hydroxy-(C₁-C₄) alkylamino, (alkylamino)-(C₁-C₄) alkyl, (dialkylamino)-(C₁-C₄) alkyl, (cyano)-(C₁-C₄) alkyl, (carboxamido)-(C₁-C₄) alkyl, mercapto-(C₁-C₄) alkyl, (heterocyclo)-(C₁-C₄) alkyl, (cycloalkylamino)-(C₁-C₄) alkyl, (C_1-4haloalkoxy)-(C₁-C₄) alkyl and (heteroaryl)-(C₁-C₄) alky.

In another embodiment, the optional substituents on R³ are independently selected from (C₃-C₈) cycloalkyl, (C₆-C₁₀) aryl, (C₃-C₆) heteroaryl, and (C₃-C₈) heterocyclo.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein two of the optional substituents on R³ are taken together with the carbon or nitrogen atom to which they are attached to form an optionally substituted cycloalkyl, optionally substituted heterocyclo, optionally substituted aryl, or optionally substituted heteroaryl group.

In another embodiment, two of the optional substituents on R³ are taken together with the carbon or nitrogen atoms to which they are attached to form an optionally substituted (C₃-C₈) cycloalkyl, optionally substituted (C₃-C₈) heterocyclo, optionally substituted (C₆-C₁₀) aryl, or optionally substituted (C₃-C₆) heteroaryl group.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is an optionally substituted phenyl, wherein the phenyl is optionally substituted at the 2-position. In another embodiment, the phenyl is optionally substituted at the C-position. In another embodiment, the phenyl is optionally disubstituted at the 2- and 6-positions. In another embodiment, the phenyl is optionally disubstituted at the 2- and 3-positions.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is an optionally substituted pyrid-3-yl or optionally substituted pyrid-4-yl.

In another embodiment. R³ is an optionally substituted pyrid-3-yl. In another embodiment, the pyrid-3-yl is optionally substituted at the 2-position. In another embodiment, the pyrid-3-yl is optionally substituted at the 4-position. In another embodiment, the pyrid-3-yl is optionally disubstituted at the 2- and 4-positions.

In another embodiment, R³ is an optionally substituted pyrid-4-yl. In another embodiment, the pyrid-4-yl is optionally substituted at the 3-position. In another embodiment, the pyrid-4-yl is optionally substituted at the 5-position. In another embodiment, the pyrid-4-yl is optionally disubstituted at the 3- and 5-positions.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is an optionally substituted pyrimidin-5-yl. In another embodiment, the pyrimidin-5-yl is optionally substituted at the 2-position. In another embodiment, the pyrimidin-5-yl is optionally substituted at the 4-position. In another embodiment, the pyrimidin-5-yl is optionally substituted at the 6-position. In another embodiment, the pyrimidin-5-yl is optionally disubstituted at the 4- and 6-positions. In another embodiment, the pyrimidin-5-yl is optionally disubstituted at the 2- and 6-positions. In another embodiment, the pyrimidin-5-yl is optionally disubstituted at the 2- and 4-positions. In another embodiment, the pyrimidin-5-yl is optionally trisubstituted at the 2-, 4-, and 6-positions.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is an optionally substituted pyrazol-3-yl or optionally substituted pyrazol-5-yl.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is an optionally substituted pyrazol-5-yl. In another embodiment, the pyrazol-5-yl is optionally substituted at the 1-position. In another embodiment, the pyrazol-5-yl is optionally substituted at the 3-position. In another embodiment, the pyrazol-5-yl is optionally substituted at the 4-position. In another embodiment, the pyrazol-5-yl is optionally disubstituted at the 1- and 4-positions. In another embodiment, the pyrazol-5-yl is optionally disubstituted at the 1- and 3-positions. In another embodiment, the pyrazol-5-yl is optionally disubstituted at the 3- and 4-positions.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R³ is substituted and the substituents are independently selected from methoxy, deuteromethoxy, ethoxy, isopropoxy, t-butoxy, difluoromethoxy, 2-fluoroethoxy, 2-methoxyethoxy, cyclopropoxy, cyclobutoxy, (tetrahydrofuran-3-yl)oxy, benzyloxy, methyl, ethyl, isopropyl, 2-fluoroisopropyl, t-butyl, cyclopropyl, cyclobutyl, methylcyclopropyl, pyrrolidin-1-yl, azetidin-1-yl, methylamino, dimethylamino, cyano, halo, methylthio, methylsulfonyl, and ethylsulfonyl.

In one embodiment, R³ is selected from the group consisting of

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein at least one of X¹¹ and X¹² is N. In some embodiments, X¹¹ is N. In some embodiments, X¹² is N.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein at least one of X¹¹ and X¹² is CH. In some embodiments, X¹¹ is CH. In some embodiments, X¹² is CH.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of X¹¹ and X¹² is N.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of X¹¹ and X¹² is CH.

In some embodiments, one of X¹¹ and X¹² is N and the other of X¹¹ and X¹² is CH. In one embodiment X¹¹ is N and X¹² is CH. In another embodiment, X¹¹ is CH and X¹² is N.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R⁵ is selected from optionally substituted (C₁-C₄) alkyl, optionally substituted (C₂-C₄) alkenyl, optionally substituted (C₂-C₄) alkynyl, optionally substituted (C₁-C₄) alkoxy. (C₁-C₄) haloalkyl, (C₁-C₄) haloalkoxy, (C₁-C₄) hydroxyalkyl.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R⁵ is selected from cyano, halo, sulfonamido, —C(O)R²³, —C(═O))OR²⁴, —NR^32aR^37b, —NR^31aC(═O))R²⁵, —NR^31aC(═O))NR^31aR^31b, —C(═O))NR^31a R^31b, —S(O)₂R²⁷, —NR^31aSO₂R²⁷.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R⁵ is selected from optionally substituted (C₆-C₁₀) aryl, optionally substituted (C₆-C₁₀) ar-(C₁-C₂) alkyl, optionally substituted (C₃-C₆) heteroaryl, optionally substituted (C₃-C₆)heteroar-(C₁-C₂) alkyl, optionally substituted (C₃-C₈) cycloalkyl, optionally substituted ((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted (C₃-C₈) heterocyclo, optionally substituted (C₃-C₈) heterocyclo-(C₁-C₂) alkyl, optionally substituted —O—(C₆-C₁₀) aryl, optionally substituted —O—(C₆-C₁₀) ar-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₈) heteroaryl, optionally substituted —O—(C₃-C₆) heteroar-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₈) cycloalkyl, optionally substituted —O—((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₈) heterocyclo, optionally substituted —O—(C₃-C₈) heterocyclo-(C₁-C₂) alkyl.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R⁵ is an optionally substituted heteroaryl. In another embodiment, R⁵ is an optionally substituted 5- or 6-membered heteroaryl containing one or more nitrogen. In another embodiment, R is an optionally substituted 5- or 6-membered heteroaryl containing only nitrogen as the heteroatom or heteroatoms.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted (C₆-C₁₀) aryl ring.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted (C₃-C₆) heteroaryl ring.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted (C₃-C₈) cycloalkyl ring.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted (C₃-C₈) heterocycloalkyl ring.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted spirocycloalkyl ring.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein one of R⁵ and one of R^5′ on adjacent atoms are taken together with the atoms to which they are attached to form an optionally substituted spiroheterocycloalkyl ring.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein the optional substituents on R⁵ are independently selected from hydrogen, halo, nitro, cyan, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, alkoxy, hydroxy, carboxy, carboxyalkyl, amino, alkylamino, dialkylamino, cycloalkylamino, heterocycloalkylamino, aralkylamino, heteroaralkylamino, alkylthio, haloalkyl, haloalkoxy, hydroxyalkyl, hydroxyalkylamino, alkoxyalkyl, (alkoxyalkyl)amino, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (carboxamido)alkyl, mercaptoalkyl, (cyano)alkyl, (cycloalkyl)alkyl, aralkyl, aralkyloxy, alkylcarbonyl, arylcarbonyl, (heterocyclo)alkyl, (heteroaryl)alkyl, (amino)(hydroxy)alkyl, (aralkylamino)alkyl, (C_1-4 haloalkoxy)alkyl, optionally substituted heterocyclo, optionally substituted heteroaryl, optionally substituted aryl, optionally substituted cycloalkyl, carboxamido, sulfonyl, sulfonamido, sulfamido, alkylsulfonyl, alkylsulfonamido, alkylsulfamido, arylsulfonyl, aryloxy, heteroaryloxy, —C(═O)R²³, —C(O)OR²⁴, —C(O)NR^31a R^31b, —NR^31aC(═O)R²⁵, —NR^31aC(═O))OR²⁶, —NR^31aC(═O))NR^31aR^31b, —NR^31aSO₂R²⁷, —OC(═O)R²⁸, —OC(═O))OR²⁹, —OC(═O))NR^31a R^31b, —OSO₂R³⁰, and —NR^32aR^32b.

In another embodiment, the optional substituents on R⁵ are independently selected from hydrogen, halo, nitro, cyan, optionally substituted (C₁-C₄) alkyl, optionally substituted (C₂-C₄) alkenyl, optionally substituted (C₂-C₄) alkynl, (C₁-C₄) alkoxy, hydroxy, carboxy, carboxy-(C₁-C₄) alkyl, amino, (C₁-C₄) alkylamino, di-(C₁-C₄) alkylamino, (C₃-C₈) cycloalkylamino, heterocyclo-(C₁-C₄) alkylamino, ar-(C₁-C₄) alkylamino, heteroar-(C₁-C₄) alkylamino, (C₁-C₄) alkylthio, halo-(C₁-C₄) alkyl, halo-(C₁-C₄) alkoxy, hydroxy-(C₁-C₄) alkyl, hydroxy-(C₁-C₄) alkylamino, alkoxy-(C₁-C₄) alkyl, (alkoxyalkyl)amino, (amino)-(C₁-C₄) alkyl, (alkylamino)-(C₁-C₄) alkyl, (dialkylamino)-(C₁-C₄) alkyl, (cycloalkylamino)-(C₁-C₄) alkyl, (carboxamido)-(C₁-C₄) alkyl, mercapto-(C₁-C₄)alkyl, (cyano)-(C₁-C₄) alkyl, (cycloalkyl)-(C₁-C₄) alkyl, ar-(C₁-C₄)alkyl, ar-(C₁-C₄) alkyloxy, (C₁-C₄)alkylcarbonyl, arylcarbonyl, (heterocyclo)-(C₁-C₄) alkyl, (heteroaryl)-(C₁-C₄) alkyl, (amino)(hydroxy)-(C₁-C₄) alkyl, (aralkylamino)-(C₁-C₄) alkyl, and (C_1-4 haloalkoxy)-(C₁-C₄) alkyl.

In another embodiment, the optional substituents on R⁵ are independently selected from optionally substituted (C₃-C₈) heterocycle, optionally substituted (C₃-C₆) heteroaryl, optionally substituted (C₆-C₁₀) aryl, optionally substituted (C₃-C₈) cycloalkyl.

In another embodiment, the optional substituents on R⁵ are independently selected from carboxamido, sulfonyl, sulfonamido, sulfamido, (C₁-C₄) alkylsulfonyl, (C₁-C₄) alkylsulfonamido, (C₁-C₄) alkylsulfamido, (C₆-C₁₀) arylsulfonyl, (C₆-C₁₀) aryloxy, (C₃-C₆) heteroaryloxy, —C(═O)R²³, —C(═O))OR²⁴, —C(═O))NR^31a R^31b, —NR^31aC(═O))R²⁵, —NR^31aC(═O)OR²⁶, —NR^31aC(═O)NR^31aR^31b, —NR^31aSO₂R²⁷, —OC(═O)R²⁸, —OC(═O)OR²⁹, —OC(═O)NR^31a R^31b, —OSO₂R³⁰, and —NR^32aR^32b.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein two of the optional substituents on R⁵ are taken together with the carbon or nitrogen atoms to which they are attached to form an optionally substituted cycloalkyl, optionally substituted heterocyclo, optionally substituted aryl, or optionally substituted heteroaryl group.

In another embodiment, two of the optional substituents on R⁵ are taken together with the carbon atoms to which they are attached to form an optionally substituted (C₃-C₈) cycloalkyl, optionally substituted (C₃-C₈) heterocyclo, optionally substituted (C₆-C₁₀) aryl, or optionally substituted (C₃-C₆) heteroaryl group.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R⁵ is selected from optionally substituted (C₁-C₆) alkyl, optionally substituted (C₂-C₆) alkenyl, optionally substituted (C₂-C₆) alkynyl, optionally substituted (C₁-C₆) alkoxy, (C₁-C₆) haloalkyl, (C₁-C₆) haloalkoxy, and (C₁-C₆) hydroxyalkyl.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R⁵ is selected from cyano, halo, sulfonamido, —C(O)R²³, —C(═O)OR²⁴, —NR^32aR^32b, —NR^31aC(═O))R²⁵, —NR^31aC(═O)NR^31aR^31b, —C(═O)NR^31a R^31b, —S(O)₂R²⁷, and —NR^31aSO₂R²⁷.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R⁵ is selected from optionally substituted —O—(C₆-C₁₄) aryl, optionally substituted —O—(C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted —O— heteroaryl, optionally substituted —O-heteroar-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₈) cycloalkyl, optionally substituted —O—((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted —O-heterocyclo, optionally substituted —O-heterocyclo-(C₁-C₂) alkyl. In another embodiment, R⁵ is selected from optionally substituted —O—(C₆-C₁₀) aryl, optionally substituted —O—(C₆-C₁₀) ar-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₆) heteroaryl, optionally substituted —O—(C₃-C₆) heteroar-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₈) cycloalkyl, optionally substituted —O—((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted —O—(C₃-C₈) heterocyclo, optionally substituted —O—(C₃-C₈) heterocyclo-(C₁-C₂) alkyl.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R⁵ is selected from optionally substituted (C₆-C₁₄) aryl, optionally substituted (C₆-C₁₄) ar-(C₁-C₂) alkyl, optionally substituted heteroaryl, optionally substituted heteroar-(C₁-C₂) alkyl, optionally substituted (C₃-C₈) cycloalkyl, optionally substituted ((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted heterocyclo, optionally substituted heterocyclo-(C₁-C₂) alkyl. In another embodiment, R⁵ is selected from optionally substituted (C₆-C₁₀) aryl, optionally substituted (C₆-C₁₀) ar-(C₁-C₂) alkyl, optionally substituted (C₃-C₆) heteroaryl, optionally substituted (C₃-C₆) heteroar-(C₁-C₂) alkyl, optionally substituted (C₃-C₈) cycloalkyl, optionally substituted ((C₃-C₈) cycloalkyl)-(C₁-C₂) alkyl, optionally substituted (C₃-C₈) heterocyclo, optionally substituted (C₃-C₈) heterocyclo-(C₁-C₂) alkyl.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R⁵ is an optionally substituted pyrrolyl, optionally substituted imidazolyl, optionally substituted pyrazolyl, optionally substituted triazolyl, or optionally substituted tetrazolyl. In another embodiment, R is an optionally substituted pyrrolyl.

In another embodiment, R⁵ is an optionally substituted imidazolyl. In another embodiment, R⁵ is an optionally substituted pyrazolyl. In another embodiment, R⁵ is an optionally substituted triazolyl. In another embodiment, R⁵ is an optionally substituted tetrazolyl.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R⁵ is substituted and the substituents are independently selected from halo, methyl, ethyl, isopropyl, cyclopropyl, cyclobutyl, methoxy, ethoxy, cyano, optionally substituted alkyl, amino, allylamino, dialkylamino, difluoromethyl, trifluoromethyl, methylsulfonyl, oxetan-3-yl, and methylazetidinyl,

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R⁵ is selected from the group consisting of:

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of R⁶ and R⁷ is independently selected from hydrogen, halo, and cyano.

In another embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of R⁶ and R⁷ is independently selected from optionally substituted (C₁-C₄) alkyl, optionally substituted (C₂-C₄) alkenyl, and optionally substituted (C₂-C₄) alkynyl.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein R²³ is selected from the group consisting of hydrogen, optionally substituted (C₁-C₄) alkyl, optionally substituted (C₂-C₄) alkenyl, optionally substituted (C₂-C₄) alkynyl, amino, (C₁-C₄) alkylamino, di-(C₁-C₄) alkylamino, cyclo-(C₁-C₄) alkylamino, hydroxy-(C₁-C₄) alkyl, (amino)-(C₁-C₄) alkyl, (alkylamino)-(C₁-C₄) alkyl, (dialkylamino)-(C₁-C₄) alkyl, (cycloalkylamino)-(C₁-C₄) alkyl, (cycloalkyl)-(C₁-C₄) alkyl, ar-(C₆-C₁₀) alkyl, (heterocyclo)-(C₁-C₄) alkyl, (heteroaryl)-(C₁-C₄) alkyl, (amino)(hydroxy)-(C₁-C₄) alkyl, (aralkylamino)-(C₁-C₄) alkyl, optionally substituted (C₃-C₈) heterocyclo, optionally substituted (C₃-C₆) heteroaryl, optionally substituted (C₆-C₁₀) aryl, and optionally substituted (C₃-C₈) cycloalkyl.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of R^31a and R^31b is independently selected from the group consisting of hydrogen, optionally substituted (C₁-C₄) alkyl, optionally substituted (C₂-C₄) alkenyl, optionally substituted (C₂-C₄) alkynyl, hydroxy-(C₁-C₄) alkyl, (amino)-(C₁-C₄) alkyl, (alkylamino)-(C₁-C₄) alkyl, (dialkylamino)-(C₁-C₄) alkyl, alkoxy-(C₁-C₄) alkyl, (C₃-C₈) cycloalkyl, (cycloalkyl)-(C₁-C₄) alkyl, (heterocyclo)-(C₁-C₄) alkyl, ar-(C₁-C₄) alkyl, and (heteroaryl)-(C₁-C₄) alkyl.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of R²⁴, R²⁵, R²⁷, R^32a, and R^32b is independently selected from the group consisting of hydrogen, optionally substituted (C₁-C₄) alkyl, optionally substituted (C₂-C₄) alkenyl, optionally substituted (C₂-C₄) alkynyl, amino, (C₁-C₄) alkylamino, di-(C₁-C₄) alkylamino, (C₃-C₈) cycloalkylamino, hydroxy-(C₁-C₄)alkyl, (amino)-(C₁-C₄) alkyl, (alkylamino)-(C₁-C₄)alkyl, (diallylamino)-(C₁-C₄) alkyl, (cycloalkylamino)-(C₁-C₄) alkyl, (cycloalkyl)-(C₁-C₄) alkyl, ar-(C₁-C₄) alkyl, (heterocyclo)-(C₁-C₄) alkyl, (heteroaryl)-(C₁-C₄) alkyl, (amino)(hydroxy)-(C₁-C₄) alkyl, (aralkylamino)-(C₁-C₄) alkyl, alkoxy-(C₁-C₄) alkyl, optionally substituted (C₃-C₈) heterocyclo, optionally substituted (C₃-C₆) heteroaryl, optionally substituted (C₆-C₁₀) aryl, and optionally substituted (C₃-C₈) cycloalkyl.

In one embodiment, a Compound of the Disclosure is a compound having Formula I, wherein each of R²⁴, R²⁵, R²⁶, R²⁷, R²⁸, R²⁹, R³⁰, R^32a, and R^32b is selected from the group consisting of hydrogen, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted alkynyl, amino, alkylamino, diallylamino, cycloalkylamino, hydroxyalkyl, (amino)alkyl, (alkylamino)alkyl, (dialkylamino)alkyl, (cycloalkylamino)alkyl, (cycloalkyl)alkyl, aralkyl, (heterocyclo)alkyl, (heteroaryl)alkyl, (amino)(hydroxy)alkyl, (aralkylamino)alkyl, alkoxyalkyl, optionally substituted heterocyclo, optionally substituted heteroaryl, optionally substituted aryl, and optionally substituted cycloalkyl.

In another embodiment, each of R²⁴, R²⁵, R²⁶, R²⁷, R²⁸, R²⁹, R³⁰, R^32a and R^32b is selected from the group consisting of hydrogen, optionally substituted (C₁-C₄) alkyl, optionally substituted (C₂-C₄) alkenyl, optionally substituted (C₂-C₄) alkynyl, amino, (C₁-C₄) alkylamino, di-(C₁-C₄) alkylamino, (C₃-C₈) cycloalkylamino, hydroxy-(C₁-C₄) alkyl, (amino)-(C₁-C₄) alkyl, (alkylamino)-(C₁-C₄) alkyl, (dialkylamino)-(C₁-C₄) alkyl, (cycloalkylamino)-(C₁-C₄) alkyl, (cycloalkyl)-(C₁-C₄) alkyl, ar-(C₁-C₄) alkyl, (heterocyclo)-(C₁-C₄) alkyl, (heteroaryl)-(C₁-C₄) alkyl, (amino)(hydroxy)-(C₁-C₄) alkyl, (aralkylamino)-(C₁-C₄) alkyl, alkoxy-(C₁-C₄) alkyl, optionally substituted (C₃-C₅) heterocyclo, optionally substituted (C₃-C₆) heteroaryl, optionally substituted (C₆-C₁₀) aryl, and optionally substituted (C₃-C₈) cycloalkyl.

In another embodiment, Compounds of the Disclosure are compounds having Formula II:

and the pharmaceutically acceptable salts or solvates, e.g., hydrates, thereof, wherein:

each of X¹, X², R¹, R⁵, R⁶, and R⁷ are as defined above for Formula I;

X³ is selected from N and CR¹⁰; X⁴ is selected from N and CR¹¹; and X⁵ is selected from N and CR¹²; and

each of R⁸, R⁹, R¹⁰, R¹¹, and R¹² is independently selected from the group consisting of hydrogen, halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, heteroaryloxy, aralkyl aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, (cycloalkylamino)alkyl, (C_1-4 haloalkoxy)alkyl, or (heteroaryl)alkyl.

In another embodiment, each of R⁸, R⁹, R¹⁰, R¹¹, and R¹² is independently selected from hydrogen, halo, nitro, cyano, hydroxy, amino, (C₁-C₄) alkylamino, di-(C₁-C₄) alkylamino, halo-(C₁-C₄) alkyl, hydroxy-(C₁-C₄) alkyl, (C₁-C₄) alkoxy, halo-(C₁-C₄) alkoxy, (C₆-C₁₀) aryloxy, (C₃-C₆) heteroaryloxy, ar-(C₁-C₄) alkyl ar-(C₁-C₄) alkyloxy, (C₁-C₄) alkylthio, carboxamido, sulfonamido, (C₁-C₄) alkylcarbonyl, (C₆-C₁₀) arylcarbonyl, (C₁-C₄) alkylsulfonyl, (C₆-C₁₀) arylsulfonyl, carboxy, carboxy-(C₁-C₄) alkyl, (C₁-C₄) alkyl, (C₂-C₄) alkenyl, (C₂-C₄) alkynyl, alkoxy-(C₁-C₄) alkyl, (amino)-(C₁-C₄) alkyl, hydroxy-(C₁-C₄) alkylamino, (alkylamino)-(C₁-C₄) alkyl, (dialkylamino)-(C₁-C₄) alkyl, (cyano)-(C₁-C₄) alkyl. (carboxamido)-(C₁-C₄) alkyl, mercapto-(C₁-C₄) alkyl, (heterocyclo)-(C₁-C₄) alkyl, (cycloalkylamino)-(C₁-C₄) alkyl, (C_1-4 haloalkoxy)-(C₁-C₄) alkyl, or (heteroaryl)-(C₁-C₄) alky.

In another embodiment, each of R⁸, R⁹, R¹⁰, R¹¹, and R¹² is independently selected from optionally substituted (C₃-C₈) cycloalkyl, optionally substituted (C₆-C₁₀) aryl, optionally substituted (C₃-C₆) heteroaryl, and optionally substituted (C₃-C₈) heterocyclo.

In one embodiment, Compounds of the Disclosure are compounds having Formula III, Formula IV, Formula V, Formula VI, or Formula VIa:

wherein each of X¹, X², R¹, R⁵, R⁶, R⁷, R⁸, R⁹, and R¹¹ are as defined above for Formula II.

In another embodiment, R⁵ is:

wherein:

X⁶ is selected from NR¹³ and CR¹⁸; X⁷ is selected from NR¹⁴ and CR¹⁹; X⁸ is selected from NR¹⁵ and CR²⁰; X⁹ is selected from NR¹⁶ and CR²¹; X¹⁰ is selected from NR¹⁷ and CR²²; and

each of R¹³, R¹⁴, R¹⁵, R¹⁶, and R¹⁷ is absent, or independently selected from hydrogen, halo, methyl, ethyl, isopropyl, cyclopropyl, cyclobutyl, methoxy, ethoxy, triazolyl, cyano, optionally substituted alkyl, amino, alkylamino, dialkylamino, difluoromethyl, trifluoromethyl, methylsulfonyl, oxetan-3-yl, and methylazetidinyl.

each of R¹⁸, R¹⁹, R²⁰, R²¹, and R²² is independently selected from hydrogen, halo, methyl, ethyl, isopropyl, cyclopropyl, methoxy, triazolyl, cyano, optionally substituted alkyl, amino, alkylamino, dialkylamino, difluoromethyl, trifluoromethyl, methylsulfonyl, and methylazetidinyl.

In one embodiment, Compounds of the Disclosure are compounds having Formula VII, Formula VIII, Formula IX, Formula X, Formula XI, or Formula XII:

wherein each of X¹, X², R¹, R³, R⁶, R⁷, R¹⁵, R¹⁶, R¹⁷, R²⁰, R²¹, and R²² are as defined above for Formula II.

In one embodiment, Compounds of the Disclosure are compounds having Formula XIII:

wherein:

each of X^1a and X^2a is independently selected from N, and CR^2a;

R^2a is independently selected from hydrogen, halo, cyano, optionally substituted alkyl, optionally substituted alkenyl, optionally substituted al ynyl, alkoxy, alkoxyalkyl, alkylsulfonyl, alkylthio, aryl, heteroaryl, and heterocyclo; and

each of the remaining substituents is defined as disclosed herein.

In one embodiment, Compounds of the Disclosure are compounds selected from the group consisting of:

• 6-(3-methoxypyridin-4-yl)-1-(4-(1-meth yl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 8);
• 1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(2-(meth ylsulfonyl)-phenyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 3);
• 1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(2-methyl-6-(methylsulfonyl)phenyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 23):
• 6-(2-(ethylsulfonyl)phenyl)-1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 7);
• 1-(4-(3-(difluoromethyl)-S-methyl-1H-pyrazol-1-yl)benzyl)-6-(2-isopropylpyridin-3-yl)-1H-pyrazolo[3,4-d]pyrimidine (Example 20):
• 6-(2-methoxy-4-methylpyridin-3-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 6);
• 6-(4-methoxy-6-methylpyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 21);
• 6-(2-isopropylpyridin-3-yl)-1-(4(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 18);
• 6-(2,6-dimethoxyphenyl)-1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 4);
• 6-(2-methoxyphenyl)-1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 2);
• 6-(2-isopropylphenyl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 15);
• 6-(2-methoxy-6-methylphenyl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 5);
• 2-methoxy-3-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)isonicotinonitrile (Example 22);
• 2-(2-isopropylphenyl)-9-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-purine (Example 24);
• 6-(4-cyclopropyl-1-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 12);
• 6-(2-isopropylpyridin-3-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 9);
• 1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(2-methyl-6-(methylthio)phenyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 13);
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 19):
• 6-(2-cyclopropyl-6-methoxyphenyl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 11);
• 6-(2-isopropylphenyl)-1-(4-(1-(1-methylazetidin-3-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 25);
• 6-(2-isopropylphenyl)-1-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)et yl)-1H-pyrazolo[3,4-d]pyrimidine (Example 16);
• 6-(2-isopropylphenyl)-4-methyl-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 14);
• 6-(3-fluoro-2-isopropylphenyl)-1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 10):
• 6-(2-isopropylphenyl)-3-methyl-1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 17);
• 6-(2-isopropylphenyl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 1);
• 6-(4-(tert-butyl)-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-(2-fluoropropan-2-yl)-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-methoxy-6-(1-methylcyclopropyl)pyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclobutyl-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• (S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;
• (R)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-ethoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-isopropoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-cyclopropyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidine-4-carbonitrile;
• 6-cyclopropyl-N,N-dimethyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-amine;
• 6-(4,6-dimethoxy pyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-isopropyl-6-methylpyrimidin-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-6-(4-methyl-6-(methylthio)pyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine;
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-methyl-9-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-9H-purine:
• 1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-6-(4-methyl-6-(methylsulfonyl)pyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-(2-methoxyethoxy)-6-methylpyrimidin-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(1-isopropyl-4-methyl-1H-pyrazol-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(1-isopropyl-4-methoxy-1H-pyrazol-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-1-isopropyl-1H-pyrazol-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine:
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine; and
• 5-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-3-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3H-[1,2,3]triazolo[4,5-d]pyrimidine,or a pharmaceutically acceptable salt or solvate. e.g., hydrate, of any of the above.

In another embodiment, Compounds of the Disclosure are compounds selected from the group consisting of:

• 6-(4,6-diethoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine:
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(trifluoromethyl)-5,6,7,8-tetrahydroimidazo[1,5-a]pyrazin-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-5-(trifluoromethyl)-1H-1,2,4-triazol-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine:
• 6-(1-cyclopropyl-4-methoxy-1H-pyrazol-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-((6-(5-methoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)pyridin-3-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidine;
• (R)-6-(4-cyclobutyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;
• (S)-6-(4-cyclobutyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine:
• (R)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;
• (S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine:
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-2-(trifluoromethyl)-1H-imidazol-4-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-(2-fluoropropan-2-yl)-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine:
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(5-ethoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-((6-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)pyridin-3-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 1-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-5-methyl-1H-pyrazole-3-carbonitrile;
• 6-(4-cyclopropyl-1-ethyl-1H-pyrazol-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-(methoxy-d₃)pyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-cyclopropyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidine-4-carbonitrile;
• 6-(4-cyclopropoxy-6-cyclopropylpyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclobutoxy-6-cyclopropylpyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-(difluoromethoxy)pyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxy-2-methylpyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(oxetan-3-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-(tert-butyl)-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-(tert-butoxy)-6-cyclopropylpyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-(2-fluoroethoxy)pyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(methyl-d3)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 1-(4-(1-cyclobutyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4,6-dimethoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 1-(4-(1-cyclopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxy pyrimidin-5-yl)-1-(4-(1-(2-fluoroethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4d]pyrimidine:
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(3-fluoro-4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4d]pyrimidine:
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(2-fluoro-4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(2,4-dimethoxy-6-methylpyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(5-methoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-(2-methoxyethoxy)pyrimidin-5-yl)-1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-(2-methoxyethoxy)pyrimidin-5-yl)-1-(4(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-methoxy-6-(1-methylcyclopropyl)pyrimidin-5-yl)-1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(1-isopropyl-4-methyl-1H-pyrazol-5-yl)-1-(4(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• (S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-meth yl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;
• (R)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclobutyl-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-isopropoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4d]pyrimidine;
• 6-(4-isopropyl-6-methylpyrimidin-5-yl)-1-(4(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-ethoxypyrimidin-5-yl)-1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• N,N,6-trimethyl-5-(1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-amine;
• 1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-6-(4-methyl-6-(methylthio)pyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4,6-dimethoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-(2-methoxyethoxy)-6-methylpyrimidin-5-yl)-1-(4(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolol[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(1-methylazetidin-3-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-methoxy-6-methylpyrimidin-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 3-(1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)picolinonitrile;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(3-(difluoromethyl)-5-methyl-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-cyclopropyl-N-methyl-5-(1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-amine;
• 1-(4-(5-methoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-6-(4-methoxy-6-methylpyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine:
• 6-(4-cyclopropyl-6-((tetrahydrofuran-3-yl)oxy)pyrimidin-5-yl)-1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-(benzyloxy)-6-cyclopropylpyrimidin-5-yl)-1-(4(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4(3-(difluoromethyl)-1-methyl-1H-1,2,4-triazol-5-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine:
• 6-(4-(benzyloxy)-6-cyclopropylpyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine:
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(5-methoxy-1-methyl-1H-1,2,4-triazol-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 2-(2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)-N,N-dimethylacetamide;
• 6-cyclopropyl-N,N-dimethyl-5-(1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-amine:
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(5-(difluoromethyl)-1-methyl-1H-1,2,4-triazol-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-(pyrrolidin-1-yl)pyrimidin-5-yl)-1-(4-(1-methyl-4-trifluoromethyl) 1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-(azetidin-1-yl)-6-cyclopropylpyrimidin-5-yl)-1-(4(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine: and
• 5-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-3-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3H-[1,2,3]triazolo[4,5-d]pyrimidine,or a pharmaceutically acceptable salt or solvate, e.g., hydrate, of any of the above.

In another embodiment, Compounds of the Disclosure are compounds selected from the group consisting of:

• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3-(methylsulfonyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3-(methylthio)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3-((4-methoxybenzyl)thio)-1H-pyrazolo[3,4-d]pyrimidine;
• (S)-1-(1-(4-(5-bromo-1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-6-(4 cyclopropyl-6-methoxypyrimidin-5-yl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine;
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(4(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine;
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-9-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-8-(methoxymethyl)-9H-purine;
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-isopropyl-9-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-purine;
• 3-cyclobutoxy-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-isopropyl-2-(trifluoromethyl)-1H-imidazol-4-yl)benzyl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine;
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-ethyl-9-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-purine:
• (S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-(2-fluoroethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine;
• 3-(azetidin-1-yl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 1-(4-(5-bromo-1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-(2-fluoroethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine;
• (S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine;
• (S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-ethoxypyrimidin-5-yl)-3-ethoxy-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine:
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-3-ethoxy-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorobenzyl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine;
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-9-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-purine;
• 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine;
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-methyl-9-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-1-purine;
• 8-cyclopropyl-2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-9-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-9H-purine;
• 8-cyclobutyl-2-(4-cyclopropyl-6-methoxy pyrimidin-5-yl)-9-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-9H-purine;
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-isopropyl-9-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-9H-purine:
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-ethyl-9-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-9H-purine;
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine;
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-methyl-9-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-9H-purine:
• 5-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-3-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3H-[1,2,3]triazolo[4,5-d]pyrimidine;
• 2-(4-methoxy-6-methylpyrimidin-5-yl)-9-(4(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-9H-purine:
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-9-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-9H-purine;
• 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-9-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-purine; and
• 2-(2-isopropylphenyl)-9-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-purine.

Definitions

For the purpose of the present disclosure, the term “alkyl” as used by itself or as part of another group refers to a straight- or branched-chain aliphatic hydrocarbon containing one to twelve carbon atoms (i.e., C_1-12 alkyl) or the number of carbon atoms designated (i.e., a C₁ alkyl such as methyl, a C₂ alkyl such as ethyl, a C₃ alkyl such as propyl or isopropyl, etc.). The alkyl group can be suitably chosen from a straight chain C_1-10 alkyl group, a branched chain C_3-10 alkyl group, a straight chain C_1-6 alkyl group, a branched chain C_3-6 alkyl group, a straight chain C_1-4 alkyl group, a branched chain C_3-4 alkyl group, a straight or branched chain C_3-4 alkyl group. The alkyl group can be partially or completely deuterated, i.e., one or more hydrogen atoms of the alkyl group are replaced with deuterium atoms. Non-limiting exemplary C_1-10 alkyl groups include methyl (including —CD₃), ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, iso-butyl, 3-pentyl, hexyl, heptyl, octyl, nonyl, and decyl. Non-limiting exemplary C_1-4 alkyl groups include methyl, ethyl, propyl, isopropyl, butyl, sec-butyl, tert-butyl, and iso-butyl.

For the purpose of the present disclosure, the term “optionally substituted alkyl” as used by itself or as part of another group means that the alkyl as defined above is either unsubstituted or substituted with one, two, or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, allylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, carboxy, carboxyalkyl, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)allyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, or (heteroaryl)alkyl. The alkyl can be an optionally substituted C_1-4 alkyl. The optionally substituted alkyl can be substituted with two substituents, or one substituent. Non-limiting exemplary optionally substituted alkyl groups include —CH₂CH₂NO₂, —CH₂CH₂CO₂H, —CH₂CH₂SO₂CH₃, —CH₂CH₂COPh, and —CH₂C₆H₁₁.

For the purpose of the present disclosure, the term “alkylene” or “alkylenyl” refers to a divalent alkyl radical. Any of the above mentioned monovalent alkyl groups may be an alkylene by abstraction of a second hydrogen atom from the alkyl. The alkylene group may also be a C₁-C₆ alkylene or a C₁-C₄ alkylene. Non-limiting exemplary alkylene groups include, —CH₂—, —CH(CH₃)—, —C(CH₃)₂—, —CH₂CH₂—, —CH₂CH(CH₃)—, —CH₂C(CH₃)₂—, —CH₂CH₂CH₂—, and —CH₂CH₂CH₂CH₂—.

For the purpose of the present disclosure, the term “cycloalkyl” as used by itself or as part of another group refers to saturated and partially unsaturated (containing one or two double bonds) cyclic aliphatic hydrocarbons containing one to three rings having from three to twelve carbon atoms (i.e., C_3-12 cycloalkyl) or the number of carbons designated. The cycloalkyl group can have two rings, or one ring. The cycloalkyl group can be chosen from a C_3-8 cycloalkyl group and a C_3-6 cycloalkyl group. The cycloalkyl group can contain one or more carbon-to-carbon double bonds or one carbon-to-carbon double bond. Non-limiting exemplary cycloalkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, cyclooctyl, norbornyl, decalin, adamantyl, cyclohexenyl, and spiro[3.3]heptane.

For the purpose of the present disclosure, the term “optionally substituted cycloalkyl” as used by itself or as part of another group means that the cycloalkyl as defined above is either unsubstituted or substituted with one, two, or three substituents independently chosen from halo, nitro, cyan, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyallyl, alkoxy, haloalkoxy, aryloxy, aralkyl, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkynyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, or (heteroaryl)alkyl. The optionally substituted cycloalkyl can be substituted with two substituents or one substituent.

For the purpose of the present disclosure, the term “alkenyl” as used by itself or as part of another group refers to an alkyl group as defined above containing one, two or three carbon-to-carbon double bonds. The alkenyl group can be chosen from a C_2-6 alkenyl group and a C_2-4 alkenyl group. Non-limiting exemplary alkenyl groups include ethenyl, propenyl, isopropenyl, butenyl, sec-butenyl, pentenyl, and hexenyl.

For the purpose of the present disclosure, the term “optionally substituted alkenyl” as used herein by itself or as part of another group means the alkenyl as defined above is either unsubstituted or substituted with one, two or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, carboxy, carboxyalkyl, optionally substituted cycloalkyl optionally substituted aryl, optionally substituted heteroaryl, or optionally substituted heterocyclo.

For the purpose of the present disclosure, the term “alkynyl” as used by itself or as part of another group refers to an alkyl group as defined above containing one to three carbon-to-carbon triple bonds. The alkynyl can have one carbon-to-carbon triple bond. The alkynyl group can be chosen from a C_2-6 alkynyl group and a C_2-4 alkynyl group. Non-limiting exemplary alkynyl groups include ethynyl, propynyl, butynyl, 2-butynyl, pentynyl, and hexynyl groups.

For the purpose of the present disclosure, the term “optionally substituted alkynyl” as used herein by itself or as part of another group means the alkynyl as defined above is either unsubstituted or substituted with one, two or three substituents independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyloxy, allylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, carboxy, carboxyalkyl, cycloalkyl, aryl, heteroaryl, or heterocyclo.

For the purpose of the present disclosure, the term “haloalkyl” as used by itself or as part of another group refers to an alkyl group substituted by one or more fluorine, chlorine, bromine and/or iodine atoms. The alkyl group can be substituted by one, two, or three fluorine and/or chlorine atoms. The haloalkyl group can be chosen from a C_1-4 haloalkyl group. Non-limiting exemplary haloalkyl groups include fluoromethyl, difluoromethyl, trifluoromethyl, pentafluoroethyl, 1,1-difluoroethyl, 2,2-difluoroethyl, 2,2,2-trifluoroethyl, 3,3,3-trifluoropropyl, 4,4,4-trifluorobutyl, and trichloromethyl groups.

For the purpose of the present disclosure, the term “hydroxyalkyl” as used by itself or as part of another group refers to an alkyl group substituted with one or more, e.g., one, two, or three, hydroxy groups. The hydroxyalkyl group can be chosen from a monohydroxyalkyl group, i.e., substituted with one hydroxy group, a dihydroxyalkyl group, i.e., substituted with two hydroxy groups, and a C_1-4 hydroxyalkyl group. Non-limiting exemplary hydroxyalkyl groups include hydroxymethyl, hydroxyethyl, hydroxypropyl and hydroxybutyl groups, such as 1-hydroxyethyl, 2-hydroxyethyl, 1,2-dihydroxyethyl, 2-hydroxypropyl, 3-hydroxypropyl, 3-hydroxybutyl, 4-hydroxybutyl, 2-hydroxy-1-methylpropyl, and 1,3-dihydroxyprop-2-yl.

For the purpose of the present disclosure, the term “alkoxy” as used by itself or as part of another group refers to an optionally substituted alkyl, optionally substituted cycloalkyl, optionally substituted heterocyclo, optionally substituted alkenyl or optionally substituted alkynyl attached to a terminal oxygen atom. The alkoxy group can be chosen from a C_1-4 alkoxy group and a C_1-4 alkyl attached to a terminal oxygen atom, e.g., methoxy, ethoxy, and tert-butoxy.

For the purpose of the present disclosure, the term “alkylthio” as used by itself or as part of another group refers to a sulfur atom substituted by an optionally substituted alkyl group. The alkylthio group can be chosen from a C_1-4 alkylthio group. Non-limiting exemplary alkylthio groups include —SCR; (i.e., methylthio), and —SCH₂CH₃.

For the purpose of the present disclosure, the term “alkoxyalkyl” as used by itself or as part of another group refers to an alkyl group substituted with an alkoxy group. Non-limiting exemplary alkoxyalkyl groups include methoxymethyl, methoxyethyl, methoxypropyl, methoxybutyl, ethoxymethyl, ethoxyethyl, ethoxypropyl, ethoxybutyl, propoxymethyl, iso-propoxymethyl, propoxyethyl, propoxypropyl, butoxymethyl, tert-butoxymethyl, isobutoxymethyl, sec-butoxymethyl, and pentyloxymethyl.

For the purpose of the present disclosure, the term “halo” as used by itself or as part of another group refers to a halogen atom. Non-limiting exemplary halo groups include fluoro, chloro, bromo, and iodo.

For the purpose of the present disclosure, the term “haloalkoxy” as used by itself or as part of another group refers to a haloalkyl attached to a terminal oxygen atom. Non-limiting exemplary haloalkoxy groups include fluoromethoxy, difluoromethoxy, trifluoromethoxy, and 2,2,2-trifluoroethoxy.

For the purpose of the present disclosure, the term “heteroalkyl” as used by itself or part of another group refers to a stable straight or branched chain hydrocarbon radical containing 1 to 10 carbon atoms and at least two heteroatoms, which can be the same or different, selected from O, N, or S, wherein: 1) the nitrogen atom(s) and sulfur atom(s) can optionally be oxidized; and/or 2) the nitrogen atom(s) can optionally be quaternized. The heteroatoms can be placed at any interior position of the heteroalkyl group or at a position at which the heteroalkyl group is attached to the remainder of the molecule. The heteroalkyl group can contain two oxygen atoms, one oxygen and one nitrogen atom, or two nitrogen atoms. Non-limiting exemplary heteroalkyl groups include —CH₂OCH—₂CH₂OCH₃, —OCH₂CH₂OCH₂CH₂OCH₃, —CH₂NHCH₂CH₂OCH₂, —OCH₂CH₂NH₂, —NHCH₂CH₂N(H)CH₃, —NHCH₂CH₂OCH₃ and —OCH₂CH₂OCH₃.

For the purpose of the present disclosure, the term “aryl” as used by itself or as part of another group refers to a monocyclic or bicyclic aromatic ring system having from six to fourteen carbon atoms (i.e., C_6-14 aryl). The aryl group can be chosen from a C_6-14 aryl group and a C_6-10 aryl group. Non-limiting exemplary aryl groups include phenyl (abbreviated as “Ph”), naphthyl, phenanthryl, anthracyl, indenyl, azulenyl, biphenyl, biphenylenyl, and fluorenyl groups. The aryl group can be chosen from phenyl or naphthyl. The aryl group can be phenyl.

For the purpose of the present disclosure, the term “optionally substituted aryl” as used herein by itself or as part of another group means that the aryl as defined above is either unsubstituted or substituted with one to five substituents independently selected from the group consisting of halo, nitro, cyan, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, heteroaryloxy, aralkyl aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alknyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, (cycloalkylamino)alkyl, (C_1-4 haloalkoxy)alkyl, (heteroaryl)alkyl. The optionally substituted aryl can be an optionally substituted phenyl. The optionally substituted phenyl can have four substituents, three substituents, two substituents, or one substituent. The optionally substituted phenyl can have one amino, alkylamino, dialkylamino, (amino)alkyl, (alkylamino)alkyl, or (dialkylamino)alkyl substituent. Non-limiting exemplary substituted aryl groups include 2-methylphenyl, 2-methoxyphenyl, 2-fluorophenyl, 2-chlorophenyl, 2-bromophenyl, 3-methylphenyl, 3-methoxyphenyl, 3-fluorophenyl, 3-chlorophenyl, 4-methylphenyl, 4-ethylphenyl, 4-methoxyphenyl, 4-fluorophenyl, 4-chlorophenyl, 2,6-di-fluorophenyl, 2,6-di-chlorophenyl, 2-methyl, 3-methoxyphenyl, 2-ethyl, 3-methoxyphenyl, 3,4-di-methoxyphenyl, 3,5-di-fluorophenyl 3,5-di-methylphenyl, 3,5-dimethoxy, 4-methylphenyl, 2-fluoro-3-chlorophenyl, 3-chloro-4-fluorophenyl, and 2-phenylpropan-2-amine. The term optionally substituted aryl is meant to include groups having fused optionally substituted cycloalkyl and fused optionally substituted heterocyclo rings. Examples include:

For the purpose of the present disclosure, the term “aryloxy” as used by itself or as part of another group refers to an optionally substituted aryl attached to a terminal oxygen atom. A non-limiting exemplary aryloxy group is PhO—.

For the purpose of the present disclosure, the term “heteroaryloxy” as used by itself or as part of another group refers to an optionally substituted heteroaryl attached to a terminal oxygen atom.

For the purpose of the present disclosure, the term “aralkyloxy” or “arylalkyloxy” as used by itself or as part of another group refers to an aralkyl group attached to a terminal oxygen atom. A non-limiting exemplary aralkyloxy group is PhCH₂O—.

For the purpose of the present disclosure, the term “heteroaryl” or “heteroaromatic” refers to monocyclic and bicyclic aromatic ring systems having 5 to 14 ring atoms (i.e., C_5-14 heteroaryl) and 1, 2, 3, or 4 heteroatoms independently chosen from oxygen, nitrogen or sulfur. The heteroaryl group can be chosen from a C_5-14 heteroaryl group and a C_3-6 heteroaryl group. The heteroaryl can have three heteroatoms, two heteroatoms, or one heteroatom. The heteroaryl can be a C₅ heteroaryl, or a C₆ heteroaryl. Non-limiting exemplary heteroaryl groups include thienyl, benzo[b]thienyl, naphtho[2,3-b]thienyl, thianthrenyl, furyl, benzofuryl, pyranyl, isobenzofuranyl, benzooxazonyl, chromenyl, xanthenyl, 2H-pyrrolyl, pyrrolyl, imidazolyl, pyrazolyl, pyridyl, pyrazinyl, pyrimidinyl, pyridazinyl, isoindolyl, 3H-indolyl, indolyl, indazolyl, purinyl, isoquinolyl, quinolyl, phthalazinyl, naphthyridinyl, cinnolinyl, quinazolinyl, pteridinyl, 4aH-carbazolyl, carbazolyl, β-carbolinyl, phenanthridinyl, acridinyl, phenanthrolinyl, phenazinyl, thiazolyl, isothiazolyl, phenothiazolyl, isoxazolyl, furazanyl, triazolyl, tetrazolyl, and phenoxazinyl. The heteroaryl can be chosen from thienyl (e.g., thien-2-yl and thien-3-yl), furyl (e.g., 2-furyl and 3-furyl), pyrrolyl (e.g., 1H-pyrrol-2-yl and 1H-pyrrol-3-yl), imidazolyl (e.g., 2H-imidazol-2-yl and 2H-imidazol-4-yl), pyrazolyl (e.g., 1H-pyrazol-3-yl, 1H-pyrazol-4-yl, and 1H-pyrazol-5-yl), pyridyl (e.g., pyridin-2-yl, pyridin-3-yl, and pyridin-4-yl), pyrimidinyl (e.g., pyrimidin-2-yl, pyrimidin-4-yl, and pyrimidin-5-yl), thiazolyl (e.g., thiazol-2-yl, thiazol-4-yl, and thiazol-5-yl), isothiazolyl (e.g., isothiazol-3-yl, isothiazol-4-yl, and isothiazol-5-yl), oxazolyl (e.g., oxazol-2-yl, oxazol-4-yl, and oxazol-5-yl) isoxazolyl (e.g., isoxazol-3-yl, isoxazol-4-yl, and isoxazol-5-yl), triazolyl (e.g., 1,2,4-triazolyl and 1,2,3-triazolyl). The term “heteroaryl” is also meant to include possible N-oxides. Exemplary N-oxides include pyridyl N-oxide.

For the purpose of the present disclosure, the term “optionally substituted heteroaryl” as used by itself or as part of another group means that the heteroaryl as defaced above is either unsubstituted or substituted with one to four substituents, e.g., one or two substituents, independently chosen from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aralkyl aryloxy, aralkyloxy, allylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, carboxy, carboxyalkyl, alkyl, optionally substituted cycloalkyl, alkenyl, alkenyl, optionally substituted aryl, optionally substituted heteroaryl, optionally substituted heterocyclo, alkoxyalkyl, (amino)allyl hydroxyalkylamino, (allylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)allyl, mercaptoalkyl, (heterocyclo)alkyl, (heteroaryl)alkyl, —N(R³³)(R³⁴), or —N(H)C(═O)—R³⁵, wherein R³³ is hydrogen or C_1-4 alkyl; R³⁴ is alkoxyalkyl, (heterocyclo)alkyl, (amino)alkyl, (alkylamino)allyl, or (dialkylamino)allyl; and R³⁵ is alkyl, optionally substituted aryl, or optionally substituted heteroaryl. The optionally substituted heteroaryl can have one substituent. The substituent can be amino, alkylamino, dialkylamino, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (heterocyclo)alkyl, —N(R³³)(R³⁴), or —N(H)C(═O)—R³⁵. The optionally substituted heteroaryl can be an optionally substituted pyridyl, i.e., 2-, 3-, or 4-pyridyl. Any available carbon or nitrogen atom can be substituted.

For the purpose of the present disclosure, the term “heterocycle” or “heterocyclo” as used by itself or as part of another group refers to saturated and partially unsaturated (e.g., containing one or two double bonds) cyclic groups containing one, two, or three rings having from three to fourteen ring members (i.e., a 3- to 14-membered heterocyclo) and at least one heteroatom. The heterocyclo group can be chosen from a C_3-14 heterocyclo group and a C_3-8 heterocyclo group. Each heteroatom is independently selected from the group consisting of oxygen, sulfur, including sulfoxide and sulfone, and/or nitrogen atoms, which can be quaternized. The term “heterocyclo” is meant to include cyclic ureido groups such as imidazolidinyl-2-one, cyclic amide groups such as β-lactam, γ-lactam, δ-lactam and ε-lactam, and cyclic carbamate groups such as oxazolidinyl-2-one. The term “heterocyclo” is also meant to include groups having fused optionally substituted aryl groups, e.g., indolinyl, indolinyl-2-one, benzo[d]oxazolyl-2(3H)-one. The term “heterocyclo” is also meant to include groups having fused optionally substituted heteroaryl groups, e.g., 5,6,7,8-tetrahydroimidazo[1,5-a]pyrazine. The heterocycle group can be chosen from a 4-, 5-, 6-, 7- or 8-membered cyclic group containing one ring and one or two oxygen and/or nitrogen atoms, a 5- or 6-membered cyclic group containing one ring and one or two nitrogen atoms, an 8-, 9-, 10-, 11-, or 12-membered cyclic group containing two rings and one or two nitrogen atoms. The heterocyclo can be optionally linked to the rest of the molecule through a carbon or nitrogen atom. Non-limiting exemplary heterocyclo groups include 2-oxopyrrolidin-3-yl, 2-imidazolidinone, piperidinyl, morpholinyl, piperazinyl, pyrrolidinyl, azetidinyl, 8-azabicyclo[3.2.1]octane (nortropane), 6-azaspiro[2.5]octane, 6-azaspiro[3.4]octane, indolinyl, indolinyl-2-one, 1,3-dihydro-2H-benzo[d]imidazol-2-one.

For the purpose of the present disclosure, the term “optionally substituted heterocyclo” as used herein by itself or part of another group means the heterocyclo as defined above is either unsubstituted or substituted with one to four substituents independently selected from halo, nitro, cyano, hydroxy, amino, alkylamino, dialkylamino, haloalkyl, hydroxyalkyl, alkoxy, haloalkoxy, aryloxy, aralkyl aralkyloxy, alkylthio, carboxamido, sulfonamido, alkylcarbonyl, arylcarbonyl, alkylsulfonyl, arylsulfonyl, carboxy, carboxyalkyl, alkyl, cycloalkyl, alkenyl, alkynyl, aryl, heteroaryl, heterocyclo, alkoxyalkyl, (amino)alkyl, hydroxyalkylamino, (alkylamino)alkyl, (dialkylamino)alkyl, (cyano)alkyl, (carboxamido)alkyl, mercaptoalkyl, (heterocyclo)alkyl, and (heteroaryl)alkyl. Substitution may occur on any available carbon or nitrogen atom, and may form a spirocycle.

For the purpose of the present disclosure, the term “amino” as used by itself or as part of another group refers to —NH₂.

For the purpose of the present disclosure, the term “alkylamino” as used by itself or as part of another group refers to —NHR³⁶, wherein R³⁶ is C_1-6 alkyl. R³⁶ can be C_1-4 alkyl. Non-limiting exemplary alkylamino groups include —N(H)CH₃ and —N(H)CH₂CH₃.

For the purpose of the present disclosure, the term “dialkylamino” as used by itself or as part of another group refers to —NR^37aR^37b, wherein R^37a and R^37b are each independently C_1-6 alkyl. R^37a and R^37b can each independently be C_1-4 alkyl Non-limiting exemplary dialkylamino groups include —N(CH₃)₂ and —N(CH₃)CH₂CH(CH₃)₂.

For the purpose of the present disclosure, the term “hydroxyalkylamino” as used by itself or as part of another group refers to —NHR³⁸, wherein R³⁸ is hydroxyalkyl.

For the purpose of the present disclosure, the term “cycloalkylamino” as used by itself or as part of another group refers to —NR^39aR^39b, wherein R^39a is optionally substituted cycloalkyl and R^39b is hydrogen or C_1-4 alkyl.

For the purpose of the present disclosure, the term “aralkylamino” as used by itself or as part of another group refers to —NR^40aR^40b, wherein R^40a is aralkyl and R^40b is hydrogen or C_1-4 alkyl. Non-limiting exemplary aralkylamino groups include —N(H)CH₂Ph and —N(CH₃)CH₂Ph.

For the purpose of the present disclosure, the term “(amino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with an amino group. The alkyl can be a C_1-4 alkyl Non-limiting exemplary (amino)alkyl groups include —CH₂NH₂, —C(NH₂)(H)CH₃, —CH₂CH₂NH₂, —CH₂C(NH₂)(H)CH₃, —CH₂CH₂CH₂NH₂, —CH₂CH₂CH₂CH₂NH₂, and —CH₂C(CH₃)₂CH₂NH₂

For the purpose of the present disclosure, the term “(alkylamino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with an alkylamino group. The alkyl can be a C_1-4 alkyl. A non-limiting exemplary (alkylamino)alkyl group is —CH₂CH₂N(H)CH₃.

For the purpose of the present disclosure, the term “(dialkylamino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted by a dialkylamino group. The alkyl can be a C_1-4 alkyl Non-limiting exemplary (dialkylamino)alkyl groups are —CH₂CH₂N(CH₃)₂.

For the purpose of the present disclosure, the term “(cycloalkylamino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted by a cycloalkylamino group. The alkyl can be a C_1-4 alkyl. Non-limiting exemplary (cycloalkylamino)alkyl groups include —CH₂N(H)cyclopropyl, —CH₂N(H)cyclobutyl and —CH₂N(H)cyclohexyl.

For the purpose of the present disclosure, the term “(aralkylamino)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with an aralkylamino group. The alkyl can be a C_1-4 alkyl A non-limiting exemplary (aralkylamino)alkyl group is —CH₂CH₂CH₂N(H)CH₂Ph.

For the purpose of the present disclosure, the term “(cyano)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one or more cyano, e.g., —CN, groups. The alkyl can be a C_1-4 alkyl. Non-limiting exemplary (cyano)alkyl groups include —CH₂CH₂CN, —CH₂CH₂CH₂CN, and —CH₂CH₂CH₂CH₂CN.

For the purpose of the present disclosure, the term “(amino)(hydroxy)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one amino, alkylamino, or dialkylamino group and one hydroxy group. The alkyl is a C_1-6 alkyl or a C_1-4 alkyl.

For the purpose of the present disclosure, the term “(amino)(aryl)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one amino, alkylamino, or dialkylamino group and one optionally substituted aryl group. The alkyl can be a C_1-6 alkyl. The optionally substituted aryl group can be an optionally substituted phenyl.

For the purpose of the present disclosure, the term “(cycloalkyl)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one optionally substituted cycloalkyl group. The alkyl can be a C_1-4 alkyl or a C_3-6 cycloalkyl. The optionally substituted cycloalkyl group can be substituted with an amino or (amino)alkyl group.

For the purpose of the present disclosure, the term “(hydroxy)(aryl)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one hydroxy group and one optionally substituted aryl group. The alkyl can be a C_1-6 alkyl. The optionally substituted aryl group can be an optionally substituted phenyl. Non-limiting exemplary (hydroxy)(aryl)alkyl groups include:

For the purpose of the present disclosure, the term “carboxamido” as used by itself or as part of another group refers to a radical of formula —C(═O))NR^41aR^41b, wherein R^41a and R^41b are each independently hydrogen, optionally substituted alkyl, optionally substituted aryl, or optionally substituted heteroaryl, or R^41a and R^41b taken together with the nitrogen to which they are attached from a 3- to 8-membered heterocyclo group. R^41a and R^41b can each independently be hydrogen or optionally substituted allyl. Non-limiting exemplary carboxamido groups include —CONH₂, —CON(H)CH₃, —CON(CH₃)₂, and —CON(H)Ph.

For the purpose of the present disclosure, the term “(carboxamido)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with a carboxamido group. Non-limiting exemplary (carboxamido)alkyl groups include —CH₂CONH₂, —C(H)CH₃—CONH₂, and —CH₂CON(H)CH₃.

For the purpose of the present disclosure, the term “sulfonamido” as used by itself or as part of another group refers to a radical of the formula —SO₂NR^42aR^42b, wherein R^42a and R^42b are each independently hydrogen, optionally substituted alkyl, or optionally substituted aryl, or R^42a and R^42b taken together with the nitrogen to which they are attached from a 3- to 8-membered heterocyclo group. Non-limiting exemplary sulfonamido groups include —SO₂NH₂, —SO₂N(H)CH₃, and —SO₂N(H)Ph.

For the purpose of the present disclosure, the term “alkylcarbonyl” as used by itself or as part of another group refers to a carbonyl group, i.e., —C(═O)—, substituted by an alkyl group. A non-limiting exemplary alkylcarbonyl group is —COCH₃.

For the purpose of the present disclosure, the term “arylcarbonyl” as used by itself or as part of another group refers to a carbonyl group. i.e., —C(═O)—, substituted by an optionally substituted aryl group. A non-limiting exemplary arylcarbonyl group is —COPh.

For the purpose of the present disclosure, the term “alkylsulfonyl” as used by itself or as part of another group refers to a sulfonyl group, i.e., —SO₂—, substituted by any of the above-mentioned optionally substituted alkyl groups. Non-limiting exemplary alkylsulfonyl groups are —SO₂CH₃ (i.e., methylsulfonyl) and —SO₂CH₂CH₃ (i.e., ethylsulfonyl).

For the purpose of the present disclosure, the term “arylsulfonyl” as used by itself or as part of another group refers to a sulfonyl group, i.e., —SO₂—, substituted by any of the above-mentioned optionally substituted aryl groups. A non-limiting exemplary arylsulfonyl group is —SO₂Ph.

For the purpose of the present disclosure, the term “mercaptoalkyl” as used by itself or as part of another group refers to any of the above-mentioned alkyl groups substituted by a —SH group.

For the purpose of the present disclosure, the term “carboxy” as used by itself or as part of another group refers to a radical of the formula —COOH.

For the purpose of the present disclosure, the term “carboxyalkyl” as used by itself or as part of another group refers to any of the above-mentioned alkyl groups substituted with a —COOH. A non-limiting exemplary carboxyalkyl group is —CH₂CO₂H.

For the purpose of the present disclosure, the term “alkoxycarbonyl” as used by itself or as part of another group refers to a carbonyl group, i.e., —C(═O)—, substituted by an alkoxy group. Non-limiting exemplary alkoxycarbonyl groups are —CO₂Me and —CO₂Et.

For the purpose of the present disclosure, the term “aralkyl” or “arylalkyl” as used by itself or as part of another group refers to an alkyl group substituted with one, two, or three optionally substituted aryl groups. The aralkyl group can be a C_1-4 alkyl substituted with one optionally substituted aryl group. Non-limiting exemplary aralkyl groups include benzyl, phenethyl, —CHPh₂, —CH₂(4-OH-Ph), and —CH(4-F-Ph)₂.

For the purpose of the present disclosure, the term “(heterocyclo)allyl” as used by itself or as part of another group refers to an alkyl group substituted with one, two, or three optionally substituted heterocyclo groups. The (heterocyclo)alkyl can be a C_1-4 alkyl substituted with one optionally substituted heterocyclo group. The heterocyclo can be linked to the alkyl group through a carbon or nitrogen atom. Non-limiting exemplary (heterocyclo)alkyl groups include:

For the purpose of the present disclosure, the term “heteroaralkyl” or “(heteroaryl)alkyl” as used by itself or as part of another group refers to an alkyl group substituted with one, two, or three optionally substituted heteroaryl groups. The (heteroaryl)alkyl group can be a C_1-4 alkyl substituted with one optionally substituted heteroaryl group. Non-limiting exemplary (heteroaryl)alkyl groups include:

For the purpose of the present disclosure, the term “alkylcarbonylamino” as used by itself or as part of another group refers to an alkylcarbonyl group attached to an amino. A non-limiting exemplary alkylcarbonylamino group is —NHCOCH₃.

The present disclosure encompasses any of the Compounds of the Disclosure being isotopically-labelled (i.e., radiolabeled) by having one or more atoms replaced by an atom having a different atomic mass or mass number. Examples of isotopes that can be incorporated into the disclosed compounds include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine and chlorine, such as ²H (or deuterium (D)), ³H, ¹¹C, ¹³C, ¹⁴C, ¹⁵N, ¹⁸O, ¹⁷O, ³¹P, ³²P, ³⁵S, ¹⁸F, and ³⁶Cl, respectively, e.g., ³H, ¹¹C, and ¹⁴C. The present disclosure also provides a composition wherein substantially all of the atoms at a position within the Compound of the Disclosure are replaced by an atom having a different atomic mass or mass number. The present disclosure also provides a composition wherein a portion of the atoms at a position within the Compound of the disclosure are replaced, i.e., the Compound of the Disclosure is enriched at a position with an atom having a different atomic mass or mass number. In one embodiment, the present disclosure provides a composition wherein a Compound of the Disclosure has from 1 to 8 hydrogens replaced with deuterium. Isotopically-labelled Compounds of the Disclosure can be prepared by methods known in the art.

Compounds of the Disclosure may contain one or more asymmetric centers and may thus give rise to enantiomers, diastereomers, and other stereoisomeric forms. The present disclosure is meant to encompass the use of all such possible forms, as well as their racemic and resolved forms and mixtures thereof. The individual enantiomers can be separated according to methods known in the art in view of the present disclosure. When the compounds described herein contain olefinic double bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that they include both E and Z geometric isomers. All tautomers are intended to be encompassed by the present disclosure as well.

As used herein, the term “stereoisomers” is a general term for all isomers of individual molecules that differ only in the orientation of their atoms in space. It includes enantiomers and isomers of compounds with more than one chiral center that are not mirror images of one another (diastereomers).

The term “chiral center” or “asymmetric carbon atom” refers to a carbon atom to which four different groups are attached.

The terms “enantiomer” and “enantiomeric” refer to a molecule that cannot be superimposed on its mirror image and hence is optically active wherein the enantiomer rotates the plane of polarized light in one direction and its mirror image compound rotates the plane of polarized light in the opposite direction.

The term “racemic” refers to a mixture of equal parts of enantiomers and which mixture is optically inactive.

The term “absolute configuration” refers to the spatial arrangement of the atoms of a chiral molecular entity (or group) and its stereochemical description. e.g., R or S.

The stereochemical terms and conventions used in the specification are meant to be consistent with those described in Pure & Appl. Chem 68:2193 (1996), unless otherwise indicated.

The term “enantiomeric excess” or “ee” refers to a measure for how much of one enantiomer is present compared to the other. For a mixture of R and S enantiomers, the percent enantiomeric excess is defined as |R−S|*100, where R and S are the respective mole or weight fractions of enantiomers in a mixture such that R+S=1. With knowledge of the optical rotation of a chiral substance, the percent enantiomeric excess is defined as ([α]_obs/[α]_max)*100, where [α]_obs is the optical rotation of the mixture of enantiomers and [α]_max is the optical rotation of the pure enantiomer. Determination of enantiomeric excess is possible using a variety of analytical techniques, including NMR spectroscopy, chiral column chromatography or optical polarimetry.

The terms “enantiomerically pure” or “enantiopure” refer to a sample of a chiral substance all of whose molecules (within the limits of detection) have the same chirality sense.

The terms “enantiomerically enriched” or “enantioenriched” refer to a sample of a chiral substance whose enantiomeric ratio is greater than 50:50. Enantiomerically enriched compounds may be enantiomerically pure.

It is understood that embodiments of the invention described herein include “consisting” and/or “consisting essentially of” embodiments. As used herein, the singular form “a,” “an,” and “the” includes plural references unless indicated otherwise. Use of the term “or” herein is not meant to imply that alternatives are mutually exclusive.

In this application, the use of “or” means “and/or” unless expressly stated or understood by one skilled in the art. In the context of a multiple dependent claim, the use of “or” refers back to more than one preceding independent or dependent claim.

The term “about,” as used herein, includes the recited number ±10%. Thus, “about 10” means 9 to 11. As is understood by one skilled in the art, reference to “about” a value or parameter herein includes (and describes) instances that are directed to that value or parameter per se. For example, description referring to “about X” includes description of “X.”

The present disclosure encompasses the preparation and use of salts of the Compounds of the Disclosure, including non-toxic pharmaceutically acceptable salts. Examples of pharmaceutically acceptable addition salts include inorganic and organic acid addition salts and basic salts. The pharmaceutically acceptable salts include, but are not limited to, metal salts such as sodium salt, potassium salt, cesium salt and the like; alkaline earth metals such as calcium salt, magnesium salt and the like; organic amine salts such as triethylamine salt, pyridine salt, picoline salt, ethanolamine salt, triethanolamine salt, dicyclohexylamine salt, N,N′-dibenzylethylenediamine salt and the like: inorganic acid salts such as hydrochloride, hydrobromide, phosphate, sulphate and the like; organic acid salts such as citrate, lactate, tartrate, maleate, fumarate, mandelate, acetate, dichloroacetate, trifluoroacetate, oxalate, formate and the like; sulfonates such as methanesulfonate, benzenesulfonate, p-toluenesulfonate and the like; and amino acid salts such as arginate, asparginate, glutamate and the like. The term “pharmaceutically acceptable salt” as used herein, refers to any salt, e.g., obtained by reaction with an acid or a base, of a Compound of the Disclosure that is physiologically tolerated in the target patient (e.g., a mammal, e.g., a human).

Acid addition salts can be formed by mixing a solution of the particular Compound of the Disclosure with a solution of a pharmaceutically acceptable non-toxic acid such as hydrochloric acid, fumaric acid, maleic acid, succinic acid, acetic acid, citric acid, tartaric acid, carbonic acid, phosphoric acid, oxalic acid, dichloroacetic acid, or the like. Basic salts can be formed by mixing a solution of the compound of the present disclosure with a solution of a pharmaceutically acceptable non-toxic base such as sodium hydroxide, potassium hydroxide, choline hydroxide, sodium carbonate and the like.

The present disclosure encompasses the preparation and use of solvates of Compounds of the Disclosure. Solvates typically do not significantly alter the physiological activity or toxicity of the compounds, and as such may function as pharmacological equivalents. The term “solvate” as used herein is a combination, physical association and/or solvation of a compound of the present disclosure with a solvent molecule such as, e.g. a disolvate, monosolvate or hemisolvate, where the ratio of solvent molecule to compound of the present disclosure is about 2:1, about 1:1 or about 1:2, respectively. This physical association involves varying degrees of ionic and covalent bonding, including hydrogen bonding. In certain instances, the solvate can be isolated, such as when one or more solvent molecules are incorporated into the crystal lattice of a crystalline solid. Thus, “solvate” encompasses both solution-phase and isolatable solvates. Compounds of the Disclosure can be present as solvated forms with a pharmaceutically acceptable solvent, such as water, methanol, ethanol, and the like, and it is intended that the disclosure includes both solvated and unsolvated forms of Compounds of the Disclosure. One type of solvate is a hydrate. A “hydrate” relates to a particular subgroup of solvates where the solvent molecule is water. Solvates typically can function as pharmacological equivalents. Preparation of solvates is known in the art. See, for example, M. Caira et al, J. Pharmaceut. Sci., 93(3):601-611 (2004), which describes the preparation of solvates of fluconazole with ethyl acetate and with water. Similar preparation of solvates, hemisolvates, hydrates, and the like are described by E. C. van Tonder et al., AAPS Pharm Sci. Tech., 5(1):Article 12 (2104), and A. L. Bingham et al., Chem. Commun. 603-604 (2001). A typical, non-limiting, process of preparing a solvate would involve dissolving a Compound of the Disclosure in a desired solvent (organic, water, or a mixture thereof) at temperatures above 20° C. to about 25° C. then cooling the solution at a rate sufficient to form crystals, and isolating the crystals by known methods, e.g., filtration. Analytical techniques such as infrared spectroscopy can be used to confirm the presence of the solvent in a crystal of the solvate.

Since Compounds of the Disclosure are inhibitors of USP1 proteins, the present disclosure provides a method for inhibiting a USP1 protein comprising contacting a USP1 protein or a composition comprising a USP1 protein with one or more Compounds of the Disclosure.

Since Compounds of the Disclosure are inhibitors of USP1 proteins, a number of diseases, conditions, or disorders mediated by USP1 proteins can be treated by employing these compounds. The present disclosure is thus directed generally to a method for treating a disease, condition, or disorder responsive to the inhibition of USP1 proteins in an animal suffering from, or at risk of suffering from, the disorder, the method comprising administering to the animal an effective amount of one or more Compounds of the Disclosure.

The present disclosure is further directed to a method of inhibiting USP1 proteins in an animal in need thereof, the method comprising administering to the animal a therapeutically effective amount of at least one Compound of the Disclosure.

As used herein, “treatment” is an approach for obtaining beneficial or desired clinical results. “Treatment” as used herein, covers any administration or application of a therapeutic for disease in a mammal, including a human. For purposes of this disclosure, beneficial or desired clinical results include, but are not limited to, any one or more of: alleviation of one or more symptoms, diminishment of extent of disease, preventing or delaying spread (for example, metastasis) of disease, preventing or delaying recurrence of disease, delay or slowing of disease progression, amelioration of the disease state, inhibiting the disease or progression of the disease, inhibiting or slowing the disease or its progression, arresting its development, and remission (whether partial or total). Also encompassed by “treatment” is a reduction of pathological consequence of a proliferative disease. The methods provided herein contemplate any one or more of these aspects of treatment. In-line with the above, the term treatment does not require one-hundred percent removal of all aspects of the disorder.

In the context of cancer, the term “treating” includes, but is not limited to, inhibiting growth of cancer cells, inhibiting replication of cancer cells, lessening of overall tumor burden, and delaying, halting, or slowing tumor growth, progression, or metastasis.

As used herein, “delaying” means to defer, hinder, slow, retard, stabilize, suppress and/or postpone development or progression of the disease (such as cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or individual being treated.

A “therapeutically effective amount” of a substance can vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the substance to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the substance are outweighed by the therapeutically beneficial effects. A therapeutically effective amount can be delivered in one or more administrations. A therapeutically effective amount refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic effect.

The terms “administer,” “administering,” “administration,” and the like refer to methods that can be used to enable delivery of the therapeutic agent to the desired site of biological action. Administration techniques that can be employed with the agents and methods described herein are found in e.g., Goodman and Gilman, The Pharmacological Basis of Therapeutics, current ed.; Pergamon; and Remington's, Pharmaceutical Sciences (current edition), Mack Publishing Co., Easton. Pa.

The terms “pharmaceutical formulation” and “pharmaceutical composition” refer to a preparation which is in such form as to permit the biological activity of the active ingredient(s) to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered. Such formulations may be sterile.

A “pharmaceutically acceptable carrier” refers to a non-toxic solid, semisolid, or liquid filler, diluent, encapsulating material, formulation auxiliary, or carrier conventional in the art for use with a therapeutic agent that together comprise a “pharmaceutical composition” for administration to a subject. A pharmaceutically acceptable carrier is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation. The pharmaceutically acceptable carrier is appropriate for the formulation employed.

A “sterile” formulation is aseptic or essentially free from living microorganisms and their spores.

The term “container” means any receptacle and closure therefore suitable for storing, shipping, dispensing, and/or handling a pharmaceutical product.

The term “insert” or “package insert” means information accompanying a pharmaceutical product that provides a description of how to administer the product, along with the safety and efficacy data required to allow the physician, pharmacist, and patient to make an informed decision regarding use of the product. The package insert generally is regarded as the “label” for a pharmaceutical product.

The term “disease” or “condition” or “disorder” as used herein refers to a condition where treatment is needed and/or desired and denotes disturbances and/or anomalies that as a rule are regarded as being pathological conditions or functions, and that can manifest themselves in the form of particular signs, symptoms, and/or malfunctions. As demonstrated below, Compounds of the Disclosure inhibit USP1 proteins and can be used in treating diseases and conditions such as proliferative diseases, wherein inhibition of USP1 proteins provides a benefit.

The terms “polypeptide” and “protein” are used interchangeably to refer to a polymer of amino acid residues and are not limited to a minimum length. Such polymers of amino acid residues may contain natural or non-natural amino acid residues, and include, but are not limited to, peptides, oligopeptides, dimers, trimers, and multimers of amino acid residues. Both full-length proteins and fragments thereof are encompassed by the definition. The terms also include post-expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, phosphorylation, and the like. Furthermore, for purposes of the present disclosure, a “polypeptide” refers to a protein which includes modifications, such as deletions, additions, and substitutions (generally conservative in nature), to the native sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR amplification.

“USP1” and “ubiquitin-specific-processing protease 1” as used herein refer to any native polypeptide or USP1-encoding polynucleotide. The term “USP1” encompasses “full-length,” unprocessed USP1 pot/peptide as well as any forms of USP1 that result from processing within the cell (e.g., removal of the signal peptide). The term also encompasses naturally occurring variants of USP1, e.g., those encoded by splice variants and allelic variants. The USP1 polypeptides described herein can be isolated from a variety of sources, such as from human tissue types or from another source, or prepared by recombinant or synthetic methods. Human USP1 sequences are known and include, for example, the sequences publicly available as UniProt No. 094782 (including isoforms). As used herein, the term “human USP1 protein” refers to USP1 protein comprising the amino acid sequence as set forth in SEQ ID NO:1 in U.S. provisional patent application no. 62%857,986 filed Jun. 6, 2019.

USP1 is a deubiquitinating enzyme that acts as part of a complex with UAF1. USP1's “deubiquitinase activity” includes its ability to deubiquitinate as part of the USP1-UAF1 complex.

The term “specifically binds” to a protein or domain of a protein is a term that is well understood in the art, and methods to determine such specific binding are also well known in the art. A molecule is said to exhibit “specific binding” or “preferential binding” if it reacts or associates more frequently, more rapidly, with greater duration and/or with greater affinity with a particular protein or domain of a protein than it does with alternative proteins or domains. It should be understood that a molecule that specifically or preferentially binds to a first protein or domain may or may not specifically or preferentially bind to a second protein or domain. As such, “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding. Generally, but not necessarily, reference to binding means preferential binding. For example, a USP1 inhibitor that specifically binds to USP1, UAF1, and/or the USP1-UAF1 complex may not bind to other deubiquitinases, other USP proteins, or other UAF1 complexes (e.g., USP46-UAF1) or may bind to other deubiquitinases, other USP proteins, or other UAF1 complexes (e.g., USP46-UAF1) with a reduced affinity as compared to binding to USP1.

The terms “reduction” or “reduce” or “inhibition” or “inhibit” refer to a decrease or cessation of any phenotypic characteristic or to the decrease or cessation in the incidence, degree, or likelihood of that characteristic. To “reduce” or “inhibit” is to decrease, reduce or arrest an activity, function, and/or amount as compared to a reference. In some embodiments, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 20% or greater. In some embodiments, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 50% or greater. In some embodiments, by “reduce” or “inhibit” is meant the ability to cause an overall decrease of 75%, 85%, 90%, 95%, or greater. In some embodiments, the amount noted above is inhibited or decreased over a period of time, relative to a control over the same period of time.

In some embodiments inhibiting USP1 proteins is the inhibition of one or more activities or functions of USP1 proteins. It should be appreciated that the activity or function of the one or more USP1 proteins may be inhibited in vitro or in vivo. Non-limiting examples of activities and functions of USP1 include deubiquitinase activity, and formation of a complex with UAF1 and are described herein. Exemplary levels of inhibition of the activity of one or more USP1 proteins include at least 10% inhibition, at least 20% inhibition, at least 30% inhibition, at least 40% inhibition, at least 50% inhibition, at least 60% inhibition, at least 70% inhibition, at least 80% inhibition, at least 90% inhibition, and up to 100% inhibition.

The terms “individual” or “subject” are used interchangeably herein to refer to an animal; for example, a mammal, such as a human. In some instances, methods of treating mammals, including, but not limited to, humans, rodents, simians, felines, canines, equines, bovines, porcines, ovines, caprines, mammalian laboratory animals, mammalian farm animals, mammalian sport animals, and mammalian pets, are provided. In some examples, an “individual” or “subject” refers to an individual or subject in need of treatment for a disease or disorder. In some instances, the subject to receive the treatment can be a patient, designating the fact that the subject has been identified as having a disorder of relevance to the treatment, or being at particular risk of contracting the disorder.

As used herein, the terms “cancer” and “tumor” refer to or describe the physiological condition in mammals in which a population of cells are characterized by unregulated cell growth. The terms encompass solid and hematological/lymphatic cancers. Examples of cancer include but are not limited to, DNA damage repair pathway deficient cancers. Additional examples of cancer include, but are not limited to, ovarian cancer, breast cancer (including triple negative breast cancer), non-small cell lung cancer (NSCLC), and osteosarcoma. The cancer can be BRCA1 or BRCA2 wildtype. The cancer can also be BRCA1 or BRCA2 mutant. The cancer can further be a P ARP inhibitor resistant or refractory cancer, or a PARP inhibitor resistant or refractory BRCA1 or BRCA2-mutant cancer.

As used herein, the term “loss of function” mutation refers to a mutation that that results in the absence of a gene, decreased expression of a gene, or the production of a gene product (e.g. protein) having decreased activity or no activity. Loss of function mutations include for example, missense mutations, nucleotide insertions, nucleotide deletions, and gene deletions. Loss of function mutations also include dominant negative mutations. Thus, cancer cells with a loss of function mutation in a gene encoding p53 include cancer cells that contain missense mutations in a gene encoding p53 as well as cancer cells that lack a gene encoding p53.

USP1 Inhibitors

In various embodiments, the Compounds of the Disclosure are USP1 inhibitors that reduce the level of USP1 protein and/or inhibit or reduce at least one biological activity of USP1 protein.

In some embodiments, the Compounds of the Disclosure specifically bind to USP1 protein. In some embodiments, the Compounds of the Disclosure specifically bind to USP1 protein in a USP1-UAF1 complex. In some embodiments, the Compounds of the Disclosure specifically bind to USP1 mRNA. In some embodiments, the Compounds of the Disclosure specifically bind to USP1 protein (alone or in a USP1-UAF1 complex) or USP1 mRNA. In some embodiments, the Compounds of the Disclosure specifically bind to UAF1 (alone or in a USP1-UAF1 complex) and inhibit or reduces formation or activity of the USP1-UAF1 complex.

In some embodiments, the Compounds of the Disclosure decrease the formation of the USP1-UAF1 complex. In some embodiments, the Compounds of the Disclosure decrease the activity of the USP1-UAF1 complex. In some embodiments, the Compounds of the Disclosure decrease the deubiquitinase activity of USP1. In some embodiments, the Compounds of the Disclosure increase mono-ubiquitinated PCNA. In some embodiments, the Compounds of the Disclosure increase mono-ubiquitinated FANCD2. In some embodiments, the Compounds of the Disclosure increase mono-ubiquitinated FANCI.

In some embodiments, the Compounds of the Disclosure do not bind to other deubiquitinases, other USP proteins, or other UAF1 complexes (e.g., USP46-UAF1) or bind deubiquitinases, other USP proteins, or other UAF1 complexes (e.g., USP46-UAF1) with at least 5-fold, at least 10-fold, at least 20-fold, or at least 100-fold reduced affinity compared to the affinity for LISP (i.e., the K_D of the USP1 inhibitor for other deubiquitinases, other USP proteins, or other UAF1 complexes (e.g., USP46-UAF1) is at least 5-fold, at least 10-fold, at least 20-fold, or at least 100-fold higher than the K_D for USP1).

In some embodiments, the Compounds of the Disclosure inhibit USP1 deubiquitinase activity with an 1050 of less than about 50 nM, between about 50 nM and about 200 nM, between about 200 nM and about 2 pM, or greater than 2 pM, e.g., as measured using the assay disclosed in US Patent Application Publication No. 2017/0145012 or IC50 of 50 nM to 1000 nM, e.g., as measured using the assay disclosed in Liang et al., Nat Chem Biol 10: 289-304 (2014). In some embodiments, the Compounds of the Disclosure inhibit USP1 deubiquitinase activity with an 1050 as measured using the assay disclosed in Chen, et al., Chem Biol., 18(11):1390-1400 (2011). In some embodiments, the Compounds of the Disclosure do not inhibit the activity of other deubiquitinases, other USP proteins, or other UAF1 complexes (e.g., USP46-UAF1) or inhibit the activity of other deubiquitinases, other USP proteins, or other UAF1 complexes (e.g., USP46-UAF1) with at least 5-fold, at least 10-fold, at least 20-fold, or at least 100-fold higher IC50 compared to the IC50 for inhibition of USP1 deubiquitinase activity.

In some embodiments, the Compounds of the Disclosure bind to a USP1 protein with an affinity in the range of 1 pM to 100 μM, or 1 pM to 1 μM, or 1 pM to 500 nM, or 1 pM to 100 nM. In some embodiment, the Compounds of the Disclosure bind to a USP1 protein with an affinity of about 1 pM to about 100 μM, about 1 nM to about 100 μM, about 1 μM to about 100 μM, about 1 μM to about 50 μM, about 1 μM to about 40 μM, about 1 μM to about 30 μM, about 1 μM to about 20 μM, or about 1 μM to about 10 μM, about 1 μM, about 5 μM, about 10 μM, about 15 μM, about 20 μM, about 25 μM, about 30 μM, about 35 μM, about 40 μM, about 45 μM, about 50 μM, about 60 μM, about 70 μM, about 80 μM, about 90 μM, or about 100 μM. In some embodiment, the Compounds of the Disclosure bind to a USP1 protein with an affinity of about 100 nM to about 1 μM, about 100 nM to about 900 nM, about 100 nM to about 800 nM, about 100 nM to about 700 nM, about 100 nM to about 600 nM, about 100 nM to about 500 nM, about 100 nM to about 400 nM, about 100 nM to about 300 nM, about 100 nM to about 200 nM, about 200 nM to about 1 μM, about 300 nM to about 1 μM, about 400 nM to about 1 μM, about 500 nM to about 1 μM, about 600 nM to about 1 μM, about 700 nM to about 1 μM, about 800 nM to about 1 μM, about 900 nM to about 1 μM, about 100 nM, about 200 nM, about 300 nM, about 400 nM, about 500 nM, about 600 nM, about 700 nM, about 800 nM, or about 900 nM. In some embodiment, the Compounds of the Disclosure bind to a USP1 protein with an affinity of about 1 nM to about 100 nM, 1 nM to about 90 nM, 1 nM to about 80 nM, 1 nM to about 70 nM, 1 nM to about 60 nM, 1 nM to about 50 nM, 1 nM to about 40 nM, 1 nM to about 30 nM, 1 nM to about 20 nM, 1 nM to about 10 nM, about 10 nM to about 100 nM, about 20 nM to about 100 nM, about 30 nM to about 100 nM, about 40 nM to about 100 nM, about 50 nM to about 100 nM, about 60 nM to about 100 nM, about 70 nM to about 100 nM, about 80 nM to about 100 nM, about 90 nM to about 100 nM, about 1 nM, about 2 nM, about 3 nM, about 4 nM, about 5 nM, about 6 nM, about 7 nM, about 8 nM, about 9 nM, about 10 nM, about 20 nM, about 30 nM, about 40 nM, about 50 nM, about 60 nM, about 70 nM, about 80 nM, about 90 nM, or about 100 nM. In some embodiment, the Compounds of the Disclosure bind to a USP1 protein with an affinity of less than 1 μM, less than 500 nM, less than 100 nM, less than 10 nM, or less than 1 nM. In some embodiments, the Compounds of the Disclosure bind to a LISP 1 protein with an affinity of less than 1 nM.

In some embodiments, the Compounds of the Disclosure inhibit USP1 activity with an IC₅₀ of 1 pM to 100 μM, or 1 pM to 1 μM, or 1 pM to 500 nM, or 1 pM to 100 nM. In some embodiments, the Compounds of the Disclosure inhibit USP1 activity with an IC₅₀ of about 1 pM to about 100 μM, about 1 nM to about 100 μM, about 1 μM to about 100 μM, about 1 μM to about 50 μM, about 1 μM to about 40 μM, about 1 μM to about 30 μM, about 1 μM to about 20 μM, or about 1 μM to about 10 μM, about 1 μM, about 5 μM, about 10 μM, about 15 μM, about 20 μM, about 25 μM, about 30 μM, about 35 μM, about 40 μM, about 45 μM, about 50 μM, about 60 μM, about 70 μM, about 80 μM, about 90 μM, or about 100 μM. In some embodiment, the Compounds of the Disclosure inhibit USP1 activity with an IC₅₀ of about 100 nM to about 1 μM, about 100 nM to about 900 nM, about 100 nM to about 800 nM, about 100 nM to about 700 nM, about 100 nM to about 600 nM, about 100 nM to about 500 nM, about 100 nM to about 400 nM, about 100 nM to about 300 nM, about 100 nM to about 200 nM, about 200 nM to about 1 μM, about 300 nM to about 1 μM, about 400 nM to about 1 μM, about 500 nM to about 1 μM, about 600 nM to about 1 μM, about 700 nM to about 1 μM, about 800 nM to about 1 μM, about 900 nM to about 1 μM, about 100 nM, about 200 nM, about 300 nM, about 400 nM, about 500 nM, about 600 nM, about 700 nM, about 800 nM, or about 900 nM In some embodiment, the Compounds of the Disclosure inhibit USP1 activity with an IC₅₀ of about 1 nM to about 100 nM, 1 nM to about 90 nM, 1 nM to about 80 nM, 1 nM to about 70 nM, 1 nM to about 60 nM, 1 nM to about 50 nM, 1 nM to about 40 nM, 1 nM to about 30 nM, 1 nM to about 20 nM, 1 nM to about 10 nM, about 10 nM to about 100 nM, about 20 nM to about 100 nM, about 30 nM to about 100 nM, about 40 nM to about 100 nM, about 50 nM to about 100 nM, about 60 nM to about 100 nM, about 70 nM to about 100 nM, about 80 nM to about 100 nM, about 90 nM to about 100 nM, about 1 nM, about 2 nM, about 3 nM, about 4 nM, about 5 nM, about 6 nM, about 7 nM, about 8 nM, about 9 nM, about 10 nM, about 20 nM, about 30 nM, about 40 nM, about 50 nM, about 60 nM, about 70 nM, about 80 nM, about 90 nM, or about 100 nM In some embodiments, the Compounds of the Disclosure inhibit USP1 activity with an IC₅₀ of less than 1 μM, less than 500 nM, less than 100 nM, less than 10 nM, or less than 1 nM. In some embodiments, the Compounds of the Disclosure inhibit USP1 activity with an IC₅₀ of less than 1 nM.

Exemplary Assays

Any suitable assay in the art can be used to determine an activity, detect an outcome or effect, determine efficacy, etc. Certain non-limiting exemplary assays that can be used in the methods provided herein are described.

In some instances, a method of determining whether a Compound of the Disclosure inhibits USP1 deubiquitinase activity measure a change in mass upon di-ubiquitin cleavage of deubiquitinase binding. For example, ubiquitin aldehyde and ubiquitin vinyl sulfone form covalent irreversible linkages to deubiquitinases that result in observable mass changes to the deubiquitinases. Similarly, cleavage of di-ubiquitins results in an observable mass change.

In some instances, a method of determining whether a Compound of the Disclosure inhibits USP1 deubiquitinase activity involves an increase in luminescence or fluorescence upon cleavage, e.g., that can be monitored on a plate reader. Such assays can use ubiquitin linked to a flurophore through a linker linkage, such as ubiquitin-7-amino-4-methylcoumarin (Ub-AMC) or ubiquitin-Rhodamine 110. Such assays can also use a di-ubiquitin containing an isopeptide linkage. Exemplary di-ubiquitins can comprise a flurophore on one ubiquitin and a quencher on the other ubiquitin such that fluorescence increases with then di-ubiquitin is cleaved. Such assays can also use enzyme coupled systems wherein ubiquitin is coupled to an enzyme that is only active in producing a fluorescence enzyme product when released from the ubiquitin.

Exemplary Deubiquitination Assay for USP1/UAF1 Activity and Inhibitor Testing. Deubiquitinase activity can be measured using ubiquitin-rhodamine 110 as a substrate. Cleavage of the amide bond between rhodamine and the c-terminal glycine of ubiquitin yields an increase in fluorescence signal. The assay can be conducted in 20 ul total volume of assay buffer (50 mM Tris-HCL pH 7.8, 0.5 mM EDTA, 0.01% Bovine Serum Albumin, 1 mM DTT, 0.01% Tween-20), and 0.05 nM USP1/UAF1 enzyme. Reaction can be initiated by addition of 150 nM Ubiquitin-rhodamine (Boston Biochem) substrate.

Compounds of the Disclosure can be dissolved in DMSO and tested in dose response format, beginning at 10 μM.

Compounds of the Disclosure can be added to enzyme/assay buffer mix and incubated 10 min. Substrate mix can be added, and reaction mix can be read in kinetic mode for 30 rain at Ex480/Em540 and IC50 response curves can be plotted. See, e.g., Chen, et al., Chem Biol., 18(11):1390-1400 (2011).

Methods of Use

In some embodiments, the Compounds of the Disclosure can be used to inhibit the activity of a USP1 protein. For example, in some embodiments, a method of inhibiting a USP1 protein comprises contacting the USP1 protein with a Compound of the Disclosure. The contacting can occur in vitro or in vivo.

In some embodiments, the Compounds of the Disclosure can be used to treat a “USP1 protein mediated disorder.” A USP1 protein mediated disorder is any pathological condition in which a USP1 protein is known to play a role. In some embodiments, a USP1 protein mediated disorder is a proliferative disease such as cancer.

Various methods of treating diseases and disorders with the Compounds of the Disclosure are provided herein. Exemplary diseases and disorders that may be treated with the Compounds of the Disclosure include, but are not limited to, cancer.

In some embodiments, methods of treating cancer with Compounds of the Disclosure are provided. Such methods comprise administering to a subject with cancer a therapeutically effective amount of a Compound of the Disclosure.

In some embodiments, the cancer to be treated with a Compound of the Disclosure is selected from a hematological cancer, a lymphatic cancer, and a DNA damage repair pathway deficient cancer. In some embodiments, the cancer to be treated with a Compound of the Disclosure is a cancer that comprises cancer cells with a mutation in a gene encoding p53. In some embodiments, the cancer to be treated with a Compound of the Disclosure is a cancer that comprises cancer cells with a loss of function mutation in a gene encoding p53. In some embodiments, the cancer to be treated with a Compound of the Disclosure is a cancer that comprises cancer cells with a mutation in a gene encoding BRCA1. In some embodiments, the cancer to be treated with a Compound of the Disclosure is a cancer that comprises cancer cells with a mutation in a gene encoding BRCA2. In some embodiments, the cancer to be treated with a Compound of the Disclosure is a cancer that comprises cancer cells with a loss of function mutation in a gene encoding ATM.

In some embodiments, the cancer to be treated with a Compound of the Disclosure is selected from non-small cell lung cancer (NSCLC), osteosarcoma, ovarian cancer, and breast cancer. In some embodiments, the cancer is ovarian cancer or breast cancer. In some embodiments, the cancer is ovarian cancer. In some embodiments, the cancer is breast cancer. In some embodiments, the cancer is a triple negative breast cancer.

In some embodiments, the cancer to be treated with a Compound of the Disclosure is selected from the group consisting of bone cancer, including osteosarcoma and chondrosarcoma; brain cancer, including glioma, glioblastoma, astrocytoma, medulloblastoma, and meningioma; soft tissue cancer, including rhabdoid and sarcoma; kidney cancer; bladder cancer; skin cancer, including melanoma; and lung cancer, including non-small cell lung cancer; colon cancer, uterine cancer; nervous system cancer; head and neck cancer; pancreatic cancer; and cervical cancer.

Various methods of treating cancer with a Compound of the Disclosure are provided herein. In some embodiments, a therapeutically effective amount of Compound of the Disclosure is administered to a subject with cancer, wherein the cancer comprises cancer cells with elevated levels of RAD18. In some embodiments, the elevated levels of RAD18 are elevated RAD18 protein levels. In some embodiments, the elevated levels of RAD18 are elevated RAD18 mRNA levels. In some embodiments, elevated levels of RAD18 (e.g., RAD18 protein and/or RAD18 mRNA) have been detected (e.g., in a cancer sample obtained from the subject) prior to the administration. That is, in some embodiments, a subject's cancer has been tested for RAD18 protein or mRNA prior to beginning treatment with a LISP 1 inhibitor.

In some embodiments, such methods comprise (a) identifying a cancer in a subject as a USP1 inhibitor-sensitive cancer and then (b) administering a therapeutically effective amount of a Compound of the Disclosure to the subject.

In some embodiments, such methods comprise (a) detecting levels of RAD18 (e.g., RAD18 protein and/or RAD18 mRNA) in cancer cells (e.g., in a cancer sample obtained from the subject) and then (b) administering a therapeutically effective amount of a Compound of the Disclosure to a subject having a cancer comprising cells with elevated levels of RAD18.

In some embodiments, such methods comprise administering to a subject with triple negative breast cancer a therapeutically effective amount of a Compound of the Disclosure.

In some embodiments, a Compound of the Disclosure is used to treat a cancer, wherein the cancer is a homologous-recombination deficient cancer. In some embodiments, a Compound of the Disclosure is used to treat a cancer, wherein the cancer comprises cancer cells with a mutation in a gene encoding p53. In some embodiments, a Compound of the Disclosure is used to treat a cancer, wherein the cancer comprises cancer cells with a loss of function mutation in a gene encoding p53. In some embodiments, a Compound of the Disclosure is used to treat a cancer that does not have a defect in the homologous recombination pathway.

In some embodiments, a Compound of the Disclosure is used to treat a cancer, wherein the cancer is a BRCA1 mutant cancer. In some embodiments, a Compound of the Disclosure is used to treat a cancer, wherein the cancer is a BRCA2 mutant cancer. In some embodiments, a Compound of the Disclosure is used to treat a cancer, wherein the cancer is a BRCA1 mutant cancer and a BRCA2 mutant cancer. In some embodiments, the cancer is not a BRCA1 mutant cancer or a BRCA2 mutant cancer. In some embodiments, the cancer is a BRCA1 deficient cancer. In some embodiments, the cancer is a BRCA2 deficient cancer. In some embodiments, the cancer is a BRCA1 deficient cancer and a BRCA2 mutant cancer.

In some embodiments, a Compound of the Disclosure is used to treat a cancer, wherein the cancer is an ATM mutant cancer. In some embodiments, the cancer is not an ATM mutant cancer. In some embodiments, the cancer is an ATM deficient cancer.

In some embodiments, a Compound of the Disclosure is used to treat a cancer, wherein the cancer is a PARP inhibitor resistant or refractory cancer. In some embodiments, a Compound of the Disclosure is used to treat a cancer, wherein the cancer is a PARP inhibitor resistant or refractory BRCA1-deficient cancer.

In some embodiments, the cancer is a BRCA1 and/or BRCA2 mutant cancer, wherein the cancer comprises cells with elevated levels of RAD18, e.g., wherein the elevated levels of RAD18 are at least as high as the RAD18 protein and/or mRNA levels in ES2 cells or wherein the elevated levels of RAD18 are higher than the RAD18 protein and/or mRNA levels in HEP3B217 cells. In some embodiments, a triple negative breast cancer is a BRCA1 and/or BRCA2 mutant cancer.

In some instances, the cancer is a solid cancer. In some instances, the cancer is a hematological/lymphatic cancer. In some instances, the cancer is a DNA damage repair pathway deficient cancer. In some instances, the cancer is a homolgous-recombination deficient cancer. In some instances, the cancer comprises cancer cells with a mutation in a gene encoding p53. In some instances, the cancer comprises cancer cells with a loss of function mutation in a gene encoding p53. In some instances, the cancer is selected from the group consisting of non-small cell lung cancer (NSCLC), osteosarcoma, ovarian cancer, and breast cancer (including triple negative breast cancer). In some instances, the cancer is ovarian cancer or breast cancer (including triple negative breast cancer). In some instances, the cancer is ovarian cancer. In some instances, the cancer is breast cancer (including triple negative breast cancer.)

In some embodiments, a Compound of the Disclosure is used in combination with one or more additional therapeutic agents to treat cancer. It has been reported that p53 status determines PARP inhibitor sensitization (Sa et al. Genome Biology, (2019) 20253) and that BRCA1/2 status predicts the efficacy of PARP inhibitors in the clinic (Audeh et al. Lancet (2010) 376 (9737), 245-51). As shown below, p53 mutant cancers and BRCA mutant cancers have increased sensitivity to USP1 inhibitors. Accordingly, in some embodiments, a Compound of the Disclosure is used in combination with a PARP inhibitor to treat cancer.

In some embodiments, provided herein are Compounds of the Disclosure for use as a medicament or for use in preparing a medicament, e.g., for the treatment of cancer. In some embodiments, provided herein are Compounds of the Disclosure for use in a method for the treatment of cancer.

Pharmaceutical Compositions

Compounds of the Disclosure can be administered to a mammal in the form of a raw chemical without any other components present, or Compounds of the Disclosure can also be administered to a mammal as part of a pharmaceutical composition containing the compound combined with a suitable pharmaceutically acceptable carrier (see, for example, Gennaro, Remington: The Science and Practice of Pharmacy with Facts and Comparisons: Drugfacts Plus, 20th ed. (2003); Ansel et al, Pharmaceutical Dosage Forms and Drug Delivery Systems, 7th ed. Lippencott Williams and Wilkins (2004); Kibbe et al., Handbook of Pharmaceutical Excipients, 3rd ed., Pharmaceutical Press (2000)). Such a carrier can be selected from pharmaceutically acceptable excipients and auxiliaries. The term “pharmaceutically acceptable carrier” or “pharmaceutically acceptable vehicle” encompasses any of the standard pharmaceutical carriers, solvents, surfactants, or vehicles. Standard pharmaceutical carriers and their formulations are described in Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., 19th ed. 1995.

A pharmaceutical composition of the present disclosure may be prepared as liquid suspensions or solutions using a liquid, such as an oil, water, an alcohol, and combinations of these.

A pharmaceutical composition of the present disclosure may be prepared as a sterile injectable, which may be aqueous or oleaginous suspensions. These suspensions may be formulated according to techniques known in the art.

A pharmaceutical composition of the present disclosure may be orally administered in any orally acceptable dosage form including capsules, tablets, aqueous suspensions or solutions.

A pharmaceutical composition of the present disclosure may be administered in the form of suppositories for rectal administration.

A pharmaceutical composition of the present disclosure may also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, including diseases of the eye, the skin, or the lower intestinal tract. Topical application for the lower intestinal tract may be effected in a rectal suppository formulation (see above) or in a suitable enema formulation. Topically-transdermal patches may also be used. For topical applications, the pharmaceutical compositions may be formulated in a suitable ointment, lotion, or cream containing the active component suspended or dissolved in one or more carriers.

A pharmaceutical composition of the present disclosure may also be administered ophthalmically and formulated as micronized suspensions in isotonic, pH adjusted sterile saline, or, preferably, as solutions in isotonic, pH adjusted sterile saline, either with or without a preservative such as benzylalkonium chloride. Alternatively, for ophthalmic uses, the pharmaceutical compositions may be formulated in an ointment such as petrolatum.

A pharmaceutical composition of the present disclosure may also be administered by nasal aerosol or inhalation. Such compositions are prepared according to techniques well known in the art of pharmaceutical formulation and may be prepared as solutions in saline, employing benzyl alcohol or other suitable preservatives, absorption promoters to enhance bioavailability, fluorocarbons, and/or other conventional solubilizing or dispersing agents.

The pharmaceutical compositions to be used for in vivo administration can be sterile. This is readily accomplished by filtration through, e.g., sterile filtration membranes.

Pharmaceutical compositions within the scope of the present disclosure include all compositions where a Compound of the Disclosure is combined with one or more pharmaceutically acceptable carriers. In one embodiment, the Compound of the Disclosure is present in the composition in an amount that is effective to achieve its intended therapeutic purpose.

A pharmaceutical composition of the present disclosure can be administered to any patient that may experience the beneficial effects of a Compound of the Disclosure. Foremost among such patients are mammals, e.g., humans and companion animals, although the disclosure is not intended to be so limited. In one embodiment, the patient is a human. In another embodiment, a pharmaceutical compositions of the present disclosure can be administered to a patient having PARP inhibitor resistant or refractory cancer. In another embodiment, a pharmaceutical compositions of the present disclosure can be administered to a patient having PARP inhibitor resistant or refractory BRCA1-deficient cancer. In another embodiment, a pharmaceutical compositions of the present disclosure can be administered to a patient in combination with a PARP inhibitor.

In another embodiment, the present disclosure provides kits which comprise a Compound of the Disclosure (or a composition comprising a Compound of the Disclosure) packaged in a manner that facilitates their use to practice methods of the present disclosure. In one embodiment, the kit includes a Compound of the Disclosure (or a composition comprising a Compound of the Disclosure) packaged in a container, such as a sealed bottle or vessel, with a label affixed to the container or included in the kit that describes use of the compound or composition to practice the method of the disclosure. In one embodiment, the compound or composition is packaged in a unit dosage form. The kit further can include a device suitable for administering the composition according to the intended route of administration. In some embodiments, the present disclosure provides a kit which comprise a Compound of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof, and instructions for administering the compound, or a pharmaceutically acceptable salt or solvate thereof, to a patient having cancer.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a Compound of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula I, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula II, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula III, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula IV, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula V, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula VI, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula VIa, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula VII, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula VIII, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula IX, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula X, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula XI, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a compound having Formula XII, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a Compound of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier, wherein the compound binds to a protein encoded by the USP1 gene.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a Compound of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier, wherein the pharmaceutical composition is for use in treating cancer.

In some embodiments, the present disclosure provides a pharmaceutical composition comprising a Compound of the Disclosure, or a pharmaceutically acceptable salt or solvate thereof, and a pharmaceutically acceptable carrier, wherein the pharmaceutical composition is for the manufacture of a medicament for treatment of cancer.

Examples

General Synthetic Methods

Compounds of the Disclosure are prepared using methods known to those skilled in the art in view of this disclosure, or by the illustrative methods shown in the General Schemes below. In any of the General Schemes, suitable protecting groups can be employed in the synthesis. (See, Wuts, P. G. M.; Greene, T. W., “Greene's Protective Groups in Organic Synthesis”, 4th Ed., J. Wiley & Sons, N Y, 2007).

Unless otherwise noted, all reagents were used without further purification. ¹H-NMR spectra were obtained in DMSO-d₆ or CD₃OD at room temperature on a Bruker 300 MHz instrument. When more than one conformer was detected, the chemical shifts for the most abundant one is reported. Chemical shifts of ¹H NMR spectra were recorded in parts per million (ppm) on the δ scale from an internal standard of residual solvent. Splitting patterns are designed as s, singlet; d, doublet; t, triplet; q, quartet; m, multiplet; br, broad. LC-MS and prep-HPLC conditions are described below:

LCMS Method A

• LCMS Column: Agilent Zorbax XDB C18 4.6×50 mm, 3.5 μm
• Mobile phase: Solvent A: Water (with 0.1% Formic acid)
  • Solvent B: MeOH
• Flow rate: 1.0 mL/min,
• Run time: 2 min gradient (20%-90% B), then 3 min @90% B,
• Temperature: 30° C.

LCMS Method B

• LCMS Column: X-Select CSH C18 3.0×50 mm, 2.5 μm
• Mobile phase: Solvent A: Water (with 0.05% Formic acid)/MeCN (95:5)
  • Solvent B: 0.05% Formic acid in MeCN
• Flow rate: 1.2 mL/min,
• Run time: 2 mm gradient (0%-98% B), hold 1 min, then 0% B up to 4 mi
• Temperature: 50° C.

LCMS Method C

• LCMS Column: X-Select CSH C18 3.0×50 mm, 2.5 μm
• Mobile phase: Solvent A: 5 mM Ammonium Bicarbonate
  • Solvent B: MeCN
• Flow rate: 1.2 mL/min,
• Run time: 2 mm gradient (0%-98% B), hold 1 mm, then 0% B up to 4 min
• Temperature: 50° C.
• HPLC Column A: Agilent SB-C18 4.6×150 mm, 3.5 μm
• Mobile phase: Solvent A: water (with 0.02% TFA)
  • Solvent B: MeOH
• Flow rate: 1.0 mL/min,
• Run time: 0.5 min @10% B, 9.5 min gradient (10%-90% B), then 10 min
  • @90% B,
• Temperature: 30° C.
• Preparative Column A: Phenomenex Luna 5u 100A, 21.2×250 mm, 5 μm
• Mobile phase: Solvent A: Water
  • Solvent B: MeOH
• Flow rate: 10 mL/min,
• Run tune: 1 min @20% B, 30 min gradient (20%-80% B), then 10 min
  • @90% B,
• Temperature: Ambient
• Preparative Column B: X-Select C18, 30×250 mm, 5 μm
• Mobile phase: Solvent A: 10 mm Formic acid in Water
  • Solvent B: MeCN
• Flow rate: 30 mL/min,
• Run time: 50 min, isocratic 5% A:95% B
• Temperature: Ambient
• Preparative Column C: Nucleodur C18, 30×250 mm, 5 μm
• Mobile phase: Solvent A: 10 mM Ammonium bicarbonate in Water
  • Solvent B: MeCN
• Flow rate: 30 mL/min,
• Run time: 50 min, isocratic 5% A:95% B
• Temperature: Ambient
• Preparative Column D: X-Select C18, 30×250 mm, 5 μm
• Mobile phase: Solvent A: 10 mM Ammonium bicarbonate in Water
  • Solvent B: MeCN
• Flow rate: 30 mL/min,
• Run time: 50 min, isocratic 5% A:95% B
• Temperature: Ambient
• Preparative Column E: Nucleodur C18, 30×250 mm, 5 μm
• Mobile phase: Solvent A: 10 mM NH; in Water
  • Solvent B: MeCN
• Flow rate: 30 mL/min,
• Run time: 50 min, isocratic 5% A:95% B
• Temperature: Ambient
• SFC Method: Green Sep ES Diol, 250×4.6 mm, 5 μm
• Mobile Phase Solvent A: CO₂
  • Solvent B: MeCN
• Flow rate: 80 mL/min; Diluent: MeCN
• Run Time: 10-20% B 3 min, 20-25% B 9 min, 25-30% B 3 min, 30-50% B 6 min, 50% B 50 min
• Chiral Method A: DIACEL CHIRAL PAK-IC (250×4.6 mm, 5μ); Wavelength: 260 nm
• Mobile Phase Solvent A: CO₂
  • Solvent B: MeOH+DCM (80:20)
• Flow rate: 3 mL/min.
• Run Time: 25-50% B in 5 min, hold 50% B 4 min, 50-25% B at 10 min, hold 25% B 2 min
• Chiral Method B: DIACEL CHIRAL PAK-IG (250×4.6 mm, 5μ); Wavelength: 280 nm
• Mobile Phase Solvent A: CO₂
  • Solvent B: MeOH+0.1% NH₃
• Flow rate: 3 mL/min.
• Run Time: 10-40% B 5.0 min, hold 40% B till 4 min, 40-10% B at 10 mm, hold 10% B 2 min

The following abbreviations are teed in the text:

• PE=petroleum ether
• EA or EtOAc=ethyl acetate
• DMSO=dimethyl sulfoxide
• DMF=N, N-dimethylformamide
• DMA=N,N-dimethylacetamide
• MeOH=methanol
• MTBE=Methyl tert-butyl ether
• DCM=dichloromethane
• TEA=trimethylamine
• DIPEA=Diisopropylethylamine
• TFA=trifluoroacetic acid
• MeCN or ACN=acetonitrile
• TLC=thin layer chromatography
• (BPin)₂=Bis(pinacolato)diboron
• HFIP=1,1,1,3,3,3-hexafluoropropan-2-ol
• DBAL-H=Diisobutylaluminum hydride
• MeI=Iodomethane
• hex or n-hex=n-Hexane
• DCE=1,2-Dichloroethane
• TBSCl=tert-Butyldmethylsilyl chloride
• Tf₂O=Trifluoromethanesulfonic anhydride
• n-BuLi=n-Butyllithium
• DMAP=4-Dimethylaminopyridine
• KOAc=Potassium acetate
• NaOAc=Sodium acetate
• TFAA=Trifluoroacetic anhydride
• m-CPBA=meta-Chloroperoxybenzoic acid
• DME=1,2-Dimethoxyethane
• TPP=Triphenylphosphine
• DTAD=Di-tert-butyl azodicarboxylate
• DEAD=Diethylazodicarboxylate
• DIAD=Diisopropyl azodicarboxylate
• PS-TPP=Polystyrene supported triphenylphosphine
• NBS=N-Bromosuccinimide.

Preparation of Common Intermediate I-1

Step 1: Synthesis of Methyl 4-(4-(trifluoromethyl)-1H-imidazol-2-yl) benzoate

To a mixture of 3,3-dibromo-1,1,1-trifluoropropan-2-one (3.1 g, 11.49 mmol) in water (6 ml), was added NaOAc (951.8 mg, 11.60 mmol). The mixture was heated at 100° C. for 1 how, then cooled to room temperature. A solution of methyl 4-formylbenzoate (1.7 g, 10.34 mmol) in MeOH (47 ml) and NH₄OH (11 ml), was then added to the reaction mixture at room temperature. After 40 min, the reaction was warmed to 100 and stirred for 2 hours. The mixture was quenched with water (50 mL), and then extracted with EA (100 mL×2). The organic layer was dried over Na₂SO₄ (30 g), filtered and concentrated. The concentrated residue was purified by silica gel chromatography (PE:EA=20:1 to 5:1) to afford 1.9 g of the title compound. LC-MS (Method A) (ESI+): m/z 271 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 8.12 (d, J=8.7 Hz, 2H), 8.01 (d, J=8.7 Hz, 2H), 7.72 (s, 1H), 3.93 (s, 3H).

Step 2: Synthesis of Methyl 4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzoate

To a solution of methyl 4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzoate (1.9 g, 7.03 mmol) in THF at 0° C. (50 ml), was added NaH (60% dispersion) (338 mg, 8.44 mmol) portion-wise over 5 mm. After the mixture was stirred at 0° C. for 30 min, MeI (1.2 g, 8.44 mmol) was added to the reaction mixture dropwise over 2 min. The reaction was warmed to room temperature over 3 hours, then quenched with ice-water (30 g). The resulting solution was extracted with EA (50 mL×3), and the combined organic layer was dried over Na₂SO₄ (30 g), filtered and concentrated. The resulting residue was purified by silica gel chromatography (PE:EA=20:1 to 5:1) to yield 1.4 g of the title compound. LC-MS (Method A) (ESI+): m/z 285 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 8.17 (d, J=8.4, Hz 2H), 7.80 (d, J=8.4 Hz, 2H), 7.75 (s, 1H), 3.94 (s, 3H), 3.83 (s, 3H).

Step 3: Synthesis of (4-(1-Methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanol

To a solution of methyl 4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzoate (1.4 g, 4.93 mmol) in THF (40 ml) at 0° C., was DIBAL-H (24 ml, 24.6 mmol, 1 M in toluene) via syringe. After the addition, the reaction was stirred at 0° C. for 20 min, and then warmed to room temperature over 30 mm. After the reaction was complete as indicated by TLC analysis, the mixture was quenched with ice water (10 mL), and the pH was adjusted to 5 with a 1N HCl solution. The resulting mixture was extracted with EA (50 mL×2), and the combined organic layer was washed with brine (30 mL), dried over Na₂SO₄ (30 g), filtered and concentrated in vacuo. The resulting residue was purified by silica gel chromatography (PE:EA=20:1 to 5:1) to afford 1.2 g of the title compound. LC-MS (Method A) (ESI+): m/z 257 (M+H)⁺, ¹H-NMR (300 MHz, CD₃OD) δ 7.69 (s, 1H), 7.63 (d, J=8.1 Hz, 2H), 7.52 (d, J=8.1 Hz, 2H), 4.69 (s, 2H), 3.78 (s, 3H).

Step 4: Synthesis of 2-(4-(Chloromethyl)phenyl)-1-methyl-4-(trifluoromethyl)-1H-imidazole

To a mixture of (4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanol (1.2 g, 4.68 mmol) in DCE (40 ml), was added SOCl₂ (1.7 g, 14.1 mmol) in one portion. After the addition, the reaction was stirred at 50° C. for 20 mat, then concentrated to dryness to afford 1.28 g of the crude title compound. LC-MS (Method A) (ESI+): m/z 275, 277 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 8.04 (s, 1H), 7.74 (d, J=8.4 Hz, 2H), 7.68 (d, J=8.4 Hz, 2H), 4.75 (s, 2H), 3.87 (s, 3H).

Step 5: Synthesis of 6-Chloro-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-1)

To a solution of 2-(4-(chloromethyl)phenyl)-1-methyl-4-(trifluoromethyl)-1H-imidazole (1 g, 3.64 mmol) in DMF (25 ml), was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (675 mg, 4.37 mmol) and K₂CO₃ (1.26 g, 9.10 mmol). The resulting mixture was stirred at 35° C. for 20 hours, then quenched with water (50 mL) and extracted with EA (100 mL×2). The combined organic phase was washed with water and brine, dried over Na₂SO₄ (50 g), filtered and concentrated in vacuo. The resulting residue was purified by silica gel chromatography (PE:EA=20:1 to 10:1) to afford 580 mg of the title compound with a small amount of its regioisomer. LC-MS (Method A) (ESI+): m/z 393, 395 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.06 (s, 1H), 8.18 (s, 1H), 7.61 (d, J=8.1 Hz, 2H), 7.47 (d, J=8.1 Hz, 2H), 7.30 (s, 1H), 5.69 (s, 2H), 3.74 (s, 3H).

The following intermediates were prepared from the appropriate heterocycles and alkylating reagents according to the method of preparation for I-1.

Intermediate	Structure	Analytics
I-2		LC-MS (Method A) (ESI+): m/z 407, 409 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 8.16 (s, 1H), 7.60 (d, J = 8.1 Hz, 2H), 7.45 (d, J = 8.1 Hz, 2H), 7.29 (s, 1H), 5.66 (s, 2H), 3.74 (s, 3H), 2.81 (s, 3H).
I-3		LC-MS (Method B) (ESI+): m/z 421.00 (M + H)+.
I-4		LC-MS (Method A) (ESI+): m/z 407 (M + H); 1H-NMR (300 MHz, CDCl3) δ 8.95 (s, 1H), 7.60 (d, J = 8.1 Hz, 2H), 7.44 (d, J = 8.1 Hz, 2H), 7.29 (s, 1H), 5.60 (s, 2H), 3.74 (s, 3H), 2.61 (s, 3H).
I-5		LC-MS (Method A) (ESI+): m/z 407 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.07 (s, 1H), 8.20 (s, 1H), 7.56 (d, J = 8.4 Hz, 2H), 7.46 (d, J = 8.4 Hz, 2H), 7.38 (s, 1H), 5.70 (s, 2H), 4.04 (q, J = 7.2 Hz, 2H), 1.26 (t, J = 7.2 Hz, 3H).
I-6		LCMS (Method B) (ESI+): m/z 421.00 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.32 (s, 1H), 8.53 (s, 1H), 8.13-8.21 (m, 1H), 7.54 (d, J = 7.48 Hz, 2H), 7.39 (d, J = 7.98 Hz, 2H), 5.74 (s, 2H), 4.44 (td, J = 6.48, 12.96 Hz, 1H), 1.38 (d, J = 6.48 Hz, 6H).
I-7		LC-MS (Method A) (ESI+): m/z 408 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.07 (s, 1H), 8.65 (d, J = 2.1 Hz, 1H), 8.22 (d, J = 8.1 Hz, 1H), 8.20 (s, 1H), 7.81 (dd, J = 8.1, 2.1 Hz, 1H), 7.34 (s, 1H), 5.68 (s, 2H), 4.63 (q, J = 7.2 Hz, 2H), 1.45 (t, J = 7.2 Hz, 3H).

Preparation of Common Intermediate I-8

Step 1: Synthesis of 3-Fluoro-4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzaldehyde

A solution of 2-chloro-1-methyl-4-(trifluoromethyl)-1H-imidazole (1.00 g, 5.40 mmol), (2-fluoro-4-formylphenyl)boronic acid (1.00 g, 6.50 mmol) and K₃PO₄ (3.40 g, 16.30 mmol) in dioxane (20 mL) and H₂O (5 mL), was degassed with argon for 5 min. To the resulting reaction mixture were added Xphos-Pd-G₂ (0.42 g, 0.54 mmol) and X-Phos (1.03 g, 2.10 mmol) sequentially, and the reaction mixture was heated in a sealed tube at 100° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water and extracted with EA. The organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound thus obtained was purified by silica gel chromatography using 0-30% EA in hexane to afford 1.40 g the title compound. LC-MS (Method B) (ESI+): m/z 272.90 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 10.09 (s, 1H), 8.08 (s, 1H), 7.83-7.94 (m, 3H), 3.66 (s, 3H).

Step 2: Synthesis of (3-Fluoro-4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanol

To an ice cooled solution of 3-fluoro-4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzaldehyde (1.40 g, 5.14 mmol) in MeOH (30 mL) was added NaBH₄ (0.293 g 7.70 mmol), and the reaction mixture was stirred at room temperature for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude reaction mixture was dissolved in water and extracted with EA. The organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 1.40 g of the title compound that was used without further purification. LC-MS (Method B) (ESI+): m/z 274.85 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.99 (s, 1H), 7.54 (t, J=7.8 Hz, 1H), 7.28-7.34 (m, 2H), 5.46 (t, J=5.6 Hz, 1H), 4.60 (d, J=5.4 Hz, 2H), 3.59 (s, 3H).

Step 3: Synthesis of 2-(4-(Chloromethyl)-2-fluorophenyl)-1-methyl-4-(trifluoromethyl)-1H-imidazole

To an ice-cooled solution of (3-fluoro-4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)-methanol (1.40 g, 5.10 mmol) in DCM (15 mL), was added SOCl₂ (1.80 g, 15.0 mmol) and the reaction mixture was stirred at room temperature for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with saturated NaHCO₃ solution and extracted with DCM. Organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 1.42 g of the title compound, which was used without further purification. LC-MS (Method B) (ESI+): m/z 292.85 (M+H)⁺.

Step 4: Synthesis of 6-Chloro-1-(3-fluoro-4-(1-methyl-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-8)

A solution of 2-(4-(chloromethyl)-2-fluorophenyl)-1-methyl-4-(trifluoromethyl)-1H-imidazole (1.41 g, 4.80 mmol), 6-chloro-1H-pyrazolo[3,4-d]pyrimidine 5 (0.65 g, 4.20 mmol) and K₂CO₃ (1.45 g, 10.50 mmol) in DMF (12 mL), was stirred at 35° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water and extracted with EA. The organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-15% EA in hexane to afford 0.70 g of the title compound. LC-MS (Method B) (ESI+): m/z 410.85 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.33 (s, 1H), 8.54 (s, 1H), 7.99 (s, 1H), 7.57 (t, J=7.6 Hz, 1H), 7.31 (d, J=10.8 Hz, 1H), 7.19 (d, J=7.8 Hz, 1H), 5.76 (s, 2H), 3.58 (s, 3H).

The following intermediate was made from the appropriate aldehyde and alkylating reagents according to the procedure for Intermediate 1-8.

Intermediate	Structure	Analytics
I-9		LC-MS (Method C) (ESI+): m/z 410.90 (M + H)+.
I-10		LC-MS (Method B) (ESI+): m/z 424.90 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.33 (s, 1H), 8.54 (s, 1H), 8.10 (s, 1H), 7.51-7.57 (m, 1H), 7.31 (d, J = 10.97 Hz, 1H), 7.19 (d, J = 7.98 Hz, 1H), 5.77 (s, 2H), 3.86 (q, J = 7.15 Hz, 2H), 1.25 (t, J = 6.98 Hz, 3H).
I-11		LC-MS (Method B) (ESI+): m/z 439.10 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 8.86 (s, 1H), 7.53 (t, J = 7.5 Hz, 1H), 7.44 (s, 1H), 7.19 (s, 1H), 7.12 (d, J = 7.8 Hz, 1H), 6.97 (d, J = 10.2 Hz, 1H), 6.65 (d, J = 3.6 Hz, 1H), 5.49 (s, 2H), 4.23 (m, 1H), 1.41 (d, J = 6.6 Hz, 6H).
I-12		LC-MS (Method B) (ESI+): m/z 437.10 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.32 (s, 1H), 8.53 (s, 1H), 7.98 (s, 1H), 7.29 (d, J = 7.98 Hz, 1H), 7.19 (s, 1H), 6.81 (d, J = 7.48 Hz, 1H), 5.73 (s, 2H), 3.77 (s, 3H), 3.70-3.76 (m, 2H), 1.21 (t, J = 6.98 Hz, 3H).
I-13		LC-MS (Method B) (ESI+): m/z 455.09 (M + H)+.
I-14		LC-MS (Method C) (ESI+): m/z 450.85 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.31-9.34 (m, 1H), 8.54 (s, 1H), 8.12 (s, 1H), 7.28 (d, J = 7.48 Hz, 1H), 7.19 (s, 1H), 6.80 (d, J = 7.48 Hz, 1H), 5.73 (s, 2H), 4.10 (q, J = 4.99 Hz, 1H), 3.76 (s, 3H), 1.30 (d, J = 6.48 Hz, 6H).

Preparation of Common Intermediate I-15

Step 1: Synthesis of 1-(Methyl-d3)-4-(trifluoromethyl)-1H-imidazole

To a stirred solution of 4-(trifluoromethyl)-1H-imidazole (4.0 g, 29.4 mmol) in dry THF (100 mL) at 0° C., was added sodium hydride (60% dispersion, 1.294 g, 32.35 mmol). The resulting mixture was stirred for 15 min, and then iodomethane-d3 (4.26 g, 29.4 mmol) was added at 0° C., and the reaction was stirred for 30 min. The reaction mixture was then allowed to warm to room temperature and stirred for 411 After completion of the reaction (monitored by TLC), the reaction mixture was quenched with saturated ammonium chloride solution (50 mL) and extracted with EA (3×50 mL). The combined organic layer was dried over anhydrous Na₂SO₄, filtered, and dried under vacuum. The crude product was purified by silica gel chromatography (50-100% EA in n-hexane) to afford 3.0 g of the title compound. LC-MS (Method B) (ESI+): m/z 154.45 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 7.48 (s, 1H), 7.27 (s, 1H)

Step 2: Synthesis of 2-Chloro-1-(methyl-d3)-4-(trifluoromethyl)-1H-imidazole

To a stirred solution of 1-(methyl-d3)-4-(trifluoromethyl)-1H-imidazole (2.70 g, 17.6 mmol) in THF (50 mL) at −78° C., was added a 2.5M solution of n-butyl lithium in n-hexane (7 mL, 17.64 mmol). The resulting mixture was stirred at −78° C. for 30 min, and then treated with hexachloroethane (2.08 g, 8.82 mmol). After 1 h, the reaction mixture was warmed to room temperature, whereupon stirring was continued for an additional 3 h. After completion of the reaction (monitored by TLC), the reaction mixture was quenched with saturated ammonium chloride solution (25 mL) and extracted with EA (3×50 mL). The combined organic layer was dried over anhydrous Na₂SO₄, filtered, and concentrated under vacuum. The crude compound was purified by silica gel chromatography (30-100% EA in n-hexane) to afford 1.30 g of the title compound. LC-MS (Method B) (ESI+): m/z 188.30 (M+H)⁺.

Step 3: Synthesis of 4-(1-(Methyl-d3)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzaldehyde

To the solution of 2-chloro-1-(methyl-d3)-4-(trifluoromethyl)-1H-imidazole (1.40 g, 7.49 mmol) in 1,4-dioxane (60 mL), was added X-Phos-Pd-G2 catalyst (0.294 g, 0.374 mmol). The resulting mixture was purged with argon gas for 10 min, whereupon solid K₃PO₄ (4.76 g, 22.5 mmol) and (4-formylphenyl)boronic acid (2.24 g, 14.97 mmol) were added, followed by additional purging with argon gas for another 5 min. The reaction mixture was then heated at 90° C. for 16 h. After completion of the reaction (monitored by TLC), the mixture was diluted with water (60 mL) and EA (60 mL). The organic layer was separated, and the aqueous layer was extracted with EA (2×50 mL). The combined organic layer was dried over anhydrous Na₂SO₄ filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography (0-30% EA in n-hexane) to afford 1.62 g of the title compound. LC-MS (Method B) (ESI+): m/z 258.00 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 10.09 (s, 1H), 8.00 (d, J=7.88 Hz, 2H), 7.86 (d, J=7.88 Hz, 2H), 7.37 (s, 1H).

Step 4: Synthesis of (4-(1-(Methyl-d3)-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanol

To a stirred solution of 4-(1-(methyl-d3)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzaldehyde (1.60 g, 6.23 mmol) in methanol (50 mL) at 0° C., was added NaBH₄ (0.118 g, 3.11 mmol). After completion of the reaction (monitored by TLC), the mixture was quenched with ice water (30 mL) and extracted with 10% methanol in DCM (4×50 mL). The combined organic layer was dried over anhydrous Na₂SO₄, filtered and concentrated under vacuum. The crude compound was purified by silica gel chromatography (0-60% EA in n-hexane) to afford 1.30 g of the title compound. LC-MS (Method B) (ESI+): m/z 259.80 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 7.60 (d, J=8.31 Hz, 2H), 7.45 (d, J=7.83 Hz, 2H), 7.31 (s, 1H), 4.76 (s, 2H).

Step 5: Synthesis of 6-Chloro-1-(4-(1-(methyl-d3)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-15)

To a mixture of (4-(1-(methyl-d3)-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanol (0.500 g, 1.930 mmol) and 6-chloro-1H-pyrazolo[3,4-d]pyrimidine 7 (0.335 g, 2.181 mmol) in dry THF (5 mL) at 0° C., was added triphenylphosphine (0.657 g, 2.509 mmol). The resulting mixture was stirred for 5 min, and then treated with diethyl azodicarboxylate (0.434 g, 2.509 mmol) dropwise. The mixture was further stirred at 0° C. for 2 h. After completion of the reaction (monitored by TLC), the mixture was diluted with water (30 mL) and extracted with EA (3×30 mL). The combined organic layer was washed with brine (3×30 mL), dried over anhydrous Na₃SO₄, filtered, and concentrated under vacuum. The crude compound was purified by silica gel chromatography (0-3% methanol in DCM) to afford 0.400 g of the title compound LC-MS (Method B) (ESI+): m/z 396.00 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 9.05 (s, 1H), 8.18 (s, 1H), 7.61 (d, J=8.31 Hz, 2H), 7.47 (d, J=7.82 Hz, 2H), 7.30 (s, 1H), 5.69 (s, 2H).

Preparation of Common Intermediate I-16

Step 1: Synthesis of Methyl 4-(2-bromoacetyl)benzoate

To a stirred solution of methyl 4-acetylbenzoate (5.00 g, 28.0 mmol) in AcOH (40 mL), was added Br₂ (1.00 mL, 19.6 mmol) in AcOH (10 mL) dropwise, and the reaction mixture was stirred at room temperature for 6 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was poured onto ice water (100 mL), and the solid obtained was filtered and dried. The crude compound was purified by silica gel chromatography using 5-7% EA in hexane to afford 3.50 g of the title compound. LC-MS (Method C) (ESI+): m/z 278.95 (M+Na)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.04-8.15 (m, 4H), 5.00 (s, 2H), 3.89 (s, 3H).

Step 2: Synthesis of Methyl 4-(2-(trifluoromethyl)-1H-imidazol-4-yl)benzoate

To a stirred solution of 2,2,2-trifluoroacetimidamide (4.37 g, 39.0 mmol) in THF (30 mL), was added methyl 4-(2-bromoacetyl)benzoate (2.00 g, 7.80 mmol), and the reaction mixture was stirred at room temperature for 5 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with EA (20 mL) and washed with brine (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-15% EA in hexane to afford 0.81 g of the title compound. LC-MS (Method B) (ESI+): m/z 270.90 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 13.89 (s, 1H), 8.14 (s, 1H), 7.98 (s, 4H), 3.86 (s, 3H).

Step 3: Synthesis of Methyl 4-(1-methyl-2-(trifluoromethyl)-1H-imidazol-4-yl)benzoate

To a stirred solution of methyl 4-(2-(trifluoromethyl)-1H-imidazol-4-yl)benzoate (0.80 g, 2.9 mmol) in THF (15 mL) at 0° C., was added NaH (60% dispersion in mineral oil, 0.178 g, 4.40 mmol) portion wise, and the reaction mixture was stirred at same temperature for 15 min. To the resulting reaction mixture, methyl iodide (0.624 g, 4.40 mmol) was added, and the reaction mixture was stirred at room temperature for 16 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with ice water (50 mL) and extracted with EA (2×30 mL). The combined organic layer was washed with brine (2×30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 0.80 g of the title compound. LC-MS (Method B) (ESI+): m/z 284.95 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.12-8.17 (m, 1H), 7.%-8.02 (m, 2H), 7.88-7.94 (m, 2H), 3.86 (s, 6H).

Step 4: Synthesis of (4-(1-Methyl-2-(trifluoromethyl)-1H-imidazol-4-yl)phenyl)methanol

To a stirred solution of methyl 4-(1-methyl-2-(trifluoromethyl)-1H-imidazol-4-yl)benzoate (0.80 g, 2.8 mmol) in THF (10 mL) at 0° C., was added DIBAL-H (1M in toluene, 5.63 mL, 5.63 mmol) dropwise, and the reaction mixture was stirred at room temperature for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with 2N HCl (20 mL) and extracted with EA (2×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 0.65 g of the title compound, which was used in subsequent reactions without further purification. LC-MS (Method B) (ESI+): m/z 256.85 (M+H)⁺.

Step 5: Synthesis of 4-(4-(Chloromethyl)phenyl)-1-methyl-2-(trifluoromethyl)-1H-imidazole

To a stirred solution of (4-(1-methyl-2-(trifluoromethyl)-1H-imidazol-4-yl)phenyl)methanol (0.65 g, 2.5 mmol) in DCM (10 mL) at 0° C., was added SOCl₂ (0.27 mL, 3.80 mmol), and the reaction mixture was stirred at room temperature for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with DCM (50 mL) and washed with saturated NaHCO₃ solution (3×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 0.65 g of the title compound, which was used in subsequent reactions without further purification. LC-MS (Method B) (ESI+): m/z 274.90 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.00 (s, 1H), 7.77 (d, J=7.8 Hz, 2H), 7.46 (d, J=7.8 Hz, 2H), 4.78 (s, 2H), 3.84 (s, 3H).

Step 6: Synthesis of 6-Chloro-1-(4-(1-methyl-2-(trifluoromethyl)-1H-imidazol-4-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-16)

To a stirred solution of 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.40 g, 2.5 mmol) in DMF (10 mL), was added K₂CO₃ (0.517 g, 3.70 mmol) in one portion. After stirring for 10 minutes at room temperature, 4-(4-(chloromethyl)phenyl)-1-methyl-2-(trifluoromethyl)-1H-imidazole (0.638 g, 2.30 mmol) was added, and the reaction mixture was stirred at room temperature for 16 It Progress of the reaction was monitored by TLC. After completion, the reaction mixture was poured onto ice water (50 mL) and extracted with EA (2×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-50% EA in hexane to afford 0.15 g of the title compound. LC-MS (Method B) (ESI+): m/z 392.95 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.30 (s, 1H), 8.49 (s, 1H), 7.94 (s, 1H), 7.72 (d, J=8.3 Hz, 2H), 7.29 (d, J=8.3 Hz, 2H), 5.63 (s, 2H), 3.82 (s, 3H).

The following intermediate was made from the appropriate reagents according to the procedure for Intermediate I-16.

Intermediate	Structure	Analytics
I-17		LC-MS (Method B) (ESI+): m/z 421.00 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.30 (s, 1H), 8.49 (s, 1H), 8.24 (s, 1H), 7.76 (d, J = 7.98 Hz, 2H), 7.30 (d, J = 7.98 Hz, 2H), 5.63 (s, 2H), 4.56 (td, J = 6.48, 12.96 Hz, 1H), 1.48 (d, J = 6.48 Hz, 6H).

Preparation of Common Intermediate I-18

Step 1: Synthesis of ethyl 4-acetyl-3-methoxybenzoate

To a stirred solution of 1-(4-bromo-2-methoxyphenyl) ethan-1-one 1 (3.00 g, 13.1 mmol) in ethanol (60 mL), was added triethylamine (3.67 mL, 26.2 mmol) and the mixture was degassed with argon for 10 min. To the reaction mixture was added PdCl₂(dppf) (0.957 g, 0.131 mmol) at room temperature, and the resulting mixture was heated at 80° C. under carbon monoxide (20 psi pressure) for 311. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-5% EA in hexane as eluent to afford the title compound (2.50 g). LC-MS (Method B) (ESI+): m/z 223.00 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 7.72-7.76 (m, 1H), 7.64-7.70 (m, 2H), 4.42 (dq, J=3.99, 7.15 Hz, 2H), 4.00 (br s, 1H), 3.99 (s, 2H), 2.65 (s, 1H), 2.64 (s, 2H), 1.43 (dt, J=3.99, 6.98 Hz, 3H).

Step 2: Synthesis of ethyl 4-(2,2-dibromoacetyl)-3-methoxybenzoate

To a stirred solution of ethyl 4-acetyl-3-methoxybenzoate 2 (1.00 g, 4.50 mmol) in acetic acid (10 mL), was added bromine (0.16 mL, 3.153 mmol) at room temperature. The resulting mixture was stirred for 3 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude residue was diluted with water (30 mL) and EA (50 mL), and then neutralized using saturated Na₂CO₃ solution. The organic layer was washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to afford the title compound (1.20 g). ¹H-NMR (400 MHz, CDCl₃) δ 7.83 (d, J=7.98 Hz, 1H), 7.69 (d, J=8.48 Hz, 1H), 7.67 (s, 1H), 4.59 (s, 1H), 4.41 (q, J=7.15 Hz, 2H), 4.01 (s, 3H), 1.42 (t, J=6.98 Hz, 3H).

Step 3: Synthesis of ethyl 4-(2-bromoacetyl)-3-methoxybenzoate

To a stirred solution of ethyl 4-(2,2-dibromoacetyl)-3-methoxybenzoate 3 (1.20 g, 3.17 mmol) in THF (15 mL), was added triethyl amine (0.44 mL, 3.17 mmol) and diethylphosphite (0.433 g, 3.166 mmol) at room temperature. The resulting mixture was stirred for 3 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture diluted with EA (30 mL) and washed with brine (3×10 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-15% EA in hexane as eluent to afford the title compound (0.900 g). LC-MS (Method B) (ESI+): m/z 300.80 (M)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 7.84 (d, J=7.98 Hz, 1H), 7.69 (d, J=7.98 Hz, 1H), 7.67 (s, 1H), 4.60 (s, 2H), 4.41 (q, J=7.15 Hz, 2H), 4.02 (s, 3H), 1.42 (t, J=6.98 Hz, 3H).

Step 4: Synthesis of ethyl 3-methoxy-4-(2-(trifluoromethyl)-1H-imidazol-4-yl)benzoate

To a stirred solution of ethyl 4-(2-bromoacetyl)-3-methoxybenzoate 4 (0.900 g, 3.00 mmol) in THF (20 mL), was added 2,2,2-trifluoroacetimidamide (1.68 g, 15.0 mmol) at room temperature. The reaction mixture was then heated at 60° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with EA (50 mL) and washed with saturated NaHCO₃ solution (2×30 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude residue was purified by silica gel chromatography using 20-30% EA in hexane as eluent to afford the title compound (0.300 g). LC-MS (Method B) (ESI+): m/z 315.10 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 13.82 (br s, 1H), 8.17 (d, J=7.48 Hz, 1H), 7.92 (br s, 1H), 7.64 (d, J=7.98 Hz, 1H), 7.59 (s, 1H), 4.33 (q, J=7.31 Hz, 2H), 4.10 (s, 3H), 1.34 (t, J=6.98 Hz, 3H).

Step 5: Synthesis of ethyl 3-methoxy-4-(1-methyl-2-(trifluoromethyl)-1H-imidazol-4-yl)benzoate

To a stirred solution of ethyl 3-methoxy-4-(2-(trifluoromethyl)-1H-imidazol-4-yl)benzoate 5 (0.300 g, 0.955 mmol) in DMF (10 mL) at 0° C., was added 60% dispersion of sodium hydride in oil (0.057 g, 1.43 mmol) and methyl iodide (0.089 mL, 1.43 mmol). The reaction mixture was allowed to warm to room temperature, and then stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was poured over ice cold water (50 mL) and extracted with EA (2×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-15% EA in hexane as eluent to afford the title compound (0.240 g). LC-MS (Method B) (ESI+); m/z 328.90 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.14 (d, J=8.48 Hz, 1H), 8.04 (s, 1H), 7.64 (dd, J=1.50, 7.98 Hz, 1H), 7.59 (s, 1H), 4.33 (q, J=7.15 Hz, 2H), 4.00 (s, 3H), 3.87 (s, 3H), 1.33 (t, J=7.23 Hz, 3H).

Step 6: Synthesis of (3-methoxy-4-(1-methyl-2-(trifluoromethyl)-1H-imidazol-4-yl)phenyl)methanol

To a stirred solution of ethyl 3-methoxy-4-(1-methyl-2-(trifluoromethyl)-1H-imidazol-4-yl) benzoate 6 (0.320 g, 0.975 mmol) in dry THF (10 mL) at 0° C., was added DIBAL-H (1M solution in toluene, 1.46 mL, 1.46 mmol). The reaction mixture was allowed to warm to room temperature, and then stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with IN HCl (20 mL) and extracted with EA (3×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to afford the crude title compound (0.260 g). LC-MS (Method B) (ESI+): m/z 287.30 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.94 (d, J=7.83 Hz, 1H), 7.84 (s, 1H), 7.05 (s, 1H), 6.95 (d, J=7.82 Hz, 1H), 5.21 (t, J=4.89 Hz, 1H), 4.51 (d, J=4.89 Hz, 2H), 3.92 (s, 3H), 3.84 (s, 3H).

Step 7: Synthesis of 4-(4-(chloromethyl)-2-methyloxyphenyl)-1-methyl-2-(trifluoromethyl)-1H-imidazole

To a stirred solution of (3-methoxy-4-(1-methyl-2-(trifluoromethyl)-1H-imidazol-4-yl)phenyl)methanol 7 (0.260 g, 0.909 mmol) in DCM (10 mL) at 0° C., was added thionyl chloride (0.065 mL, 0.91 mmol). The mixture was stirred for 1 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with DCM (20 mL) and washed with saturated Na₂CO₃ solution (3×20 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to afford the crude title compound (0.260 g). LC-MS (Method B) (ESI+): m/z 304.80 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.00 (d, J=7.98 Hz, 1H), 7.90 (s, 1H), 7.18 (s, 1H), 7.08 (d, J=7.98 Hz, 1H), 4.78 (s, 2H), 3.94 (s, 3H), 3.85 (s, 3H).

Step 8: Synthesis of 6-chloro-1-(3-methoxy-4-(1-methyl-2-(trifluoromethyl)-1H-imidazol-4-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-18)

To a stirred solution of 4-(4-(chloromethyl)-2-methoxyphenyl)-1-methyl-2-(trifluoromethyl)-1H-imidazole 8 (0.250 g, 0.822 mmol) in DMF (5 mL), was added potassium carbonate (0.170 g, 1.23 mmol) and 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.126 g, 0.822 mmol) at room temperature. The resulting mixture was stirred for 16 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was poured over ice cold water (30 mL) and extracted with EA (2×30 mL). The combined organic layer was washed with brine (2×30 mL), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 30-50% EA in hexane as eluent to afford the title compound (0.150 g). LC-MS (Method B) (ESI+): m/z 423.00 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.31 (s, 1H), 8.50 (s, 1H), 7.92 (d, J=7.98 Hz, 1H), 7.86 (s, 1H), 7.11 (s, 1H), 6.82 (d, J=7.98 Hz, 1H), 5.64 (s, 2H), 3.89 (s, 3H), 3.83 (s, 3H).

Preparation of Common Intermediate I-19

Step 1: Synthesis of Methyl 4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-yl)benzoate

To a solution of methyl 4-hydrazinylbenzoate hydrochloride (1.0 g, 4.92 mmol) and 1,1,1-trifluoropentane-2,4-dione (758 mg, 4.92 mop in HFIP (5 mL) cooled to 0° C., was added a solution of TEA (994 mg, 9.84 mmol) in HFIP (3 mL) dropwise over 5 min. After addition, the resulting mixture was stirred at room temperature for 1 hour, then quenched with water (20 mL) and extracted with DCM (100 mL×3). The combined organics were dried with anhydrous Na₂SO₄ (30 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (EA:n-Hex=120) to provide 1.1 g of the title compound. LC-MS (Method A) (ESI+): m/z 285 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 8.18 (d, J=8.7 Hz, 2H), 7.57 (d, J=8.7 Hz, 2H), 6.50 (s, 1H), 3.96 (s, 3H), 2.41 (s, 3H).

Step 2: Synthesis of (4-(5-Methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)methanol

To a solution of methyl 4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)-benzoate (1.0 g, 3.52 mmol) in dry THF (20 mL) at 0° C., was added DIBAL-H (10.5 mL, 10.56 mmol, 1 M in toluene) over 10 min. After the addition, the reaction mixture was warmed to rt. After the reaction was complete as indicated by TLC analysis, the reaction was quenched with a saturated NH₄Cl solution (20 mL), extracted with EA (100 ml×3). The combined organic layers were dried with anhydrous Na₂SO₄ (50 g), filtered and concentrated. The crude product was purified by silica gel chromatography (PE:EA=20:1 to 10:1) to give 1.1 g of the title compound. ¹H-NMR (300 MHz CDCl₃) δ 7.40-7.49 (m, 4H), 6.46 (s, 1H), 4.76 (s, 2H), 2.34 (s, 3H), 2.17 (br s, 1H).

Step 3: Synthesis of 1-(4-(Chloromethyl)phenyl)-5-methyl-3-(trifluoromethyl)-1H-pyrazole

To a solution of (4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)methanol (0.82 g, 3.20 mmol) in DCE (20 mL), was added in SOCl₂ (1.14 g, 9.61 mmol) in one portion. After the reaction was stirred at 50° C. for 30 min, the mixture was cooled to 0° C. and quenched with water (10 mL). The resulting solution was neutralized with saturated NaHCO₃ (aq) solution and extracted with DCM (3×100 mL). The combined organic layer was dried over anhydrous Na₂SO₄ (50 g), filtered and concentrated to dryness to afford 480 mg of crude product, which was used for the next step directly. LC-MS (Method A) (ESI+): m/z 275 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.53 (d, J=8.7 Hz, 2H), 7.46 (d, J=8.7 Hz, 2H), 6.47 (s, 1H), 4.64 (s, 2H), 2.37 (s, 3H).

Step 4: Synthesis of 6-Chloro-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-19)

To a solution of 1-(4-(chloromethyl)phenyl)-5-methyl-3-(trifluoromethyl)-1H-pyrazole (0.48 g, 1.75 mmol) in DMF (8 mL), was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.27 g, 1.75 mmol) and K₂CO₃ (0.60 g, 4.38 mmol). The reaction was stirred at room temperature for 2 hours, and then quenched by water (20 mL) and extracted with EA (50 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (30 g), filtered and concentrated in vacuo. The resulting residue was purified by silica gel chromatography (PE:EA=20:1 to 10:1) to give 370 mg of the title product with a small amount of regioisomer. LC-MS (Method A) (ESI+): m/z 393,395 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.06 (s, 1H), 8.19 (s, 1H), 7.51 (d, J=8.7 Hz, 2H), 7.42 (d, J=8.7 Hz, 2H), 6.44 (s, 1H), 5.70 (s, 2H), 2.33 (s, 3H).

The following common intermediates were prepared according the procedure of I-19 from the appropriate reagents:

Intermediate	Structure	Analytics
I-20		LC-MS (Method B) (ESI+): m/z 421.00 (M + H)+; 1H-NMR (300 MHz, DMSO-d6) δ 9.33 (s, 1H), 8.53 (s, 1H), 7.41-7.53 (m, 4H), 6.81 (s, 1H), 5.76 (s, 2H), 2.94 (td, J = 6.73, 13.46 Hz, 1H), 1.12 (d, J = 6.98 Hz, 6H).
I-21		LC-MS (Method B) (ESI+): m/z 445.00 (M + H)+; 1H-NMR (300 MHz, DMSO-d6) δ 9.33 (s, 1H), 8.54 (s, 1H), 7.76 (s, 1H), 7.45- 7.49 (m, 2H), 7.38-7.42 (m, 2H), 7.21-7.27 (m, 1H), 6.52-6.56 (m, 1H), 6.28 (d, J = 3.49 Hz, 1H), 5.77 (s, 2H).

Preparation of Common Intermediate I-22

Step 1: Synthesis of 6-chloro-4-methoxy-1H-pyrazolo[3,4-d]pyrimidine

To a solution of 4,6-dichloro-1H-pyrazolo[3,4-d]pyrimidine 1 (330 mg, 1.74 mmol) in methanol (10 mL) was added potassium carbonate (240 mg, 1.74 mmol). After the mixture was stirred at rt for 24 h, the reaction was quenched with saturated ammonium chloride (30 mL) solution and extracted with EA (20 mL×3). The combined organic layer was dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (eluent: EA/n-Hex=1/10) to afford 120 mg of the title compound. LC-MS (Method A) (ESI+): m/z 185 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 10.69 (br s, 1H), 8.09 (s, 1H), 4.19 (s, 3H).

Step 2: Synthesis of 6-chloro-4-methoxy-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-22)

The compound was synthesized according to the procedure for the preparation of common intermediate I-19. LC-MS (Method A) (ESI+): m/z 423 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 8.05 (s, 1H), 7.45 (m, 4H), 6.44 (s, 1H), 5.63 (s, 2H), 4.15 (s, 3H), 2.31 (s, 3H).

The Following Common Intermediate was Prepared According the Procedure of I-22 from the Appropriate Reagents:

Intermediate	Structure	Analytics
I-22b		LC-MS (Method A) (ESI+): m/z 437 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 7.97 (s, 1H), 7.47 (d, J = 8.1 Hz, 2H), 7.35 (d, J = 8.1 Hz, 2H), 7.28 (s, 1H), 5.56 (s, 2H), 4.11 (s, 3H), 3.96 (q, J = 7.5 Hz, 2H), 1.34 (t, J = 7.5 Hz, 3H).

Preparation of Common Intermediate I-23

Step 1: Synthesis of methyl 4-hydrazineyl-3-methoxybenzoate

To a stirred solution of methyl 4-amino-3-methoxybenzoate 1 (5.0 g, 27.6 mmol) in conc. HCl (55 mL) at −10° C., was added dropwise an aqueous solution of NaNO₂ (1.99 g, 29.0 mmol) in water (5 mL). To the resulting reaction mixture was added dropwise a solution of SnCl₂ (26.0 g, 138 mmol) in conc. HCl (35 mL), and the reaction was stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the solid obtained was filtered and dried under reduced pressure. The crude compound was washed with diethyl ether (50 mL), filtered and dried under reduced pressure to afford the crude title compound (8.0 g) that was used in the next step without purification. ¹H-NMR (400 MHz, DMSO-d₆) δ 10.43 (br s, 2H), 7.95-8.40 (m, 1H), 7.57 (d, J=8.31 Hz, 1H), 7.44 (s, 1H), 7.09 (d, J=8.31 Hz, 1H), 3.88 (s, 3H).

Step 2: Synthesis of methyl 3-methoxy-4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzoate

A stirred solution of methyl 4-hydrazinyl-3-methoxybenzoate 2 (2.0. g, 12.98 mmol) and 1,1,1-trifluoropentane-2,4-dione (6.09 g, 25.97 mmol) in ethanol (20 mL), was heated at 90° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and concentrated under reduced pressure. The crude compound was purified by size silica gel chromatography using 0-30% EA in hexane to afford the title compound (2.5 g). LC-MS (Method B) (ESI+): m/z 315.05 (M+H)⁺.

Step 3: Synthesis of (3-methoxy-4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl) phenyl) methanol

To a stirred solution of methyl 3-methoxy-4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl) benzoate 3 (2.5 g, 7.96 mmol) in THF (40 mL) at 0° C., was added dropwise DIBAL-H (16 mL, 15.9 mmol, 1.0 M solution in THF). The resulting mixture was stirred for 2 h at 0° C., and progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with IN HCl (4 mL) at 0° C. and extracted with EA (100 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated raider reduced pressure to afford the crude 4 (1.5 g). The crude product was used as is without purification. LC-MS (Method B) (ESI+): m/z 287.45 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) (δ 7.31 (d, J=7.98 Hz, 1H), 7.21 (s, 1H), 7.05 (d, J=7.98 Hz, 1H), 6.67 (s, 1H), 5.40 (br s, 1H), 4.59 (br s, 2H), 3.79 (s, 3H), 2.09 (s, 3H).

Step 4: Synthesis of 6-chloro-1-(3-methoxy-4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-23)

To an ice cooled solution of (3-methoxy-4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl) phenyl) methanol 4 (1.0 g, 3.494 mmol) in THF (10 mL), was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.486 g, 3.144 mmol), DTAD (1.20 g, 5.240 mmol) and TPP (2.747 g, 10.48 mmol). The reaction mixture was stirred at room temperature for 2 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (30 mL) and extracted with EA (3×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by size silica gel chromatography using 0-40% EA in hexane as eluent to afford the title compound (1.0 g). LC-MS (Method B) (ESI+): m/z 423 (M+H)⁺.

Preparation of Common Intermediate I-24

Step 1: Synthesis of (4-(4-(Trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanol

A solution of 3,3-dibromo-1,1,1-trifluoropropan-2-one (1.0 g, 7.3 mmol) and NaOAc (533.5 mg, 8.1 mmol) in H₂O (7.3 mL), was stirred at 100° C. for 1 hour. The reaction mixture was then cooled to 0° C. and the solution of 4-(hydroxymethyl)benzaldehyde (2.18 g, 8.08 mmol) and NH₄OH (9.3 mL) in MeOH (37 mL), was added over 10 min. After addition, the reaction mixture was stirred at ambient temperature overnight. The resulting mixture was concentrated under reduced pressure to remove most of the solvent. To the concentrated residue was added water (20 mL) and the mixture was extracted with EA (100 mL×3). The combined organic layer was washed with brine, dried over anhydrous Na₂SO₄ (50 g), filtered, and concentrated to dryness in vacuo. The resulting crude product was slurried in DCM (30 mL), collected by filtration, and dried in vacuo to afford 1.1 g of the title compound ¹H-NMR (300 MHz, CD₃OD) δ 7.88 (d, J=8.4 Hz, 2H), 7.64 (s, 1H), 7.48 (d, J=8.4 Hz, 2H), 4.66 (s, 2H).

Step 2: Synthesis of 4-(4-(Trifluoromethyl)-1H-imidazol-2-yl)benzaldehyde

To a solution of (4-(4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanol (1 g, 4.1 mmol) in EA (80 mL), was added Dess-Martin reagent (2.6 g, 6.2 mmol) portion-wise at 0° C. over 5 min. After addition, the reaction was stirred at ambient temperature overnight. The resulting suspension was filtered, and the filter cake was rinsed with EA (20 mL). The filtrate was washed with saturated aqueous NH₄Cl solution (20 mL), dried with anhydrous Na₂SO₄ (20 g), filtered and concentrated in vacuo. The concentrated residue was purified by silica gel chromatography (PE:EA=20:1 to 5:1) to give 0.9 g of the title compound. ¹H-NMR (300 MHz, CD₃OD) δ 10.04 (s, 1H), 8.12 (d, J=8.4 Hz, 2H), 8.03 (d, J=8.4 Hz, 2H), 7.74 (s, 1H).

Step 3: Synthesis of 4-(1-Methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzaldehyde

To a solution of 4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzaldehyde (0.9 g, 3.8 mmol) in DMF (40 mL) at room temperature, was added Cs₂CO₃ (3.7 g, 11.2 mmol) and MeI (1.1 g, 7.5 mmol) in one portion. After the reaction was stirred at ambient temperature for 1 hour, the reaction was quenched with water (100 mL) and extracted with EA (100 mL×2). The combined organic layer was washed with water (50 mL×2), dried with anhydrous Na₂SO₄ (50 g) and concentrated in vacuo. The concentrated residue was purified by silica gel chromatography (PE:EA=20:1 to 5:1) to give 0.8 g of the title compound. ¹H-NMR (300 MHz, CDCl₃) 510.09 (s, 1H), 8.00 (d, J=8.4 Hz, 2H), 7.86 (d, J=8.4 Hz; 2H), 7.38 (s, 1H), 3.85 (s, 3H).

Step 4: Synthesis of 1-(4-(1-Methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethan-1-ol

To a solution of 4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzaldehyde (0.8 g, 3.2 mmol) in THF (30 mL), was added CH₃MgBr (4.7 mL, 4.7 mmol, 1 M in THF) dropwise over 10 min at 0° C. After addition, the reaction was stirred at 0° C. for 1.5 hr, and then quenched by addition of a saturated aqueous NH₄Cl (20 mL) solution. The resulting mixture was extracted with EA (100 mL×2), and the combined organic layer was washed with brine (20 mL), dried over anhydrous Na₂SO₄ (30 g) and concentrated in vacuo to give 0.9 g of the crude title compound. ¹H-NMR (300 MHz, CDCl₃) δ 7.60 (d, J=8.1 Hz, 2H), 7.47 (d, J=8.1 Hz, 2H), 7.31 (s, 1H), 4.97 (q, J=6.3, 1H), 3.81 (s, 3H), 1.52 (d, J=6.3 Hz, 3H).

Step 5: Synthesis of 2-(4-(1-Chloroethyl)phenyl)-1-methyl-4-(trifluoromethyl)-1H-imidazole

To a solution of 1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethan-1-ol (570 mg, 2.1 mmol) in DCE (20 mL), was added SOCl₂ (753.8 mg, 6.3 mmol) in one portion. After addition, the reaction was stirred at 60° C. for 1 hour, and then concentrated to dryness in vacuo. The residue was dissolved in EA (100 mL), and then treated with a saturated NaHCO₃ solution. After separation, the organic layer was dried with anhydrous Na₂SO₄ (30 g) and concentrated in vacuo. The concentrated crude product was purified by silica gel chromatography (PE:EA=20:1) to give 330 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 7.64 (d, J=8.4 Hz, 2H), 7.53 (d, J=8.4 Hz, 2H), 7.32 (s, 1H), 5.13 (q, J=6.6 Hz, 1H), 3.79 (s, 3H), 1.87 (d, J=6.6 Hz, 3H).

Step 6: Synthesis of 6-Chloro-1-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine (I-24)

To a solution of 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (321.2 mg, 2.1 mmol) in DMF (14 mL), was added 2-(4-(1-chloroethyl)phenyl)-1-methyl-4-(trifluoromethyl)-1H-imidazole (400 mg, 1.4 mmol) and K₂CO₃ (574.5 mg, 4.2 mmol). After addition, the reaction mixture was stirred at 65° C. overnight, then quenched with water (30 mL) and extracted with EA (50 mL×2). The combined organic layer was washed with water (20 mL×2), dried over anhydrous Na₂SO₄ (30 g), filtered and concentrated to dryness in vacuo. The concentrated residue was purified by silica gel chromatography (PE:EA=5:1 to 3:1) to give 40 mg of the title compound. Its regioisomer was obtained as the major product after purification. ¹H-NMR (300 MHz, CDCl₃) δ 9.03 (s, 1H), 8.19 (s, 1H), 7.50-7.64 (m, 4H), 7.29 (s, 1H), 6.26 (q, J=7.2, 1H), 3.75 (s, 3H), 204 (d, J=7.2 Hz, 3H).

The Following Common Intermediates were Prepared According the Procedure of I-24 from the Appropriate Reagents:

Intermediate	Structure	Analytics
I-25		1H-NMR (300 MHz, CDCl3) δ 9.05 (s, 1H), 8.17 (s, 1H), 7.70 (d, J = 8.4 Hz, 2H), 7.46 (d, J = 8.4 Hz, 2H), 5.90 (s, 1H), 5.67 (s, 2H), 4.20 (q, J = 7.2 Hz, 2H), 1.45 (t, J = 7.2 Hz, 3H).
I-26		LC-MS (Method C) (ESI+): m/z 439.29 (M + H)+; 1H-NMR (300 MHz, DMSO-d6) δ 9.31 (s, 1H), 8.56 (s, 1H), 8.10 (d, J = 0.98 Hz, 1H), 7.53 (t, J = 7.83 Hz, 1H), 7.39 (dd, J = 0.98, 11.25 Hz, 1H), 7.27 (dd, J = 1.47, 7.83 Hz, 1H), 6.30 (q, J = 7.17 Hz, 1H), 3.85 (q, J = 7.17 Hz, 2H), 1.95 (d, J = 6.85 Hz, 3H), 1.25 (t, J = 7.34 Hz, 3H).

Preparation of Common Intermediate I-27

Step 1: Synthesis of 2-bromo-1-ethyl-4-(trifluoromethyl)-1H-imidazole

To a stirred solution of 1-ethyl-4-(trifluoromethyl)-1H-imidazole 1 (12.0 g, 73.2 mmol) in THF (75 mL) at −78° C., was added n-BuLi (1.6M in hexane, 68.5 mL, 110 mmol) dropwise. The resulting mixture was stirred for 30 min at −78° C. and was then treated with a solution of CBr₄ (36.3 g, 109.75 mmol) in dry THF (75 mL). The reaction mixture was allowed to warm room temperature and then stirred for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with saturated NH₄Cl solution and extracted with EA (3×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel column chromatography eluting with 0-10% EA in hexane to afford the title compound (8.00 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 8.09 (s, 1H), 4.01 (q J=7.34 Hz, 2H), 1.33 (t, J=7.34 Hz, 3H).

Step 2: Synthesis of 1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorophenyl)ethan-1-one

To a stirred solution of 2-bromo-1-ethyl-4-(trifluoromethyl)-1H-imidazole 2 (1.80 g, 7.44 mmol) in dioxane:H₂O (8:2 mL) was added K₃PO₄ (3.94 g, 18.6 mmol) and (4 acetyl-2-fluorophenyl)boronic acid 3 (1.48 g, 8.18 mmol). The resulting mixture was degassed with argon for 10 min, and then treated with X-Phos (0.708 g, 1.49 mmol) and X-Phos-Pd-G2 (0.292 g, 0.372 mmol) in a sealed tube at room temperature. The reaction mixture was further degassed with argon for 10 min and then heated at 100° C. for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-20% EA in hexane to afford the title compound (1.85 g). LC-MS (Method B) (ESI+): m/z 301.15 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.14-8.20 (m, 1H), 7.93 (d, J=9.29 Hz, 2H), 7.76 (t, J=7.34 Hz, 1H), 3.93 (q, J=7.01 Hz, 2H), 2.66 (s, 3H), 1.29 (t, J=7.34 Hz, 3H).

Step 3: Synthesis of (R)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorophenyl)ethan-1-ol

To a stirred solution of 1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorophenyl)ethan-1-one 4 (2.30 g, 7.67 mmol) in THF (18 mL), was added (S)-2-Methyl-CBS-oxazoborolidine (0.42 mL 1.53 mmol) at room temperature. The resulting mixture was then heated at 45° C. for 1 h. To the resulting reaction mixture was added borane-DMS (1.09 mL, 11.5 mmol), and the mixture was heated at 60° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, quenched with methanol (10 mL) and concentrated under reduced pressure. The crude compound was purified by silica gel column chromatography eluting with 0-30% EA in hexane to afford the title compound (2.10 g). LC-MS (Method B) (ESI+): m/z 303.00 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.10 (s, 1H), 7.50 (t, J=7.82 Hz, 1H), 7.30-7.37 (m, 2H), 5.43 (d, J=4.40 Hz, 1H), 4.81 (m, J=5.87 Hz, 1H), 3.88 (q, J=7.17 Hz, 2H), 1.37 (d, J=6.36 Hz, 3H), 1.27 (t, J=7.09 Hz, 3H).

Step 3: Synthesis of(S)-6-chloro-1-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorophenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine (I-27)

To a stirred solution of (R)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorophenyl)ethan-1-ol 5 (2.10 g, 6.95 mmol) in THF (12 mL) at 0° C., was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (1.07 g, 6.95 mmol), DEAD (2.41 g, 13.9 mmol) and TPP (2.25 g, 13.9 mmol). The reaction mixture was stirred at room temperature for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (10 mL) and extracted with EA (3×10 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude product was purified by silica gel column chromatography using 0-30% EA in hexane to afford the title compound (2.20 g). LC-MS (Method B) (ESI+): m/z 439.22 (M+H)⁺.

The Following Common Intermediates were Prepared According the Procedure of I-27 from the Appropriate Ketones and CBS Reducing Reagents:

Intermediate	Structure	Analytics
I-28		1H-NMR (400 MHz, DMSO-d6) δ 9.30 (s, 1H), 8.54 (s, 1H), 8.01 (s, 1H), 7.60 (d, J = 8.31 Hz, 2H), 7.46 (d, J = 8.31 Hz, 2H), 6.27 (q, J = 7.01 Hz, 1H), 4.05 (q, J = 7.34 Hz, 2H), 1.95 (d, J = 7.34 Hz, 3H), 1.30 (t, J = 7.34 Hz, 3H).
I-29		LC-MS (Method C) (ESI+): m/z 435.00 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.30 (s, 1H), 8.54 (s, 1H), 8.16 (s, 1H), 7.53- 7.59 (m, 1H), 7.52-7.56 (m, 1H), 7.45-7.49 (m, 2H), 6.23-6.31 (m, 1H), 4.43 (td, J = 6.55, 13.34 Hz, 1H), 1.96 (d, J = 6.98 Hz, 3H), 1.38 (d, J = 6.48 Hz, 6H).
I-30		LC-MS (Method C) (ESI+): m/z 435.00 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.30 (s, 1H), 8.55 (s, 1H), 8.17 (s, 1H), 7.52- 7.55 (m, 2H), 7.45-7.50 (m, 2H), 6.27 (q, J = 6.65 Hz, 1H), 4.40- 4.48 (m, 1H), 1.96 (d, J = 6.98 Hz, 3H), 1.38 (d, J = 6.48 Hz, 6H).

Preparation of Common Intermediate I-31

Step 1: Synthesis of 2-(4-(((Tert-butyldimethylsilyl)oxy)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazole

To a solution of (4-(4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanol (1.90 g, 7.85 mmol), DMAP (95.8 mg, 0.79 mmol) and TEA (1.19 g, 11.78 mmol) in THF (40 mL) at room temperature, was added TBSCl (1.42 g, 9.42 mmol) in one portion. After addition, the reaction mixture was stirred at room temperature for 1.5 hours. The reaction was then quenched with water (20 mL) and extracted with EA (150 ml×3). The combined organic layer was dried over anhydrous Na₂SO₄ (50 g), filtered and concentrated in vacuo. The concentrated residue was purified by silica gel chromatography (EA:n-Hex=1:10 to 1:1) to give 2.69 g of the title compound. LC-MS (Method A) (ESI+): m/z 357 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.82 (br s, 1H), 7.68 (d, J=8.7 Hz, 2H), 7.26-7.31 (m, 3H), 4.66 (s, 2H), 0.84 (s, 9H), 0.00 (s, 6H).

Step 2: Synthesis of 3-(2-(4-(Hydroxymethyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)azetidine-1-carboxylate

To a solution of 2-(4-(((tert-butyldimethylsilyl)oxy)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazole (2.50 g, 7.02 mmol) in DMF (40 mL), was added ten-butyl 3-iodoazetidine-1-carboxylate (2.58 g, 9.13 mmol) and Cs₂CO₃ (6.87 g, 21.06 mmol). The reaction mixture was stirred at 120° C. for 4 hours. The reaction was then quenched with water (80 mL) and extracted with EA (150 mL×3). The combined organic layer was washed with water (50 mL×2), dried with anhydrous Na₂SO₄ (100 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (DCM:MeOH=100:1 to 20:1) to give 917 mg of the title compound. LC-MS (Method A) (ESI+): m/z 398 (M+H); ¹H-NMR (300 MHz, CDCl₃) δ7.73 (s, 1H), 7.37-7.44 (m, 4H), 5.06 (m, 1H), 4.74 (s, 2H), 4.37-4.43 (m, 2H), 4.07-4.16 (m, 2H), 2.86 (br s, 1H), 1.46 (s, 9H).

Step 3: Synthesis of tert-Butyl 3-(2-(4-(Chloromethyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)azetidine-1-carboxylate

To a solution of tert-butyl 3-(2-(4-(hydroxymethyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl) azetidine-1-carboxylate (0.92 g, 2.32 mmol) in DCE (22 mL), was added pyridine (1.10 g, 13.92 mmol) and SOCl₂ (0.83 g, 6.95 mmol). The reaction was then stirred at room temperature overnight before concentration to dryness in vacuo. The resulting residue was purified by column chromatography (EA:n-Hex=1:10 to 1:4) to give 480 mg of the title compound. LC-MS (Method A) (ESI+): m/z 416 (M+H); ¹H-NMR (300 MHz, CDCl₃) δ 7.75 (s, 1H), 7.52 (d, J=8.1 Hz, 2H), 7.46 (d, J=8.1 Hz, 2H), 5.07 (m, 1H), 4.64 (s, 2H), 4.41-4.47 (t, J=9.0 Hz, 21-1), 4.09-4.14 (m, 2H), 4.47 (s, 9H).

Step 4: Synthesis of tert-Butyl 3-(2-(4-(6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)azetidine-1-carboxylate (I-31)

A solution of tert-butyl 3-(2-(4-(chloromethyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl) azetidine-1-carboxylate (0.45 g, 1.07 mmol), 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.18 g, 1.18 mmol) and K₂CO₃ (0.37 g, 2.68 mmol) in DMF (13 mL) was stirred at room temperature for 3 hours. The mixture was then quenched with water (30 mL) and extracted with EA (100 mL×3). The combined organic layer was washed with water (20 mL) and dried over anhydrous Na₂SO₄ (50 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (EA:Hex=1:10 to 1:0) to give 280 mg of the title compound. LC-MS (Method A) (ESI+): m/z 534 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.07 (s, 1H), 8.19 (s, 1H), 7.72 (s, 1H), 7.41-7.49 (m, 4H), 5.70 (s, 2H), 5.01 (m, 1H), 4.36-4.42 (t, J=8.7 Hz, 2H), 4.06-4.13 On, 2H), 1.42 (s, 9H).

Preparation of Common Intermediate I-32

Step 1: Synthesis of Ethyl 4-(3-(difluoromethyl)-5-methyl-1H-pyrazol-1-yl)benzoate

To a solution of ethyl 4-hydrazinylbenzoate hydrochloride salt (300 mg, 1.5 mmol) and 1,1-difluoropentane-2,4-dione (201.5 mg, 1.5 mmol) in HFIP (2 mL) at 0° C., was added a solution of TEA (299.6 mg, 3.0 mmol) in HFIP (1 mL) dropwise over 2 min. After addition, the reaction was stirred at room temperature for 2.5 hours. The reaction was then quenched with water (10 mL) and extracted with DCM (20 mL×2). The combined organic layer was washed with water (10 mL), dried over anhydrous Na₂SO₄ (20 g) and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EA=15:1 to 3:1) to give 300 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ8.17 (dd, J=69, 1.8 Hz, 2H), 7.56 (dd, J=69, 1.8 Hz, 2H), 6.71 (t, J=54.9 Hz, 1H), 6.48 (s, 1H), 3.96 (s, 3H), 2.42 (s, 3H).

Step 2: Synthesis of (4-(3-(Difluoromethyl)-5-methyl-1H-pyrazol-1-yl)phenyl)methanol

The title compound was synthesized according to the step 3 of common intermediate 1-1. ¹H-NMR (300 MHz, CDCl₃) δ 7.49 (dd, J=6.3, 2.1 Hz, 2H), 7.42 (dd, J=6.3, 2.1 Hz, 2H), 6.70 (t, J=55.2 Hz, 1H), 6.44 (s, 1H), 4.78 (d, J=5.7 Hz, 2H), 2.35 (s, 3H), 1.90 (t, J=5.7 Hz, 1H).

Step 3: Synthesis of 1-(4-(Chloromethyl)phenyl)-3-(difluoromethyl)-5-methyl-1H-pyrazole

To a solution of (4-(3-(difluoromethyl)-5-methyl-1H-pyrazol-1-yl)phenyl)methanol (290 mg, 1.2 mmol) in DCE (10 mL), was added SOCl₂ (426.4 mg, 3.6 mmol) in one portion. After addition, the reaction was stirred at 60° C. for 1 hour, then concentrated in vacuo to give 300 mg of the crude title compound. ¹H-NMR (300 MHz, CDCl₃) δ7.52 (dd, J=6.3, 2.1 Hz, 2H), 7.44 (dd, J=6.3, 2.1 Hz, 2H), 6.70 (t, J=54.9 Hz, 1H), 6.44 (s, 1H), 4.65 (s, 2H), 2.37 (s, 3H).

Step 4: Synthesis of 6-Chloro-1-(4-(3-(difluoromethyl)-5-methyl-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-32)

A solution of 1-(4-(chloromethyl)phenyl)-3-(difluoromethyl)-5-methyl-1H-pyrazole (300 mg, 1.2 mmol), 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (270.9 mg, 1.8 mmol) and K₂CO₃ (484.6 mg, 351 mmol) in DMF (12 mL) was stirred at 90° C. for 1.5 hours. The reaction was then quenched with water (25 mL) and extracted with EA (50 mL×2). The combined organic layer was washed with water (20 mL×2), dried over anhydrous Na₂SO₄ (30 g) and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EA=5:1 to 3:1) to give 150 mg of title compound with a small amount of the regioisomer. ¹H-NMR (300 MHz, CDCl₃) δ 9.06 (s, 1H), 8.19 (s, 1H), 7.50 (dd, J=6.6, 1.8 Hz, 2H), 7.41 (dd, J=6.6, 1.8 Hz, 2H), 6.67 (t, J=54.9 Hz, 1H), 6.42 (s, 1H), 5.69 (s, 2H), 2.33 (s, 3H).

Preparation of Common Intermediate I-33 and I-34

Step 1: Synthesis of Ethyl 4-bromobenzimidate hydrochloride salt

Gaseous HCl was bubbled through a vigorously stirred solution of 4-bromobenzonitrile (4.2 g, 23.07 mmol) in anhydrous MeOH (40 mL) at 0° C. for 311 The mixture was then stirred at rt overnight. The resulting reaction mixture was poured into Et₂O (40 mL), and the resulting solid precipitate was collected by filtration. The solid was suspended in cold DCM (80 mL) and neutralized by a saturated aqueous NaHCO₃ solution (80 mL). After the organic phase was separated, the aqueous phase was extracted with DCM (40 mL×2). The combined organic phase was dried with sodium sulfate (40 g), filtered and concentrated to afford 5.0 g of the title compound. LC-MS (Method A) (ESI+): m/z 214 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ7.81 (br s, 1H), 7.51-7.68 (m, 4H), 3.92 (s, 3H).

Step 2: Synthesis of 4-Bromobenzohydrazonamide

To a solution of methyl 4-bromobenzimidate (4.6 g, 21.6 mmol) in IPA (80 mL) at 0° C., was added hydrazine hydrate (1.6 g, 25.9 mmol) in IPA (20 mL) dropwise over 30 min. The reaction mixture was stirred in an ice-water bath for 1 h and then warmed to rt overnight. After the reaction was completed as indicated by TLC analysis, the reaction mixture was concentrated to dryness. The residue was diluted with Et₂O (35 mL) and a large amount of solid was precipitated. The suspension was stirred at rt for 1 h, then the solid was collected by filtration to afford 3.8 g of the crude title compound. LC-MS (Method A) (ESI+): m/z 214 (M+H)⁺; ¹H-NMR (300 MHz, DMSO) δ 7.63 (d, J=8.7 Hz, 2H), 7.52 (d, J=8.7 Hz, 2H), 5.66 (br s, 2H), 5.08 (br s, 2H).

Step 3: Synthesis of 3-(4-Bromophenyl)-5-(difluoromethyl)-1H-1,2,4-triazole

A solution of 2,2-difluoroacetic anhydride (1.63 g, 9.38) in DCM (20 mL) was added dropwise over 5 min to a mixture of 4-bromobenzohydrazonamide (2.0 g, 9.38 mmol) and TEA (2.84 g, 28.14 mmol) in DCM (70 mL) at 0° C. After the addition, the reaction mixture was warmed to rt and stirred overnight. After the reaction was completed as indicated by TLC analysis, the mixture was quenched with brine (80 mL) and extracted with DCM (80 mL×2). The combined organic layer was dried with sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (PE:EA=8:1 to 4:1) to yield 1.2 g of the title compound. LC-MS (Method A) (ESI+): m/z 274 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.85 (d, J=8.4 Hz, 2H), 7.66 (d, J=8.4 Hz, 2H), 6.81 (t, J=53.4 Hz, 1H).

Step 4: Synthesis of 5-(4-Bromophenyl)-3-(difluoromethyl)-1-methyl-1H-1,2,4-triazole and 3-(4-bromophenyl)-5-(difluoromethyl)-1-methyl-1H-1,2,4-triazole

To a solution of 3-(4-bromophenyl)-5-(difluoromethyl)-1H-1,2,4-triazole (1.05 g, 3.85 mmol) in DMF (25 mL) at 0° C., was added sodium hydride (200 mg, 5.0 mind) portion-wise over 5 min. After the resulting mixture was stirred at 0° C. for 20 min, MeI (1.09 g, 7.69 mmol) was added dropwise over 1 min. The reaction was warmed to rt and stirred for 1 h. After the reaction was completed as indicated by TLC analysis, the reaction was quenched with ice-water (50 mL) and extracted with EA (70 mL×2). The combined organic layer was washed with water (60 mL×2), dried with sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (PE:EA=20:1 to 15:1) to yield 260 mg of 5-(4-bromophenyl)-3-(difluoromethyl)-1-methyl-1H-1,2,4-triazole and 750 mg of 3-(4-bromophenyl)-5-(difluoromethyl)-1-methyl-1H-1,2,4-triazole. 5-(4-bromophenyl)-3-(difluoromethyl)-1-methyl-1H-1,2,4-triazole: LC-MS (Method A) (ESI+): m/z 288 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ7.70 (d, J=6.6, 1.8 Hz, 2H), 7.59 (d, J=6.6, 1.8 Hz, 2H), 6.73 (t, J=53.7 Hz, 1H), 4.03 (s, 3H). 3-(4-bromophenyl)-5-(difluoromethyl)-1-methyl-1H-1,2,4-triazole: LC-MS (Method A) (ESI+): m/z 288 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₁) δ 7.93 (d, J=8.7 Hz, 2H), 7.58 (d, J=8.7 Hz, 2H), 6.87 (t, J=53.7 Hz, 1H), 4.09 (s, 3H).

Step 5: Synthesis of 3-(Difluoromethyl)-1-methyl-5-(4-vinylphenyl)-1H-1,2,4-triazole

Under nitrogen protection, a solution of 5-(4-bromophenyl)-3-(difluoromethyl)-1-methyl-1H-1,2,4-triazole (1.6 g, 5.57 mmol) in toluene (50 ml) was treated with tributylvinylstannane (2.65 g, 8.36 mmol) and Pd(PPh₃)₄ (644 mg, 0.56 mmol) in one portion. The reaction was stirred at 90° C. for 5 hours, then quenched with water (50 mL) and extracted with EA (50 mL×2). The combined organic layer was washed with brine (60 mL), dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by flash silica chromatography (PE:EA=10:1) to yield 1.2 g of the title compound LC-MS (Method A) (ESI+): m/z 236 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.68 (d, J=8.1 Hz, 2H), 7.56 (d, J=8.1 Hz, 2H), 6.74 (t, J=53.7 Hz, 1H), 6.73 (m, 1H), 5.88 (d, J=17.4 Hz, 1H), 5.40 (d, J=11.1 Hz, 1H), 4.05 (s, 3H).

Step 6: Synthesis of 5-(Difluoromethyl)-1-methyl-3-(4-vinylphenyl)-1H-1,2,4-triazole

The compound was synthesized according to the procedure of step 5 of common intermediate I-33. LC-MS (Method A) (ESI+): m/z 236 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 8.02 (d, J=8.1 Hz, 2H), 7.51 (d, J=8.1 Hz, 2H), 6.90 (t, J=53.7 Hz, 1H), 6.78 (m, 1H), 5.83 (d, J=17.2 Hz, 1H), 5.31 (d, J=10.8 Hz, 1H), 4.10 (s, 3H).

Step 7: Synthesis of 4-(3-(Difluoromethyl)-1-methyl-1H-1,2,4-triazol-5-yl)benzaldehyde

To a solution of 3-(difluoromethyl)-1-methyl-5-(4-vinylphenyl)-1H-1,2,4-triazole (450 mg, 1.91 mmol) in THF (15 mL) and water (8 mL) at rt, was added NaIO₄ (1.23 g, 5.75 mmol) and OsO₄ (4.2 mg, 1 mol %) in one portion. After the reaction was completed as indicated by TLC analysis, the reaction mixture was quenched by a saturated ammonium chloride solution (20 mL) and extracted with EA (30 mL×2). The combined organic layer was washed with brine (40 mL), dried over sodium sulfate (20 g), filtered and concentrated to afford 450 mg of the crude title compound. LC-MS (Method A) (ESI+): m/z 238 (M+H)⁺.

Step 8: Synthesis of 4-(5-(Difluoromethyl)-1-methyl-1H-1,2,4-triazol-3-yl)benzaldehyde

The compound was synthesized according to the procedure of step 7 of common intermediate I-33. LC-MS (Method A) (ESI+): m/z 238 (M+H)⁺. ¹H-NMR (300 MHz, CDCl₃) δ 9.99 (s, 1H), 8.17 (d, J=8.1 Hz, 2H), 7.90 (d, J=8.1 Hz, 2H), 6.84 (t, J=52.5 Hz, 1H), 4.06 (s, 3H).

Step 9: Synthesis of (4-(3-(Difluoromethyl)-1-methyl-1H-1,2,4-triazol-5-yl)phenyl)methanol

To a solution of 4-(3-(difluoromethyl)-1-methyl-1H-1,2,4-triazol-5-yl)benzaldehyde (450 mg, 1.90 mmol) in THF (15 mL), was added NaBH₄ (94 mg, 2.47 mmol) in one portion. After the reaction was completed as indicated by TLC analysis, the reaction was quenched by ice-water (20 mL) and extracted with EA (40 mL×2). The combined organic layer was washed with brine (40 mL), dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (PE:EA=32) to yield 340 mg of the title compound. LC-MS (Method A) (ESI+): m/z 240 (M+H); ¹H-NMR (300 MHz CDCl₃) δ 7.71 (d, J=8.1 Hz, 2H), 7.54 (d, J=8.1 Hz, 2H), 6.74 (t, J=53.7 Hz, 1H), 4.81 (d, J=5.7 Hz, 2H) 4.04 (s, 3H).

Step 10: Synthesis of (4-(5-(Difluoromethyl)-1-methyl-1H-1,2,4-triazol-3-yl)phenyl)methanol

The compound was synthesized according to the procedure of step 9 of common intermediate 1-14. LC-MS (Method A) (ESI+): m/z 240 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 8.06 (d, J=8.4 Hz, 2H), 7.45 (d, J=8.4 Hz, 2H), 7.89 (t, J=52.5 Hz, 1H), 4.75 (d, J=6.0 Hz, 2H) 4.13 (s, 3H).

Step 11: Synthesis of 5-(4-(Chloromethyl)phenyl)-3-(difluoromethyl)-1-methyl-1H-1,2,4-triazole

To a solution of (4-(3-(difluoromethyl)-1-methyl-1H-1,2,4-triazol-5-yl)phenyl)methanol (320 mg, 1.34 mmol) in DCE (15 mL), was added SOCl₂ (318 mg, 2.68 mmol) in one portion. The reaction was stirred at 60° C. for 1 h. After the reaction was completed as indicated by TLC analysis, the reaction mixture was concentrated to dryness to afford 340 mg of the crude title compound. LC-MS (Method A) (ESI+): m/z 258 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.72 (d, J=8.1 Hz; 2H), 7.57 (d, J=8.1 Hz, 2H), 6.74 (t, J=53.7 Hz, 1H), 4.66 (s, 2H), 4.05 (s, 3H).

Step 12: Synthesis of 3-(4-(Chloromethyl)phenyl)-5-(difluoromethyl)-1-methyl-1H-1,2,4-triazole

The compound was synthesized according to the procedure of step 11 of common intermediate 1-33. LC-MS (Method A) (ESI+): m/z 258 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 8.06 (d, J=8.1 Hz, 2H), 7.45 (d, J=8.1 Hz, 2H), 6.89 (t, J=52.5 Hz, 1H), 4.63 (s, 2H), 4.10 (s, 3H).

Step 13: Synthesis of 6-Chloro-1-(4-(3-(difluoromethyl)-1-methyl-1H-1,2,4-triazol-5-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-33)

To a solution of 5-(4-(chloromethyl)phenyl)-3-(difluoromethyl)-1-methyl-1H-1,2,4-triazole (340 mg, 1.32 mmol) and 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (244 mg, 1.58 mmol) in DMF (15 mL), was added Cs₂CO₃ (474 mg, 1.45 mmol) in one portion. The reaction was stirred at 80° C. for 1 h, then cooled to rt. The reaction was then quenched by ice-water (40 mL), and then extracted with EA (50 mL×2). The combined organic layer was washed with water (40 mL×3), dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (PE:EA=1:1 to 1:3) to yield 180 mg of the title compound. LC-MS (Method A) (ESI+): m/z 376 (M+H)⁺; ¹H-NMR (300 MHz CDCl₃) δ 9.07 (s, 1H), 8.20 (s, 1H), 7.69 (d, J=8.4 Hz, 2H), 7.52 (d, J=8.4 Hz, 2H), 6.71 (t, J=53.7 Hz, 1H), 5.72 (s, 2H), 4.00 (s, 3H).

Step 14: Synthesis of 6-Chloro-1-(4-(5-(difluoromethyl)-1-methyl-1H-1,2,4-triazol-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-34)

The compound was synthesized according to the procedure of step 13 of common intermediate 1-33. LC-MS (Method A) (ESI+): m/z 376 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.05 (s, 1H), 8.18 (s, 1H), 8.03 (d, J=8.4 Hz, 2H), 7.43 (d, J=8.4 Hz, 2H), 6.86 (t, J=58.2 Hz, 1H), 5.67 (s, 2H), 4.10 (s, 3H).

Preparation of Common Intermediate I-35

Step 1: Synthesis of 5-bromo-1-ethyl-3-(trifluoromethyl)-1H-1,2,4-triazole

To an ice cooled solution of 5-bromo-3-(trifluoromethyl)-1H-1,2,4-triazole 1 (0.500 g, 2.31 mmol) in DMF (10 mL), was added sodium hydride (0.138 g, 3.47 mmol) portion-wise. The resulting mixture was stirred for 15 min, and then ethyl iodide (0.360 mL, 0.708 g, 0.462 mmol) was added. The reaction mixture was allowed to warm to room temperature and then stirred for 16 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (20 mL) and extracted with EA (2×30 mL). The combined organic layer was washed with water (20 mL), and brine (20 mL), then dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography wing 0-5% EA in n-hexane to afford the title compound (0.280 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 4.28 (q, J=7.01 Hz, 2H), 1.40 (t, J=7.09 Hz, 3H).

Step 2: Synthesis of 4-(1-ethyl-3-(trifluoromethyl)-1H-1,2,4-triazol-5-yl)benzaldehyde

To a stirred solution of 5-bromo-1-ethyl-3-(trifluoromethyl)-1H-1,2,4-triazole 2 (0.250 g, 1.03 mmol) in dioxane:H₂O (10:4 mL) in a sealed tube were added K₃PO₄ (0.436 g, 2.07 mmol) and (4-formylphenyl)boronic acid 3 (0.200 g, 1.34 mmol). The resulting mixture was degassed with argon for 10 men, and then X-Phos (0.049 g, 0.102 mmol) and X-Phos-Pd-G₂ (0.040 g, 0.051 mmol) were added at room temperature. The reaction mixture was further degassed with argon for 10 min and then heated at 100° C. for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, quenched with water (20 mL) and extracted with EA (3×30 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-25% EA in hexane to afford the title compound (0.220 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 10.13 (s, 1H), 8.11 (d, J=6.85 Hz, 2H), 8.00 (d, J=7.34 Hz, 2H), 4.38 (q, J=6.85 Hz, 2H), 1.44 (t, J=6.85 Hz, 3H).

Step 3: Synthesis of (4-(1-ethyl-3-(trifluoromethyl)-1H-1,2,4-triazol-5-yl)phenyl)methanol

To a stirred solution of 4-(1-ethyl-3-(trifluoromethyl)-1H-1,2,4-triazol-5-yl) benzaldehyde 4 (0.200 g, 0.743 mmol) in methanol (5 mL) was added sodium borohydride (0.056 g, 1.49 mmol) portion-wise. The reaction mixture was allowed to warm to room temperature and was further stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, quenched with water (20 mL) and extracted with EA (3×30 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-40% EA in hexane to afford the title compound (0.150 g). LC-MS (Method B) (ESI+): m/z 271.40 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.72 (d, J=8.31 Hz, 2H), 7.53 (d, J=7.82 Hz, 2H), 5.38 (t, J=5.62 Hz, 1H), 4.61 (d, J=5.87 Hz, 2H), 4.34 (q, J=7.34 Hz, 2H), 1.42 (t, J=7.34 Hz, 3H).

Step 4: Synthesis of 6-chloro-1-(4-(1-ethyl-3-(trifluoromethyl)-1H-1,2,4-triazol-5-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-35)

To a stirred solution of (4-(1-ethyl-3-(trifluoromethyl)-1H-1,2,4-triazol-5-yl)phenyl)methanol 5 (0.130 g, 0.479 mmol) in THF (5 mL) at 0° C., was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.066 g, 0.43 mmol), DEAD (0.163 g, 0.959 mmol) and TPP (0.246 g, 0.959 mmol). The reaction mixture was allowed to warm to room temperature and was then stirred for 6 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (20 mL) and extracted with EA (3×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-30% EA in hexane as eluent to afford the title compound (0.100 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 9.33 (s, 1H), 8.53 (s, 1H), 7.73 (d, J=8.31 Hz, 2H), 7.45 (d, J=7.83 Hz, 2H), 5.77 (s, 2H), 4.30 (q, J=7.17 Hz, 2H), 1.39 (t, J=7.34 Hz, 3H).

The following intermediates were prepared from the appropriate heterocycles and alkylating reagents according to the method of preparation for I-35:

Intermediate	Structure	Analytics
I-36		LC-MS (Method A) (ESI+): m/z 394 (M + H)+; 1HNMR (300 MHz, CDCl3) δ 9.07 (s, 1H), 8.20 (s, 1H), 7.69 (d, J = 8.1 Hz, 2H), 7.53 (d, J = 8.1 Hz, 2H), 5.72 (s, 2H), 4.03 (s, 3H).
I-37		LC-MS (Method B) (ESI+): m/z 412 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.33 (s, 1H), 8.54 (s, 1H), 7.70 (t, J = 7.83 Hz, 1H), 7.38 (d, J = 10.76 Hz, 1H), 7.26 (d, J = 8.31 Hz, 1H), 5.79 (s, 2H), 3.88 (s, 3H).
I-38		LC-MS (Method B) (ESI+): m/z 422.13 (M + H)+.

Preparation of Common Intermediate I-39

Step 1: Synthesis of 1-(4-Bromophenyl)-3-(trifluoromethyl)-1H-pyrazol-5-ol

To a solution of (4-bromophenyl)hydrazine hydrochloride (4.9 g, 22 mmol) in ethanol (60 mL) at rt, was added sodium hydroxide (898 mg, 22.5 mmol) in one portion. The resulting mixture was stirred at rt for 30 man, a then a solution of ethyl 4,4,4-trifluoro-3-oxobutanoate (4.9 g, 27 mmol) in ethanol (10 mL) was added in one portion to the reaction mixture. The reaction was heated to ref lux and stirred overnight. After the reaction was completed as indicated by TLC analysis, the reaction was cooled to rt and quenched with water (150 mL). The resulting mixture was acidified to pH 5 with diluted HCl solution (1 N) and extracted with EA (100 mL×3). The combined organic layer was dried over sodium sulfate (50 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EA=30:1 to 6:1) to afford 6.2 g of the title compound. LC-MS (Method A) (ESI+): m/z 307 (M+H); ¹H-NMR (300 MHz, CD₃OD) δ 7.62-7.74 (m, 4H), 5.84 (s, 1H).

Step 2: Synthesis of 1-(4-Bromophenyl)-5-methoxy-3-(trifluoromethyl)-1H-pyrazole

To a solution of methyl 1-(4-bromophenyl)-3-(trifluoromethyl)-1H-pyrazol-5-ol (6.2 g, 20 mmol) in DMF (65 ml) at 0° C., was added sodium hydride (60% dispersion, 973 mg, 0.024 mmol) portion-wise over 5 min. After the mixture was stirred at 0° C. for 30 min, iodomethane (4.26 g, 0.03 mmol) was added dropwise to the reaction mixture over 2 min. The reaction was stirred at rt for 3 h, and then quenched with ice-water (200 mL) and extracted with EA (100 mL×3). The organic phase was washed with water (100 mL×2), dried over sodium sulfate (40 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (PE to PE:EA=100:1) to yield 4.4 g of the title compound. LC-MS (Method A) (ESI+): m/z 321 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 7.55-7.63 (m, 4H), 5.95 (s, 1H), 4.00 (s, 3H).

Step 3: Synthesis of 4-(5-Methoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzaldehyde

To solution of 1-(4-bromophenyl)-5-methoxy-3-(trifluoromethyl)-1H-pyrazole (1 g, 3.13 mmol) in THF (10 mL) at −78° C., was added n-BuLi (1.5 mL, 3.76 mmol) dropwise over 15 min. After the reaction was stirred at −78° C. for 1 h, anhydrous DMF (0.48 mL, 6.26 mmol) was added dropwise to the reaction mixture over 5 min. After addition, the reaction mixture was stirred at −78° C. for additional 30 min and then warmed to rt. After the reaction was completed as indicated by TLC analysis, the reaction was quenched with ice-water (20 mL). The resulting mixture was extracted with EA (30 mL×2), dried over sodium sulfate (30 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EA=30:1 to 20:1) to yield 570 mg of the title compound. LC-MS (Method A) (ESI+): m/z 271 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 10.04 (s, 1H), 7.97 (d, J=6.6 Hz, 4H), 3.99 (s, 1H), 4.05 (s, 3H).

Step 4: Synthesis of (4-(5-Methoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)methanol

To a solution of 4-(5-methoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzaldehyde (570 mg, 2.11 mmol) in THF (10 mL) at n, was added NaBH₄ (80 mg, 2.11 mmol) in one portion. The reaction was stirred at rt for 1 h. After the reaction was completed as indicated by TLC analysis, the reaction was quenched with water (20 mL) and extracted with EA (20 mL×2). The combined organic layer was dried over sodium sulfate (20 g), filtered and concentrated in vacuo to afford 620 mg of the title compound that was used without purification in subsequent steps. LC-MS (Method A) (ESI+): m/z 273 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 7.68 (d, J=8.4 Hz, 2H), 7.45 (d, J=8.4 Hz, 2H), 5.96 (s, 1H), 4.75 (d, J=5.1 Hz, 2H), 3.99 (s, 3H), 1.58 (s, 1H).

Step 5: Synthesis of 1-(4-(Chloromethyl)phenyl)-5-methoxy-3-(trifluoromethyl)-1H-pyrazole

To a solution of (4-(5-methoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)methanol (570 mg, 2.10 mmol) in DCE (20 ml), was added SOCl₂ (748 mg, 6.29 mmol) in one portion. After the addition, the reaction was stirred at 50° C. for 20 mitt After the reaction mixture was completed as indicated by TLC analysis, the reaction mixture was concentrated to dryness in vacuo to afford 500 mg of the crude title compound that was used without purification in subsequent steps. LC-MS (Method A) (ESI+): m/z 291 (M+H)⁺.

Step 6: Synthesis of 6-Chloro-1-(4-(5-methoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-39)

To a solution of 1-(4-(chloromethyl)phenyl)-5-methoxy-3-(trifluoromethyl)-1H-pyrazole (520 mg, 1.79 mmol) in DMF (25 mL), was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (276 mg, 1.79 mmol) and potassium carbonate (741 mg, 5.37 mmol). After the addition, the reaction was stirred at 70° C. for 1 h. After the reaction was completed as indicated by TLC analysis, the reaction was quenched with water (30 mL) and extracted with EA (30 mL×2). The combined organic phase was washed with water and brine, dried over sodium sulfate (20 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EA=10:1 to 5:1) to afford 330 mg of the title compound. LC-MS (Method A) (ESI+): m/z 409 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 9.05 (s, 1H), 8.17 (s, 1H), 7.67 (d, J=8.4 Hz, 2H), 7.47 (d, J=8.4 Hz, 2H), 5.93 (s, 1H), 5.66 (s, 2H), 3.99 (s, 3H).

The Following Intermediates were Prepared from the Appropriate Heterocycles and Alkylating Reagents According to the Method of Preparation for I-39:

Intermediate	Structure	Analytics
I-40		LC-MS (Method A) (ESI+): m/z 423 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.05 (s, 1H), 8.17 (s, 1H), 7.70 (d, J = 8.4 Hz, 2H), 7.46 (d, J = 8.4 Hz, 2H), 5.90 (s, 1H), 5.67 (s, 2H), 4.20 (q, J = 7.2 Hz, 2H), 1.45 (t, J = 7.2 Hz, 3H).
I-41		1H-NMR (300 MHz, CDCl3) δ 9.05 (s, 1H), 8.17 (s, 1H), 7.70 (d, J = 8.4 Hz, 2H), 7.46 (d, J = 8.4 Hz, 2H), 5.94 (s, 1H), 5.66 (s, 2H), 4.27(d, J = 4.5 Hz, 2H), 3.73 (d, J = 4.5 Hz, 2H), 3.73 (s, 1H).
I-42		LC-MS (Method A) (ESI+): m/z 595 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.05 (s, 1H), 8.17 (s, 1H), 7.70 (d, J = 8.4 Hz, 2H), 7.44 (d, J = 8.4 Hz, 2H), 5.94 (s, 1H), 5.66 (s, 2H), 4.21 (t, J = 4.8 Hz, 2H), 4.01 (t, J = 4.8 Hz, 2H), 1.08-1.02 (m, 3H), 0.98 (d, J = 5.4 Hz, 18H).
I-43		LC-MS (Method A) (ESI+): m/z 410 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.06 (s, 1H), 8.66 (d, J = 2.1 Hz, 1H), 8.17 (s, 1H), 7.90 (dd, J = 8.4, 2.1 Hz, 1H), 7.71 (d, J = 8.4 Hz, 1H), 5.96 (s, 1H), 5.69 (s, 2H), 4.02 (s, 3H).
I-44		LC-MS (Method A) (ESI+): m/z 511.24 (M + H)+.

Preparation of Common Intermediate I-45

Step 1: Synthesis of ethyl 1-(4-bromophenyl)-5-oxo-4,5-dihydro-1H-pyrazole-3-carboxylate

To a solution of (4-bromophenyl)hydrazine hydrochloride (1.0 g, 4.5 mmol) in ethanol (40 mL) was added potassium carbonate (1.23 g, 8.94 mmol). After the reaction was stirred at rt for 30 min, diethyl but-2-ynedioate (761 mg, 4.47 mmol) in ethanol (10 mL) was added to the reaction dropwise over 5 min. After the reaction was stirred under reflux for 4 h, the reaction was quenched with water (50 mL) and adjusted to pH 5 with a dilute hydrochloric acid solution. The resulting mixture was extracted with EA (40 mL×3). The combined organic layer was dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (eluent: PE/EA=10/1 to 5:1) to afford 320 mg of the title compound. LC-MS (Method A) (ESI+): m/z 311, 313 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 7.74 (d, J=9.0 Hz, 2H), 7.71 (d, J=9.0 Hz, 2H), 6.01 (s, 1H), 4.30-4.38 (q, J=6.9 Hz, 2H), 1.32-1.38 (t, J=6.9 Hz, 3H).

Step 2: Synthesis of ethyl 1-(4-bromophenyl)-5-methoxy-1H-pyrazole-3-carboxylate

To a mixture of ethyl 1-(4-bromophenyl)-5-oxo-4,5-dihydro-1H-pyrazole-3-carboxylate (720 mg, 2.32 mmol), triphenylphosphine (913 mg, 3.48 mmol) and methanol (96 mg, 3.02 mmol) in toluene (40 mL) at 0° C., was added DIAD (704 mg, 3.48 mmol) dropwise over 5 min. After the mixture was stirred at 0° C. for 30 min, the reaction was warmed to rt slowly and stirred overnight. After the reaction was complete as indicated by TLC analysis, the mixture was quenched with water (20 mL) and extracted with EA (30 mL×3). The combined organic layer was dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (eluent: PE/EA=20/1 to 10/1) to yield 650 mg of the title compound. LC-MS (Method A) (ESI+): m/z 325, 327 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.65 (d, J=8.7 Hz, 2H), 7.56 (d, J=8.7 Hz, 2H), 6.22 (s, 1H), 4.39-4.46 (q, J=7.2 Hz, 2H), 3.98 (s, 3H), 1.39-1.44 (t, J=7.2 Hz, 3H).

Step 3: Synthesis of methyl 1-(4-bromophenyl)-5-methoxy-1H-pyrazole-3-carboxamide

In a seal tube, a solution of ethyl 1-(4-bromophenyl)-5-methoxy-1H-pyrazole-3-carboxylate (650 mg, 2.01 mmol) in a saturated methanolic ammonia solution (30 mL) was stirred at 60° C. for 7 h, After the reaction was complete as indicated by TLC analysis, the mixture was quenched with water (30 mL), and extracted with EA (20 mL×3). The combined organic layer was dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (eluent: PE/EA=5/1 to 0/1) to yield 405 mg of the title compound. LC-MS (Method A) (ESI+): m/z 296, 298 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.55-7.65 (m, 4H), 6.82 (s, 1H), 6.26 (s, 1H), 5.40 (s, 1H), 3.99 (s, 3H).

Step 4: Synthesis of 1-(4-bromophenyl)-5-methoxy-1H-pyrazole-3-carbonitrile

To a solution of methyl 1-(4-bromophenyl)-5-methoxy-1H-pyrazole-3-carboxamide (400 mg, 1.36 mmol) in DCM (40 mL) and pyridine (2 mL) at 0° C. was added trifluoroacetic anhydride (1.6 mL) dropwise over 5 min. The reaction was stirred at 0° C. for 1 h. After the reaction was complete as indicated by TLC analysis, the mixture was quenched with a saturated aqueous NH₄Cl solution (40 mL) and extracted with DCM (40 mL×3). The organic layer was washed with water (20 mL) and brine (20 mL), and dried over sodium sulfate (40 g), filtered and concentrated. The resulting residue was purified by silica gel chromatography (eluent: PE/EA=20/1 to 10/1) to yield 295 mg of the title compound. LC-MS (Method A) (ESI+): m/z 278, 280 (M+H)⁺; ¹H-NMR (300 MHz CDCl₃) δ 7.59 (s, 4H), 6.06 (s, 1H), 4.00 (s, 3H).

Step 5: Synthesis of 5-methoxy-1-(4-vinylphenyl)-1H-pyrazole-3-carbonitrile

To a solution of 1-(4-bromophenyl)-S-methoxy-1H-pyrazole-3-carbonitrile (290 mg, 1.05 mmol) in toluene (8 mL) was added tributyl(vinyl)stannane (498 mg, 1.57 mmol) and Pd(Ph₃)₄ (121 mg, 0.11 mmol). The reaction was stirred at 90° C. for 6 h After the reaction was complete as indicated by LC-MS analysis, the mixture was quenched with water (10 mL) and extracted with EA (10 mL×2). The combined organic layer was dried over sodium sulfate (20 g), filtered and concentrated. The resulting residue was purified by silica gel chromatography (eluent: PE/EA=20/1 to 10/1) to yield 200 mg of the title compound. LC-MS (Method A) (ESI+): m/z 226 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.64 (d, J=8.7 Hz, 2H), 7.49 (d, J=8.7 Hz, 2H), 6.74 (dd, J=17.7 Hz, J=10.8 Hz, 1H), 6.06 (s, 1H), 5.80 (d, J=17.7 Hz, 1H), 5.33 (d, J=10.8 Hz, 1H), 3.99 (s, 3H).

Step 6: Synthesis of 1-(4-formylphenyl)-5-methoxy-1H-pyrazole-3-carbonitrile

To a solution of 5-methoxy-1-(4-vinylphenyl)-1H-pyrazole-3-carbonitrile (20 mg, 0.89 mmol) in THF/H₂O (10 mL/5 mL) and was added NaIO₄ (570 mg, 2.67 mmol) and OsO₄ (22 mg, 0.0) mmol) in one portion. The reaction was stirred at room temperature for 30 min. After the reaction was complete as indicated by TLC analysis, the mixture was quenched with an aqueous NH₄Cl solution (10 mL) and extracted with EA (20 mL×2). The combined organic was dried over sodium sulfate (20 g), filtered and concentrated to afford 210 mg of the crude title compound. LC-MS (Method A) (ESI+): m/z 228 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 10.05 (s, 1H), 7.84-8.05 (m, 4H), 6.01 (s, 1H), 3.99 (s, 3H).

Step 7: Synthesis of 1-(4-(hydroxymethyl)phenyl)-5-methoxy-1H-pyrazole-3-carbonitrile

To a solution of 1-(4-formylphenyl)-5-methoxy-1H-pyrazole-3-carbonitrile (210 mg, 0.93 mmol) in THF (30 mL) was added NaBH₄ (46 mg, 1.2 mmol) portion-wise over min. The reaction was stirred at room temperature for 1 h After the reaction was complete as indicated by TLC analysis, the mixture was quenched with water (20 mL) and extracted with EA (30 mL×2). The combined organic layer was dried over sodium sulfate (20 g) and concentrated. The residue was purified by silica gel chromatography (eluent: PE/EA=5/1 to 2/1) to yield 170 mg of the title compound. LC-MS (Method A) (ESI+): m/z 230 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ7.67 (d, J=8.7 Hz, 2H), 7.47 (d, J=8.7 Hz, 211), 6.07 (s, 1H), 4.76 (d, J=6 Hz, 2H), 3.99 (s, 3H), 1.75 (t, J=6 Hz, 1H).

Step 8: Synthesis of 1-(4-(chloromethyl)phenyl)-5-methoxy-1H-pyrazole-3-carbonitrile

To a solution of 1-(4-(hydroxymethyl)phenyl)-5-methoxy-1H-pyrazole-3-carbonitrile (170 mg, 0.74 mmol) in DCE (10 mL) was added SOCl₂ (176 mg, 1.48 mmol) in one portion, and the reaction was stirred at 50° C. for 1 h. After the reaction mixture was complete as indicated by TLC analysis, the reaction mixture was concentrated to dryness to afford 205 mg of the crude title compound. LC-MS (Method A) (ESI+): m/z 248 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.70 (d, J=8.4 Hz, 2H), 7.49 (d, J=8.4 Hz, 2H), 6.07 (s, 1H), 4.62 (s, 2H), 4.00 (s, 3H).

Step 9: Synthesis of 1-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-5-methoxy-1H-pyrazole-3-carbonitrile (I-45)

To a solution of 1-(4-(chloromethyl)phenyl)-5-methoxy-1H-pyrazole-3-carbonitrile (205 mg, 0.83 mmol) in DMF (5 mL) was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (153 mg, 1.0 mmol) and potassium carbonate (812 mg, 2.49 mmol) in one portion. After the addition, the reaction was stirred at 70° C. for 1 h. After the reaction mixture was complete as indicated by TLC analysis, the mixture was quenched with water (10 mL) and extracted with EA (30 mL×2). The combined organic layer was washed with water (20 mL) and brine (10 mL), dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (eluent: PE/EA=10/1 to 5/1) to afford 57 mg of the title compound. LC-MS (Method A) (ESI+): m/z 366 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.05 (s, 1H), 8.18 (s, 1H), 7.66 (d, J=8.4 Hz, 2H), 7.48 (d, J=8.4 Hz, 2H), 6.04 (s, 1H), 5.67 (s, 2H), 3.97 (s, 3H).

Preparation of Common Intermediate I-46

Step 1: Synthesis of 4,4,4-trifluoro-3-oxobutanenitrile

To a stirred suspension of NaH (10.5 g, 264 mmol) in THF (150 mL) at 0° C., were simultaneously added ethyl 2,2,2-trifluoroacetate 1 (15.0 g, 106 mmol) and MeCN (12.4 g, 159 mmol) under argon atmosphere. The resulting mixture was stirred was at room temperature for 10 min, and then heated to 70° C. for 16K Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with ice cold water (50 mL) and concentrated under reduced pressure to remove the organic phase. The remaining aqueous layer was extracted with diethyl ether (2×30 mL). The aqueous layer was then adjusted to pH 2 using conc. HCl, then extracted with diethyl ether (3×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to afford the crude title compound 2 (18.0 g) that was used in subsequent steps without further purification.

Step 2: Synthesis of ethyl 4-(5-amino-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzoate

To a stirred solution of 4,4,4-trifluoro-3-oxobutanenitrile 2 (3.39 g, 24.8 mmol) in methanol (30 mL), was added methyl 4-hydrazineylbenzoate hydrochloride 3 (2.50 g, 12.47 mmol) at room temperature. The reaction mixture was heated to 80° C. for 16K Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 20-25% EA in hexane as eluent to afford the title compound (2.00 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 8.09 (d, J=8.48 Hz, 2H), 7.79 (d, J=8.48 Hz, 2H), 5.98 (br s, 2H), 5.84 (s, 1H), 3.89 (s, 3H).

Step 3: Synthesis of methyl 4-(5-acetamido-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzoate

To an ice cooled solution of ethyl 4-(5-amino-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzoate 4 (1.00 g, 3.51 mmol) in pyridine (10 mL), was added CH₃COCl (0.37 mL, 5.3 mmol) dropwise. The resulting mixture was stirred for 30 min, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with saturated CuSO₄ solution (30 mL) and extracted with EA (2×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-40% EA in hexane as eluent to afford the title compound (0.800 g). LC-MS (Method B) (ESI+): Obs.: 328.05 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 8.21 (d, J=8.48 Hz, 2H), 7.59 (d, J=8.48 Hz, 2H), 6.95-7.00 (m, 1H), 3.96 (s, 3H), 2.17 (s, 3H).

Step 3: Synthesis of methyl 4-(5-(N-methylacetamido)-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzoate

To a stirred solution of methyl 4-(5-acetamido-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzoate 5 (0.800 g, 2.45 mmol) in CH₃CN (15 mL), was added potassium carbonate (0.506 g, 3.67 mmol) and methyl iodide (0.45 mL, 7.34 mewl) at room temperature. The reaction mixture was then heated in a sealed tube at 85° C. for 16K Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with EA (100 mL) and washed with water (2×25 mL) followed by brine (20 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-30% EA in hexane as eluent to afford the title compound (0.650 g). LC-MS (Method B) (ESI+): Obs.: 342.10 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 8.19 (d, J=8.48 Hz, 2H), 7.57 (d, J=8.48 Hz, 2H), 6.62 (s, 1H), 3.96 (s, 3H), 3.15 (s, 3H), 1.85 (s, 3H).

Step 5: Synthesis of methyl 4-(5-(methylamino)-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzoate

To a stirred solution of methyl 4-(5-(N-methylacetamido)-3-(trifluoromethyl)-1H-pyrazol-1-yl) benzoate 6 (0.650 g, 1.91 mmol) in methanol (10 mL), was added conc. HCl (7 mL) at room temperature. The reaction mixture was then heated at 90° C. for 4 h. Progress of the reaction was monitored by TLC. After completion, the reaction mature was cooled to room temperature, diluted with water (20 mL) and extracted with EA (3×25 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-30% EA in hexane as eluent to afford the title compound (0.500 g). LC-MS (Method C) (ESI+): m/z 299.98 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 8.16 (d, J=8.48 Hz, 2H), 7.68 (d, J=8.48 Hz, 2H), 5.80 (s, 1H), 3.95 (s, 3H), 2.89 (s, 3H).

Step 6: Synthesis of (4-(5-(methylamino)-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)methanol

To a stirred solution of methyl 4-(5-(methylamino)-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzoate 7 (0.500 g, 1.67 mmol) in THF (15 mL) at 0° C., was added DIBAL-H (1M in toluene, 5.00 mL, 5.02 mmol). The resulting mixture was stirred for 30 min, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with aqueous NH₄Cl (10 mL). The resulting solution was diluted with EA (20 mL) and filtered through a pad of Celite. The aqueous layer was separated and re-extracted with EA (3×15 mL). The combined organic layer was washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 50-80°/o EA in hexane as eluent to afford the title compound (0.400 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 7.42-7.51 (m, 4H), 5.89 (s, 1H), 5.83 (d, J=4.40 Hz, 1H), 5.33 (t, J=5.62 Hz, 1H), 4.56 (d, J=5.87 Hz, 2H), 2.69 (d, J=4.89 Hz, 3H).

Step 7: Synthesis of 1-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-N-methyl-3-(trifluoromethyl)-1H-pyrazol-5-amine (I-46)

To a stirred solution of (4-(5-(methylamino)-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)methanol 8 (0.200 g, 0.738 mmol) in THF (10 mL), was added 6-chloro-1N-pyrazolo[3,4-d]pyrimidine (0.1102 g, 0.664 mmol), DIAD (0.336 g, 1.48 mmol) and TPP (0.382 g, 1.48 mmol). The reaction mixture was stirred at room temperature for 1 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (20 mL) and extracted with EA (3×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-40% EA in hexane as eluent to get the title compound (0.160 g). LC-MS (Method C) (ESI+): m/z 407.86 (M+H)⁺.

Preparation of Common Intermediate I-47

Step 1: Synthesis of ethyl 4-(5-amino-3-(trifluoromethyl)-1H-pyrazol-1-yl)-3-fluorobenzoate

To a stirred solution of 4,4,4-trifluoro-3-oxobutanenitrile 1 (0.500 g, 2.136 mmol) in methanol (20 mL), was added ethyl 3-fluoro-4-hydrazineylbenzoate hydrochloride 2 (0.731 g, 5.341 mmol) at room temperature. The reaction mixture was then heated to 80° C. for 16 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 15-25% EA in hexane as eluent to afford the title compound (0.070 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 7.92 (d, J=9.29 Hz, 2H), 7.72 (t, J=7.83 Hz, 1H), 5.91 (s, 2H), 5.75 (s, 1H), 4.37 (q, J=6.85 Hz, 2H), 1.35 (t, J=7.09 Hz, 3H).

Step 2: Synthesis of ethyl 4-(5-(dimethylamino)-3-(trifluoromethyl)-1H-pyrazol-1-yl)-3-fluorobenzoate

To a stirred solution of ethyl 4-(5-amino-3-(trifluoromethyl)-1H-pyrazol-1-yl)-3-fluorobenzoate 3 (0.250 g, 0.788 mmol) in DMF (10 mL) at 0° C., was added 60% dispersion of sodium hydride in oil (0.063 g, 1.577 mewl) and methyl iodide (0.145 mL, 2.365 mmol). The resulting mixture was stirred for 16 h, and the progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with ice cold water (10 mL) and extracted with EA (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-10% EA in hexane as eluent to afford the title compound (0.070 g). ¹H-NMR (400 MHz, DMSO-d₆) δ7.94-8.00 (m, 2H), 7.79-7.85 (m, 1H), 6.40 (s, 1H), 4.37 (q, J=6.85 Hz, 2H), 2.56 (s, 6H), 1.35 (t, J=7.09 Hz, 3H).

Step 3: Synthesis of (4-(5-(dimethylamino)-3-(trifluoromethyl)-1H-pyrazol-1-yl)-3-fluorophenyl)methanol

To an ice cooled solution of ethyl 4-(5-(dimethylamino)-3-(trifluoromethyl)-1H-pyrazol-1-yl)-3-fluorobenzoate 4 (0.150 g, 0.434 mmol) in methanol (10 mL), was added sodium borohydride (0.066 g, 1.739 mmol) portion-wise. Upon complete addition, the reaction mixture was stirred for 5 h and progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with aqueous NH₄Cl solution (10 mL) and extracted with EA (3×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 40-50% EA in hexane to afford the title compound (0.090 g). LC-MS (Method B) (ESI+): m/z 304.00 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.56 (t, J=7.98 Hz, 1H), 7.38 (d, J=11.47 Hz, 1H), 7.32 (d, J=7.98 Hz, 1H), 6.35 (s, 1H), 5.49 (t, J=5.73 Hz, 1H), 4.59 (d, J=5.49 Hz, 2H), 2.54 (s, 6H).

Step 4: Synthesis of 1-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-2-fluorophenyl)-N,N-dimethyl-3-(trifluoromethyl)-1H-pyrazol-5-amine (I-47)

To a stirred solution of (4-(5-(dimethylamino)-3-(trifluoromethyl)-1H-pyrazol-1-yl)-3-fluorophenyl)-methanol 5 (0.080 g, 0.264 mmol) in THF (5 mL), was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.036 g, 0.237 mmol), DTAD (0.119 g, 0.528 mmol) and TPP (0.136 g, 0.528 mmol) at room temperature. The resulting mixture was stirred for 1 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-60% EA in hexane to afford the title compound (0.060 g). LC-MS (Method B) (ESI+): m/z 440.00 (M+H)⁺: ¹H-NMR (400 MHz, DMSO-d₆) δ 9.33 (s, 1H), 8.54 (s, 1H), 7.60 (t, J=8.07 Hz, 1H), 7.38 (d, J=10.76 Hz, 1H), 7.21 (d, J=8.31 Hz, 1H), 6.35 (s, 1H), 5.77 (s, 2H), 2.52 (s, 6H).

The Following Intermediates were Prepared from the Appropriate Heterocycles and Alkylating Reagents According to the Method of Preparation for I-47:

Intermediate	Structure	Analytics
I-48		LC-MS (Method A) (ESI+): m/z 422 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.19 (s, 1H), 8.12 (s, 1H) 7.80 (d, J = 8.4 Hz, 2H), 7.47 (d, J = 8.4 Hz, 2H), 6.08 (s, 1H), 5.87 (s, 2H), 2.62 (s, 6H).
I-49		LC-MS (Method B) (ESI+): m/z 404.00 (M + H)+.

Preparation of Common Intermediate I-50

Step 1: Synthesis of 1-(4-bromophenyl)-3-(trifluoromethyl)-1H-pyrazole-5-thiol

To a solution of 1-(4-bromophenyl)-3-(trifluoromethyl)-1H-pyrazol-5-ol (900 mg, 2.94 mmol) in toluene (40 mL), was added Lawesson's Reagent (2.38 g, 5.88 mmol). The reaction was then stirred under reflux for 4 h. After the reaction was completed as indicated by TLC analysis, the suspension was filtered, and the filtrate was concentrated to dryness to afford 2.6 g of the crude title compound. LC-MS (Method A) (ESI+): m/z 323, 325 (M+H)⁺.

Step 2: Synthesis of 1-(4-bromophenyl)-5-(methylthio)-3-(trifluoromethyl)-1H-pyrazole

To a solution of crude methyl 1-(4-bromophenyl)-3-(trifluoromethyl)-1H-pyrazole-5-thiol (2.6 g, 8.1 mol) in DMF (20 mL) at 0° C., was added NaH (388 mg, 9.69 mmol) portion-wise over 5 mm. After the mixture was stirred at 0° C. for 30 min, MeI (1.72 g, 12.1 mmol) was added dropwise over 2 min. The reaction was stirred at 0° C. initially, and then warmed to room temperature over 3 h. After the reaction was completed as indicated by TLC analysis, the mixture was quenched with ice-water (20 mL) and extracted with EA (20 mL×3). The organic layer was washed with water (20 mL×2) and brine (20 mL), dried over sodium sulfate (20 g), filtered and concentrated. The residue was purified by silica gel chromatography (eluent PE/EA=50/0 to 50/1) to yield 650 mg of the title compound. LC-MS (Method A) (ESI+): m/z 337, 339 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.63 (d, J=6.9 Hz, 2H), 7.48 (d, J=6.9 Hz, 2H), 6.57 (s, 1H), 2.44 (s, 3H).

Step 3: Synthesis of 4-(5-(methylthio)-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzaldehyde

To a solution of 1-(4-bromophenyl)-5-(methylthio)-3-(trifluoromethyl)-1H-pyrazole 3 (550 mg, 1.64 mmol) in anhydrous THF (10 mL) at −78° C., was added n-BuLi (0.98 mL, 2.46 mmol) dropwise over 5 min. After stirring for 1 h at −78° C., DMF (240 mg, 3.28 mmol) was added dropwise over 5 min, and the mixture was warmed to rt slowly over 2 h. After the reaction was complete as indicated by TLC analysis, the mixture was quenched with ice water (20 mL). The resulting mixture was extracted with EA (30 mL×2). The organic layer was dried over sodium sulfate (30 g), filtered and concentrated. The resulting residue was purified by silica gel chromatography (eluent: PE/EA=100/1 to 50/1) to yield 100 mg of the title compound. LC-MS (Method A) (ESI+): m/z 287 (M+H); ¹H-NMR (300 MHz, CDCl₃) δ10.08 (s, 1H), 8.02 (d, J=8.7 Hz, 2H), 7.84 (d, J=8.7 Hz, 2H), 6.61 (s, 1H), 2.48 (s, 3H).

Step 4: Synthesis of (4-(5-(methylthio)-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)methanol

Prepared according to the reduction procedure of I-8. LC-MS (Method A) (ESI+): m/z 289 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.57 (d, J=8.4 Hz, 2H), 7.49 (d, J=8.4 Hz; 2H), 6.57 (s, 1H), 4.78 (s, 2H), 2.43 (s, 3H), 1.83 (br s, 1H).

Step 5: Synthesis of 6-chloro-1-(4-(5-(methylthio)-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-50)

To a suspension of 5 (130 mg, 0.45 mol), 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (90 mg, 0.59 mmol) and PS-TPP (300 mg, 0.9 mmol) in anhydrous THF (10 mL) at 0° C., was added DIAD (136 mg, 0.68 mmol) dropwise over 5 min. The reaction was stirred in an ice-water bath for 30 min and then warmed to rt slowly overnight. After the reaction was completed as indicated by TLC analysis, the reaction was quenched with water (20 mL) and extracted with EA (20 mL×2). The combined organic layer was dried and concentrated. The residue was purified by silica gel chromatography (eluent: PE/EA=10/1 to 1/0) to afford 160 mg of the crude product. The crude product was further purified by preparative HPLC (Method A) to give 30 mg of the title compound. LC-MS (Method A) (ESI+): m/z 425 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.06 (s, 1H), 8.19 (s, 1H), 7.59-7.45 (m, 4H), 6.55 (s, 1H), 5.70 (s, 2H), 2.42 (s, 3H).

Preparation of Common Intermediate I-51

Step 1: Synthesis of Methyl 4-(5-methoxy-1-methyl-1H-1,2,4-triazol-3-yl)benzoate

To a mixture of 3-bromo-5-methoxy-1-methyl-1H-1,2,4-triazole (500 mg, 2.60 mmol), methyl 4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzoate (1.02 g, 3.91 mmol), tricyclohexylphosphine (219.07 mg, 0.78 mmol), K₃PO₄-3H₂O (2.08 g, 7.81 mmol) in dioxane (26 mL) and H₂O (1.3 mL) was added Pd₂(dba)₃ (238.45 mg, 0.26 mmol) under nitrogen. The resulting mixture was stirred at 90° C. for 1 hr. After the reaction was completed as indicated by TLC analysis, the reaction was quenched with water (30 mL) and extracted with EA (25 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (30 g), filtered, and concentrated to give the crude product. The crude product was purified by silica gel chromatography (PE:EA=10:1) to provide 650 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 8.08 (s, 0.4H), 4.17 (s, 3H), 3.93 (s, 3H), 3.68 (s, 3H).

Step 2: Synthesis of (4-(5-Methoxy-1-methyl-1H-1,2,4-triazol-3-yl)phenyl)methanol

To a solution of methyl 4-(5-methoxy-1-methyl-1H-1,2,4-triazol-3-yl) benzoate (650 mg, 2.63 mmol) in THF (26 mL) at 0° C., was added DIBAL-H (1.5 M, 7.9 mL, 11.9 mmol) dropwise over 15 min. The resulting mixture was stirred at 0° C. for 1 h, then slowly diluted with a saturated aqueous NH₄Cl solution (10 mL). The resulting suspension was stirred in an ice-water bath for additional 30 min and then filtered to remove the solids. The filter cake was washed with EA (30 mL×4), and the resulting filtrate was washed with brine (50 mL). After separation, the organic layer was dried over anhydrous Na₂SO₄ (30 g), filtered, and concentrated to give a crude residue that was purified by silica gel chromatography (PE:EA=3:1 to 2:1) to give 500 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 8.00 (d, J=8.4 Hz, 2H), 7.41 (d, J=8.4 Hz, 2H), 4.73 (d, J=6.0 Hz, 2H), 4.16 (s, 3H), 3.67 (s, 3H), 1.70 (t, J=6.0 Hz, 1H).

Step 3: Synthesis of 3-(4-(Chloromethyl)phenyl)-5-methoxy-1-methyl-1H-1,2,4-triazole

To a solution of (4-(5-methoxy-1-methyl-1H-1,2,4-triazol-3-yl)phenyl)methanol (450 mg, 2.05 mmol) in DCM (25 mL) at rt, was added PPh₃ (592 mg, 2.26 mmol) and NBS (438 mg, 2.05 mmol) in one portion. The reaction mixture was stirred at rt for 1.5 h. After the reaction was completed, as indicated by TLC analysis, the reaction mixture was concentrated in vacuo and the crude residue was purified by silica gel chromatography (PE:EA=5:1 to 3:1) to give 480 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 7.98 (d, J=8.4 Hz, 2H), 7.43 (d, J=8.4 Hz, 2H), 4.53 (s, 2H), 4.16 (s, 3H), 3.66 (s, 3H).

Step 4: Synthesis of 6-Chloro-1-(4-(5-methoxy-1-methyl-1H-1,2,4-triazol-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-51)

To a solution of 3-(4-(chloromethyl)phenyl)-5-methoxy-1-methyl-1H-1,2,4-triazole (480 mg, 1.70 mmol) and 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (316 mg, 2.04 mmol) in DMF (17 mL), was added Cs₂CO₃ (1.66 g, 5.10 mmol) in one portion and the reaction was stirred at 80° C. for 1 h. After the reaction was completed (as indicated by TLC analysis), the mixture was cooled to rt. The reaction was then quenched by ice-water (30 mL) and extracted with EA (50 mL×2). The combined organic layer was washed with water (40 mL×3), dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (PE:EA=1:1 to 1:3) to yield 220 mg of the title compound. LC-MS (Method A) (ESI+): m/z 3.56 (M+H); ¹H-NMR (300 MHz, CDCl₃) δ 9.03 (s, 1H), 8.16 (s, 1H), 7.95 (d, J=81 Hz, 2H), 7.40 (d, J=8.1 Hz, 2H), 5.65 (s, 2H), 4.13 (s, 3H), 3.64 (s, 3H).

The Following Intermediate was Prepared from the Appropriate Heterocycle and Alkylating Reagent According to the Method of Preparation for I-51:

Intermediate	Structure	Analytics
I-52		1H-NMR (300 MHz, CDCl3) δ 9.05 (s, 1H), 8.18 (s, 1H), 8.05 (d, J = 8.4 Hz, 2H), 7.43 (d, J = 8.4 Hz, 2H), 5.67 (s, 2H), 4.08 (s, 3H).

Preparation of Common Intermediate I-53

Step 1: Synthesis of (4-(Acetoxymethyl)phenyl)boronic acid

A mixture of (4-(hydroxymethyl)phenyl)boronic acid (3 g, 0.02 mol) and acetic anhydride (4.08 g, 0.04 mol) in pyridine (5 mL, 0.062 mol), was a stirred at rt for 4 it After the reaction was complete as indicated by TLC analysis, the mixture was poured into dilute aqueous HCl solution (2 N, 20 mL) and extracted with EA (30 mL×2). The combined organic phase was washed with saturated sodium bicarbonate solution (50 mL), dried over sodium sulfate (30 g), filtered, and concentrated in vacuo to afford 4.5 g of the crude title compound. ¹H-NMR (300 MHz, CD₃OD) δ 8.04 (d, J=7.8 Hz, 2H), 7.38 (d, J=7.8 Hz, 2H), 5.13 (s, 2H), 2.11 (s, 3H).

Step 2: Synthesis of 4-(3-Cyano-5-methyl-1H-pyrazol-1-yl)benzyl acetate

To a mixture of (4-(acetoxymethyl)phenyl)boronic acid (1.087 g, 5.60 mmol), 5-methyl-1H-pyrazole-3-carbonitrile (500 mg, 11.60 mmol), triethylamine (709 mg, 4.67 mmol), pyridine (1.11 g, 14.07 mmol) in DCM (20 mL), was added cupric acetate monohydrate (1.14 g, 6.26 mmol) and the resulting mixture was stirred at 40° C. overnight. After the reaction was complete as indicated by TLC analysis, the reaction was quenched by addition of water (20 mL) and extracted with DCM (20 mL×2). The combined organic phase was washed with water (20 mL), dried over sodium sulfate (30 g), filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography on silica (PE:EA=30:1 to 6:1) to afford 390 mg of the title compound. LC-MS (Method A) (ESI+): m/z 256 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 7.51 (d, J=8.7 Hz, 2H), 7.44 (d, J=8.7 Hz, 2H), 6.60 (s, 1H), 5.18 (s, 2H), 2.36 (s, 3H), 2.15 (s, 3H).

Step 3 Synthesis of 1-(4-(Hydroxymethyl)phenyl)-5-methyl-1H-pyrazole-3-carbonitrile

To a solution of 4-(3-cyano-5-methyl-1H-pyrazol-1-yl)benzyl acetate (390 mg, 1.53 mmol) in THF (40 mL) and water (5 mL), was added lithium hydroxide (128 mg, 3.06 mmol) in one portion. The reaction was stirred at rt for 3 h After the reaction was complete as indicated by TLC analysis, the reaction was quenched with ice-water (10 mL). The resulting mixture was extracted with EA (10 mL×2) and the layers separated. The combined organic layer was dried over sodium sulfate (10 g), filtered, and concentrated to afford 300 mg of the crude title compound LC-MS (Method A) (ESI+): m/z 214 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 7.56 (d, J=8.4 Hz, 2H), 7.47 (d, J=8.4 Hz, 2H), 6.75 (s, 1H), 4.70 (s, 2H), 2.37 (s, 3H).

Step 4: Synthesis of 1-(4-(Chloromethyl)phenyl)-5-methyl-1H-pyrazole-3-carbonitrile

To a solution of 1-(4-(hydroxymethyl)phenyl)-5-methyl-1H-pyrazole-3-carbonitrile (300 mg, 0.96 mmol) in DCE (6 mL), was added SOCl₂ (341 mg, 2.87 mmol) in one portion. After the addition, the reaction was stirred at 60° C. for 1 h. After the reaction mixture was complete as indicated by TLC analysis, the reaction mixture was concentrated to dryness in vacuo to afford 330 mg of the crude title compound LC-MS (Method A) (ESI+): m/z 232 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 7.55 (d, J=8.4 Hz, 2H), 7.44 (d, J=8.4 Hz, 2H), 6.10 (s, 1H), 4.65 (s, 2H), 2.38 (s, 3H).

Step 5: Synthesis of 1-(4-((6-Chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-5-methyl-1H-pyrazole-3-carbonitrile (I-53)

To a solution of 1-(4-(chloromethyl)phenyl)-5-methyl-1H-pyrazole-3-carbonitrile (330 mg, 1.43 mmol) in DMF (5 mL), was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (220 mg, 1.43 mmol) and potassium carbonate (590 mg, 4.29 mmol). After the addition, the reaction was stirred at 70° C. for 1 h. After the reaction was complete as indicated by TLC analysis, the reaction was quenched with water (10 mL) and extracted with EA (10 mL×2). The combined organic phase was washed with water, dried over sodium sulfate (10 g), filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EA=10:1 to 2:1) to afford 188 mg of the title compound. LC-MS (Method A) (ESI+): m/z 350 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 9.07 (s, 1H), 8.20 (s, 1H), 7.52 (d, J=8.4 Hz, 2H), 7.41 (d, J=8.4 Hz, 2H), 6.58 (s, 1H), 5.71 (s, 2H), 2.36 (s, 3H).

Preparation of Common Intermediate I-54

Step 1: Synthesis of methyl 3-(trifluoromethyl)-1H-pyrazole-5-carboxylate

To a solution of methyl propiolate 2 (500 mg, 5.94 mmol) in DCM (4.0 mL) at rt was added an aqueous NaNO₂ solution (613 mg of NaNO₂ in 2.0 mL of water) in portion. After the addition, the reaction was cooled with ice-water bath and 2,2,2-trifluoroethanamine HCl salt 1 (1.2 g, 8.9 mmol) was added to the reaction portion-wise over 5 min. The reaction was then stirred at 0° C. for 1 h, and then at rt overnight. The mixture was quenched with water (30 mL) and extracted with DCM (30 mL×2). The organic layer was dried over sodium sulfate (20 g), filtered and concentrated to yield 1.1 g of the crude title compound. LC-MS (Method A) (ESI+): m/z 195 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 11.41 (br s, 1H), 7.10 (s, 1H), 3.98 (s, 3H).

Step 2: Synthesis of methyl 1-(4-(acetoxymethyl)phenyl)-3-(trifluoromethyl)-1H-pyrazole-5-carboxylate

To a mixture of methyl 3-(trifluoromethyl)-1H-pyrazole-5-carboxylate 3 (870 mg, 4.48 mmol) and (4-(acetoxymethyl)phenyl)boronic acid (1.1 g, 5.8 mmol) in DCM (20 mL) and DCE (20 mL), was added Cu(OAc)₂ (1.2 g, 6.7 mmol) and pyridine (709 mg, 8.96 mmol). The reaction was then stirred at 40° C. overnight. After the reaction was completed as indicated by TLC analysis, the mixture was filtered, and the filter cake was washed with DCM (30 mL). The combined filtrate was washed with water (30 mL×2), dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (eluent: PE/EA=9/1) to yield 1.1 g of the title compound. LC-MS (Method A) (ESI+): m/z 343 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.43-7.51 (m, 4H), 7.08 (s, 1H), 5.18 (s, 2H), 3.84 (s, 3H), 2.14 (s, 3H).

Step 3: Synthesis of 1-(4-(hydroxymethyl)phenyl)-3-(trifluoromethyl)-1H-pyrazole-5-carboxamide

To a saturated methanolic ammonia solution (10 mL, 7 N) was added methyl 1-(4-(acetoxymethyl) phenyl)-3-(trifluoromethyl)-1H-pyrazole-5-carboxylate 5 (1.1 g, 3.2 mmol) in one portion. The reaction was stirred in a sealed tube at 50° C. for 6 h. After the reaction was completed as indicated by TLC analysis, the mixture was quenched with a saturated ammonium chloride solution (40 mL) and extracted with EA (50 mL×2). The combined organic layer was washed with water (30 mL), brine (30 mL), dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (eluent: DCM/MeOH=50/1 to 20/1) to yield 530 mg of the title compound. LC-MS (Method A) (ESI+): m/z 286 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 7.43-7.51 (m, 4H), 7.19 (s, 1H), 4.68 (s, 2H).

Step 4: Synthesis of 1-(4-(hydroxymethyl)phenyl)-3-(trifluoromethyl)-1H-pyrazole-5-carbonitrile

The compound was synthesized according to the procedure from 1-44 step 4. LC-MS (Method A) (ESI+): m/z 267 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.72 (d, J=8.7 Hz, 2H), 7.58 (d, J=8.4 Hz, 2H), 7.27 (s, 1H), 4.83 (s, 2H).

Steps: Synthesis of 1-(4-(chloromethyl)phenyl)-3-(trifluoromethyl)-1H-pyrazole-5-carbonitrile

The compound was synthesized according to the procedure for the preparation of common intermediate 1-8. LC-MS (Method A) (ESI+): m/z 286 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.74 (d, J=8.1 Hz, 2H), 7.61 (d, J=8.1 Hz, 2H), 7.29 (s, 1H), 4.66 (s, 2H).

Step 6: Synthesis of 1-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-3-(trifluoromethyl)-1H-pyrazole-5-carbonitrile (I-54)

The compound was synthesized according to the procedure for the preparation of common intermediate I-8. LC-MS (Method A) (ESI+): m/z 404 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.08 (s, 1H), 8.20 (s, 1H) 7.71 (d, J=8.4 Hz; 2H), 7.58 (d, J=8.4 Hz, 2H), 7.27 (s, 1H), 5.72 (s, 2H).

Preparation of Common Intermediate I-56

Step 1: Synthesis of 4-methoxy-1H-imidazole

To a stirred solution of 4-bromo-1H-imidazole 1 (15.0 g, 102 mmol) in NaOMe solution (150 mL), was added copper iodide (3.87 g, 20.4 mmol) at room temperature. The reaction mixture was heated to 100° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-80% EA in hexane to afford the title compound (1.50 g). ¹H-NMR (400 MHz, DMSO-d₆) δ11.61 (br. s, 1H), 7.25 (br s, 1H), 6.39 (br s, 1H), 3.64 (s, 3H).

Step 2: Synthesis of 1-isopropyl-4-methoxy-1H-imidazole

To a stirred solution of 4-methoxy-1H-imidazole 2 (1.50 g, 15.3 mmol) in THE (15 mL), was added Cs₂CO₃ (9.90 g, 30.6 mmol) and isopropyl iodide (3.88 g, 23.0 mmol) at room temperature. The reaction mixture was then heated to 60° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (50 mL) and extracted with EA (3×30 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by size silica gel chromatography using 0-50% EA in hexane as eluent to afford the title compound (1.00 g). LC-MS (Method B) (ESI+): m/z 140.98 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.29 (s, 1H), 6.55 (s, 1H), 4.26 (td, J=6.79, 13.33 Hz, 1H), 3.63 (d, J=0.98 Hz, 3H), 1.35 (dd, J=0.98, 6.85 Hz 6H).

Step 3: Synthesis of 2-bromo-1-isopropyl-4-methoxy-1H-imidazole

To a stirred solution of 1-isopropyl-4-methoxy-1H-imidazole 3 (1.00 g, 7.14 mmol) in THF (10 mL) at −78° C., was added n-BuLi (1.6M in hexane, 6.69 mL, 10.7 mmol) dropwise. The resulting solution was stirred for 15 mm at −78° C., and then CBr₄ (3.50 g, 10.7 mmol) was added. The reaction mixture was allowed to warm to room temperature and was stirred for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with saturated NH₄Cl solution (30 mL) and extracted with EA (3×50 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-30% EA in hexane as eluent to afford the title compound (0.700 g). LC-MS (Method B) (ESI+): m/z 221.19 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 6.81 (s, 1H), 4.34 (td, J=6.79, 13.33 Hz, 1H), 3.65 (s, 3H), 1.34 (d, J=6.85 Hz, 6H).

Step 4: Synthesis of 4-(1-isopropyl-4-methoxy-1H-imidazol-2-yl)benzaldehyde

To a stirred solution of 2-bromo-1-isopropyl-4-methoxy-1H-imidazole 4 (0.700 g, 3.21 mmol) in dioxane:H₂O (15:3 mL), was added K₃PO₄ (1.36 g, 6.42 mmol) and (4-formylphenyl)boronic acid 5 (0.621 g, 4.17 mmol). The resulting mixture was degassed with argon for 10 min, and then treated with XPhos (0.152 g, 0.321 mmol) and X-Phos-Pd-G₂ (0.126 g, 0.160 mmol) in a seal tube. The reaction mixture was further degassed with argon for 10 min, and then heated at 100° C. for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, quenched with water (20 mL) and extracted with EA (3×30 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-20% EA in hexane as eluent to afford the title compound (0.400 g).

Step 5: Synthesis of (4-(1-isopropyl-4-methoxy-1H-imidazol-2-yl)phenyl)methanol

To a stirred solution of 4-(1-isopropyl-4-methoxy-1H-imidazol-2-yl)benzaldehyde 6 (0.400 g, 1.64 mmol) in methanol (4 mL) at 0° C., was added sodium borohydride (0.063 g, 1.64 mmol). The reaction mixture was allowed to warm to room temperature and was stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (10 mL) and extracted with EA (3×30 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-70% EA in hexane as eluent to afford the title compound (0.250 g). LC-MS (Method B) (ESI+): m/z 247.04 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.37-7.46 (m, 4H), 6.75 (s, 1H), 4.54 (d, J=5.87 Hz, 2H), 4.43 (tt, J=6.79, 13.27 HA, 2H), 3.70 (s, 3H), 1.35 (d, J=6.85 Hz, 6H).

Step 6: Synthesis of 6-chloro-1-(4-(1-isopropyl-4-methoxy-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-56)

To a stirred solution of (4-(1-isopropyl-4-methoxy-1H-imidazol-2-yl)phenyl)methanol 7 (0.250 g, 1.02 mmol) in THF (4 mL) at 0° C., was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.1% g, 1.02 mmol), DEAD (0.357 g, 2.03 mmol) and TPP (0.532 g, 2.03 mmol). The reaction mixture was stirred at room temperature for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (20 mL) and extracted with EA (3×30 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-50% EA in hexane as eluent to afford the title compound (0.120 g). LC-MS (Method B) (ESI+): m/z 383.04 (M+H)⁺; ¹H-NMR (400 MHz; DMSO-d₆) δ 9.32 (s, 1H), 8.51 (s, 1H), 7.45 (d, J=8.31 Hz, 2H), 7.34 (d, J=8.31 Hz, 2H), 6.76 (s, 1H), 5.70 (s, 2H), 4.36-4.42 (m, 1H), 3.68 (s, 3H), 1.33 (d, J=6.85 Hz, 6H).

Preparation of Common Intermediate I-57

Step 1: Synthesis of 4-bromo-1-isopropyl-1H-imidazole

To a stirred solution of 4-bromo-1H-imidazole 1 (10.0 g, 68.0 mmol) in acetone (200 mL), was added Cs₂CO₃ (22.1 g, 74.8 mmol) and isopropyl iodide (12.7 g, 74.8 mmol) at room temperature. The reaction mixture was then heated at 55° C. for 15 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and filtered through a pad of Celite. The filtrate was concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-30% EA in hexane as eluent to afford the title compound (9.00 g). LC-MS (Method C) (ESI+): m/z 191 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.69 (d, J=1.00 Hz, 1H), 7.43 (d, J=1.50 Hz, 1H), 4.39 (td, J=6.73, 13.46 Hz, 1H), 1.38 (d, J=6.98 Hz, 6H).

Step 2: Synthesis of 1-isopropyl-1H-imidazole-4-carbonitrile

To a stirred solution 4-bromo-1-isopropyl-1H-imidazole 2 (5.00 g, 26.4 mmol) in DMA (50 mL) at room temperature, was added Zn(CN)₂ (6.17 g, 52.9 mmol). The resulting mixture was then degassed with argon for 10 min. To the resulting reaction mixture was added Pd₂(dba)₃ (2.40 g, 2.64 mmol) and 1,1′-bis(diphenylphosphino)ferrocene (2.92 g, 5.29 mind) at room temperature. The reaction mixture was then heated in a sealed tube at 130° C. for 6 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was coded to room temperature, quenched with aqueous ammonia (30 mL) and extracted with EA (100 mL). The organic layer was washed with water (2×200 mL), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-40% EA in hexane as eluent to afford the title compound (2.10 g). LC-MS (Method B) (ESI+): m/z 135.9 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.27 (s, 1H), 7.98 (s, 1H), 4.49 (quin, J=6.60, 13.21 Hz, 1H), 1.41 (d, J=6.85 Hz, 6H).

Step 3: Synthesis of 2-bromo-1-isopropyl-1H-imidazole-4-carbonitrile

To a stirred solution of methyl 1-isopropyl-1H-imidazole-4-carbonitrile 3 (2.00 g, 14.79 mmol) in DMF (20 mL), was added NBS (5.26 g, 29.6 mmol) at room temperature. The resulting mixture was stirred for 4 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (50 mL) and extracted with EA (3×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-60% EA in hexane to afford the title compound (1.50 g). LC-MS (Method B) (ESI−); m/z 213.8 (M−H): ¹H-NMR (400 MHz, DMSO-d₆) δ 8.25 (s, 1H), 4.40-4.49 (m 1H), 1.45 (d, J=6.48 Hz, 6H).

Step 4: Synthesis of 2-(4-formylphenyl)-1-isopropyl-1N-imidazole-4-carbonitrile

To a stirred solution of 2-bromo-1-isopropyl-1H-imidazole-4-carbonitrile 4 (0.840 g, 5.60 mmol) in dioxane:H₂O (2:1) (75 mL), was added Cs₂CO₃ (3.64 g, 11.2 mmol) and (4-formylphenyl)boronic acid 5 (1.2 g, 5.60 mmol). The resulting mixture was degassed with argon for 10 min. To the reaction mixture was added triphenylphosphine (0.586 g, 2.24 mmol) and Pd(OAc)₂ (0.251 g, 1.12 mmol) at room temperature. The reaction mixture was heated in a sealed tube at 80° C. for 2 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with water (10 mL) and extracted with EA (60 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-40% EA in hexane as eluent to afford the title compound (0.800 g). LC-MS (Method B) (ESI+): m/z 240.10 (M+H)⁺; ¹H-NMR (400 MHz; DMSO-d₆) δ10.11 (s, 1H), 8.32 (s, 1H), 8.11 (d, J=7.83 Hz, 2H), 7.78 (d, J=7.83 Hz, 2H), 4.33 (td. J=6.42, 13.08 Hz, 1H), 1.42 (d, J=6.85 Hz, 6H).

Step 5: Synthesis of 2-(4-(hydroxymethyl)phenyl)-1-isopropyl-1H-imidazole-4-carbonitrile

To a stirred solution of 2-(4-formylphenyl)-1-isopropyl-1H-imidazole-4-carbonitrile 6 (0.750 g, 3.134 mmol) in methanol (15 mL) at 10° C., was added sodium borohydride (0.059 g, 1.567 mmol). The resulting mixture was stirred at the same temperature for 30 min. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (50 mL) and extracted with DCM (100 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-80% EA in hexane as eluent to afford the title compound (0.700 g). LC-MS (Method B) (ESI+): m/z 242 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.23 (s, 1H), 7.51-7.55 (m, 2H), 7.44-7.49 (m, 2H), 5.34 (t, J=5.87 Hz, 1H), 4.59 (d, J=5.87 Hz, 2H), 4.29 (td, J=6.60, 13.21 Hz, 1H), 1.40 (d, J=85 Hz, 6H).

Step 6: Synthesis of 2-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-isopropyl-1H-imidazole-4-carbonitrile (I-57)

To a stirred solution of 2-(4-(hydroxymethyl)phenyl)-1-isopropyl-1H-imidazole-4-carbonitrile 7 (0.319 g, 2.07 mmol) and TPP (0.812 g, 3.11 mmol) in THF (5 mL), was added DEAD (0.540 g, 3.11 mmol) and 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.500 g, 2.07 mmol) at room temperature. The resulting mixture was stirred for 1 h at room temperature, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure, and the remaining residue was dissolved in water (50 mL) and extracted with EA (50 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-50% EA in hexane to afford the title compound (0.250 g). LC-MS (Method B) (ESI+): m/z 377.9 (M+H)⁺.

The Following Intermediate was Prepared from the 4-Nitro-1H-Imidazole According to the Method of Preparation for I-57:

Intermediate	Structure	Analytics
I-58		LC-MS (Method B) (ESI+): m/z 397.90 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.33 (s, 1H), 8.54 (s, 1H), 8.19 (s, 1H), 7.48 (d, J = 7.98 Hz, 2H), 7.38 (d, J = 7.98 Hz, 2H), 5.76 (s, 2H), 3.97 (td, J = 6.54, 13.34 Hz, 1H), 1.35 (d, J = 6.48 Hz, 6H).

Preparation of Common Intermediate I-59

Step 1: Synthesis of Methyl 4-(4-(trifluoromethyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazol-2-yl)benzoate

To an ice cooled solution of methyl 4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzoate (14.5 g, 53.0 mmol) in THF (300 mL), was added NaH (60% dispersion in mineral oil) (3.23 g, 80.0 mmol) portion wise over a period of 5 min. The resulting mixture was stirred at same temperature for 30 min, then SEM-Cl (14.2 mL, 80.0 mmol) was added dropwise over a period of 30 min. The reaction mixture was stirred at room temperature for a further 3 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with ice water and extracted with EA. The organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-3.5% EA in hexane to afford 15.00 g the title compound and 1.20 g of the undesired regioisomer. LC-MS (Method B) (ESI+): m/z 400.98 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.23 (s, 1H), 8.06 (d, J=7.8 Hz, 2H), 7.96 (d, J=8.3 Hz, 2H), 5.44 (s, 2H), 3.87 (s, 3H), 3.57 (t, J=7.8 Hz, 2H), 0.83 (t, J=8.1 Hz, 2H), −0.06 (s, 9H).

Step 3: Synthesis of (4-(4-(Trifluoromethyl)-1-((2-(trimethylsilyl) ethoxy) methyl)-1H-imidazol-2-yl)phenyl)methanol

To a stirred solution of methyl 4-(4-(trifluoromethyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazol-2-yl)benzoate (10.0 g, 25.0 mmol) in THF (200 mL) at 0° C., was added DIBAL-H (1M in toluene, 125 mL, 125 mmol), and the reaction mixture was stirred at room temperature for 2 h. Progress of the reaction was monitored by TLC. After completion, water was added to the reaction mixture and extracted with EA. The organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 8.10 g of the title compound. LC-MS (Method B) (ESI+): m/z 372.97 (M+H); ¹H-NMR (400 MHz, DMSO-d₆) δ 8.13 (s, 1H), 7.73 (d, J=8.3 Hz, 2H), 7.43 (d, J=8.3 Hz, 2H), 5.36 (s, 2H), 5.29 (t, J=5.6 Hz, 1H), 4.54 (d, J=5.9 Hz, 2H), 3.56 (t, J=8.1 Hz, 2H), 0.79-0.86 (m, 2H), −0.04 (s, 9H).

Step 4: Synthesis of 2-(4-(chloromethyl)phenyl)-4-(trifluoromethyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole

To a stirred solution of (4-(4-(trifluoromethyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazol-2-yl)phenyl)methanol (2.50 g, 6.72 mmol) in DCM (50 mL) at 0° C., was added SOCl₂ (1.46 mL, 20.1 mmol) and the reaction mixture was stirred at room temperature for 30 min. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with saturated NaHCO₃ solution (˜50 mL) at 0° C., diluted with water (200 mL), and extracted with DCM (2×200 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 2.40 g of the title compound, which was used as such for the next reaction without further purification. LC-MS (Method B) (ESI+): m/z 390.85 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 7.81 (d, J=7.9 Hz, 2H), 7.51 (d, J=8.4 Hz, 2H), 7.47 (s, 1H), 5.30 (s, 2H), 4.64 (s, 2H), 3.62 (t, J=8.1 Hz, 2H), 0.91-1.01 (m, 2H), −0.06 (m, 9H).

Step 5: Synthesis of 6-Chloro-1-(4-(4-(trifluoromethyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyridine (I-59)

A solution of 2-(4-(chloromethyl)phenyl)-4-(trifluoromethyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole (2.52 g, 6.46 mmol), 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (1.00 g, 6.46 mmol) and K₂CO₃ (2.32 g, 16.10 mmol) in DMF (15 mL), was stirred at 35° C. for 16 h. Progress of the reaction was monitored by TLC and LCMS. After completion, the reaction mixture was diluted with cold water (100 mL) and extracted with EA (3×200 mL). The combined organic layer was washed with ice cold water (3×200 mL), followed by brine (200 mL). The organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 50-100% EA in hexane to afford 1.25 g of the title compound. LC-MS (Method B) (ESI+): m/z 509.01 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 9.06 (s, 1H), 8.19 (s, 1H), 7.78 (d, J=7.4 Hz, 2H), 7.41-7.49 (m, 3H), 5.70 (s, 2H), 5.26 (s, 2H), 3.59 (t, J=7.9 Hz, 2H), 0.94 (t, J=8.1 Hz, 2H), −0.01 (s, 9H).

Preparation of Common Intermediate I-60

Step 1: Synthesis of 4-(5-methyl-2-(trifluoromethyl)thiazol-4-yl)benzaldehyde

To a stirred solution of 4-bromo-5-methyl-2-(trifluoromethyl)thiazole 1 (1.00 g, 4.10 mmol) in dioxane:H₂O (4:1, 12.5 mL) was added K₃PO₄ (1.73 g, 8.20 mmol), (4-formylphenyl)boronic acid 2 (0.730 g, 4.92 mmol) and the mixture was degassed with argon for 15 min. To the resulting reaction mixture was added X-Phos (0.195 g, 0.410 mmol) and Pd-XPhos-G₂ (0.161 g, 0.205 mmol) at room temperature. The reaction mixture was further heated in a seal tube at 100° C. for 4 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with water (50 mL) and extracted with EA (3×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-50% EA in hexane as eluent to afford the title compound (1.00 g). LC-MS (Method B) (ESI+): m/z 271.99 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 10.08 (s, 1H), 8.05 (d, J=7.98 Hz, 2H), 7.94-7.98 (m, 2H), 2.73 (s, 3H).

Step 2: Synthesis of (4-(5-methyl-2-(trifluoromethyl)thiazol-4-yl)phenyl)methanol

To an ice cooled solution of 4-(5-methyl-2-(trifluoromethyl) thiazol-4-yl) benzaldehyde 3 (1.00 g, 3.690 mmol) in methanol (10 mL), was added sodium borohydride (0.140 g, 3.690 mmol). The reaction mixture was allowed to warm to room temperature, and then stirred for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (10 mL) and concentrated under reduced pressure to dryness. The crude residue obtained was dissolved in water (20 mL) and extracted with EA (2×30 mL). Combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-50% EA in hexane to afford the title compound (0.80) g). LC-MS (Method B) (ESI+); m/z 273.95 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.66 (d, J=7.82 Hz, 2H), 7.45 (d, J=7.83 Hz, 2H), 5.27 (t, J=5.62 Hz, 1H), 4.56 (d, J=5.87 Hz, 2H), 2.66 (s, 3H).

Step 3: Synthesis of 4-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-5-methyl-2-(trifluoromethyl)thiazole (I-60)

To a stirred solution of (4-(5-methyl-2-(trifluoromethyl)thiazol-4-yl)phenyl)methanol 4 (0.500 g, 1.831 mmol) in THF (10 mL) was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.282 g, 1.831 mmol), DTAD (0.842 g, 3.662 mmol) and TPP (0.959 g, 3.662 mmol) at room temperature, and the mixture was stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (20 mL) and extracted with EA (2×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-50% EA in hexane to afford the title compound (0.450 g). LC-MS (Method B): (ESI+): m/z 410.02 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.32 (s, 1H), 8.52 (s, 1H), 7.67 (d, J=7.98 Hz, 2H), 7.39 (d, J=7.98 Hz, 2H), 5.71 (s, 2H), 2.63 (s, 3H).

Preparation of Common Intermediate I-61

Step 1: Synthesis of 4-(2-bromoacetyl) phenyl acetate

To an ice cooled solution of 4-acetylphenyl acetate 1 (5.00 g, 28.08 mmol) in acetic acid (50 mL) was added bromine (1.15 mL, 22.47 mind), and the reaction mixture was stirred for 4 h at room temperature. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was poured onto ice cold water (10 mL) and the resulting solid was collected on a Buchner funnel. The solid was washed with water (20 mL) and dried under reduced pressure to afford the crude title compound (5.10 g). LC-MS (Method B) (ESI+): m/z 258.95 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 8.16 (d, J=7.98 Hz, 2H), 8.05 (d, J=8.48 Hz, 2H), 4.47 (s, 2H), 3.96 (s, 3H).

Step 2: Synthesis of methyl 4-(2-(trifluoromethyl)thiazol-4-yl)benzoate

To a stirred solution 4-(2-bromoacetyl)phenyl acetate 2 (0.700 g, 2.73 mmol) in toluene (15 mL), was added 2,2,2-trifluoroethanethioamide (1.05 g, 8.20 mind) at room temperature, and the reaction mixture was heated in a sealed tube at 100° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and concentrated wider reduced pressure. The crude compound was purified by silica gel chromatography using 5-20% EA in hexane to afford the title compound (0.700 g). ¹H-NMR (400 MHz, CDCl₃) δ 8.13 (d, J=7.98 Hz, 2H), 8.01 (d, J=8.48 Hz, 2H), 7.82 (s, 1H), 3.95 (s, 3H).

Step 3: Synthesis of (4-(2-(trifluoromethyl)thiazol-4-yl)phenyl)methanol

To an ice cooled solution of methyl 4-(2-(trifluoromethyl) thiazol-4-yl) benzoate 3 (0.500 g, 1.74 mmol) in THF (5 mL), was added DIBAL-H (5.22 mL, 5.22 mmol, 1.0 M solution in THF) dropwise. After addition, the mixture was stirred for 1 h at room temperature. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with saturated solution of NH₄Cl (5 mL) and extracted with EA (3×10 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 1-20°/o EA in hexane as eluent to afford (0.400 g). LC-MS (Method B) (ESI+): m/z 260.00 (M+H); ¹H-NMR (400 MHz; DMSO-d₆) δ 8.54 (s, 1H), 7.96 (d, J=7.83 Hz, 2H), 7.44 (d, J=8.31 Hz, 2H), 5.27 (t, J=5.87 Hz, 1H), 4.55 (d, J=5.38 Hz, 2H).

Step 4: Synthesis of 4-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-2-(trifluoromethyl)thiazole (I-61)

To a stirred solution of (4-(2-(trifluoromethyl) thiazol-4-yl) phenyl)methanol 4 (0.400 g, 1.544 mmol) and TPP (0.606 g, 2.316 mmol) in THF (5 mL) was added DEAD (0.363 g, 2.316 mmol) and 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.214 g, 1.389 mmol) at room temperature and stirred for 30 min at room temperature. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-30% EA in hexane as eluent to afford the title compound (0.350 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 9.31 (s, 1H), 8.55 (s, 1H), 8.51 (s, 1H), 7.96 (d, J=8.31 Hz, 2H), 7.38 (d, J=7.83 Hz, 2H), 5.69 (s, 2H).

Preparation of Common Intermediate I-62

Step 1: Synthesis of 1 (4-bromophenyl)prop-2-yn-1-ol

To an ice cooled solution of 4-bromobenzaldehyde 1 (5.00 g, 27.0 mmol) in dry THF (75 mL), was added ethynylmagnesium bromide (0.5M solution in THF, 119 mL, 67.6 mmol) dropwise under nitrogen atmosphere. The reaction mixture was allowed to warm to room temperature, and then stirred for 3 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with dilute HCl (150 mL) and extracted with EA (3×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-20% EA in hexane as eluent to afford the title compound (3.00 g). LC-MS (Method B) (ESI+): m/z 212.00 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.56 (d, J=7.98 Hz, 2H), 7.41 (d, J=7.98 Hz, 2H), 6.15 (d, J=5.98 Hz, 1H), 5.33-5.37 (m, 1H), 3.54 (d, J=2.49 Hz, 1H).

Step 2: Synthesis of N-(1-(4-bromophenyl)prop-2-yn-1-yl)acetamide

To a stirred solution of 1-(4-bromophenyl)prop-2-yn-1-ol 2 (1.00 g, 4.76 mmol) in acetonitrile (20 mL) at −10° C., was added sodium sulphate (0.676 g, 4.76 mmol) and stirred for 5 man. To the reaction mixture, was added conc. H₂SO₄ (2.33 g, 23.8 mmol) dropwise. The resulting reaction was stirred for 16 h at room temperature. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was poured over ice cold water (50 mL), basified using sodium carbonate and extracted with EA (3×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 30-40% EA in hexane as eluent to afford the title compound (0.710 g). LC-MS (Method C) (ESI+): m/z 252.00 (M)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.87 (d, J=8.31 Hz, 1H), 7.58 (d, J=8.31 Hz, 2H), 7.37 (d, J=8.31 Hz, 2H), 5.79 (d, J=8.31 Hz, 1H), 3.50 (d, J=2.45 Hz, 1H), 1.86 (s, 3H).

Step 3: Synthesis of 1-(4-bromophenyl)prop-2-yn-1-amine

To a stirred solution of N-(1-(4-bromophenyl)prop-2-yn-1-yl)acetamide 3 (0.700 g, 2.79 mmol) in methanol (15 mL), was added 6N HCl (10 mL) at room temperature. The reaction mixture was heated at 100° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude residue obtained was dissolved in a mixture of water (20 mL) and EA (30 mL), and then neutralized using solid Na₂CO₃. The aqueous layer was extracted with EA (2×10 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 25-30% EA in hexane to afford the title compound (0.400 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 7.51-7.56 (m, 2H), 7.45 (d, J=7.98 Hz, 2H), 4.67 (s, 1H), 3.33 (br s, 1H, merged in H₂O peak of DMSO solvent), 2.28 (br s, 2H).

Step 4: Synthesis of N-(1-(4-bromophenyl)prop-2-yn-1-yl)-2,2,2-trifluoroacetamide

To a stirred solution of 1-(4-bromophenyl)prop-2-yn-1-amine 4 (0.350 g, 1.67 mmol) in DMF (5 mL), was added potassium carbonate (0.277 g, 2.01 mmol), followed by trifluoroacetic anhydride (0.28 mL, 0.42 g, 2.01 mmol) at room temperature. The reaction mixture was stirred at room temperature for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was poured over ice water (30 mL) and extracted with EA (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 4-5% EA in hexane as eluent to afford the title compound (0.260 g). ¹H-NMR (400 MHz, CDCl₃) δ 7.54 (d, J=8.48 Hz, 2H), 7.40 (d, J=8.48 Hz, 2H), 6.70 (br s, 1H), 5.95 (dd, J=1.75, 8.23 Hz, 1H), 2.63 (d, J=2.49 Hz, 1H).

Step 5: Synthesis of 4-(4-bromophenyl)-5-methyl-2-(trifluoromethyl)oxazole

To a stirred solution of N-(1-(4-bromophenyl) prop-2-yn-1-yl)-2,2,2-trifluoroacetamide 5 (0.250 g, 0.819 mind) in dry THF (5 mL) at 0° C., was added a %/o dispersion of sodium hydride in oil (0.033 g, 0.82 mmol). The reaction mixture was allowed to warm to room temperature and was then stirred for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was poured over ice cold water (30 mL), stirred well and extracted with EA (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 3-5% EA in hexane as eluent to afford the title compound (0.200 g). LC-MS (Method B) (ESI+): in/z 308.08 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 7.52-7.61 (m, 4H), 2.61 (s, 3H).

Step 6: Synthesis of ethyl 4-(5-methyl-2-(trifluoromethyl)oxazol-4-yl)benzoate

To a stirred solution of 4-(4-bromophenyl)-5-methyl-2-(trifluoromethyl)oxazole 6 (0.200 g, 0.655 mmol) and ethanol (10 mL) in a pressure vial, was added triethylamine (0.180 mL, 1.31 mmol). The resulting mixture was degassed with argon for 10 min, and then treated with Pd(dppf)Cl₂ (0.048 g, 0.065 mmol) at room temperature. The reaction mixture was then heated at 80° C. under an atmosphere of carbon monoxide (30 psi pressure) for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 5-10% EA in hexane as eluent to afford the title compound (0.170 g). LC-MS (Method B) (ESI+): m/z 299.80 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 8.13 (d, J=8.31 Hz, 2H), 7.76 (d, J=8.31 Hz, 2H), 4.40 (q, J=7.17 Hz, 2H), 2.66 (s, 3H), 1.42 (t, J=7.09 Hz, 3H).

Step 7: Synthesis of (4-(5-methyl-2-(trifluoromethyl)oxazol-4-yl)phenyl)methanol

To a stirred solution of ethyl 4-(5-methyl-2-(trifluoromethyl)oxazol-4-yl)benzoate 7 (0.170 g, 0.568 mmol) in dry THF (5 mL) at 0° C., was added DIBAL-H (1M solution in toluene, 0.850 mL, 0.850 mmol). The reaction mixture was allowed to warm to room temperature and was then stirred for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with dilute HCl (5 mL) and extracted with EA (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to afford the crude title compound (0.130 g). ¹H-NMR (400 MHz, CDCl₃) δ 7.67 (d, J=7.83 Hz, 2H), 7.46 (d, J=7.83 Hz, 2H), 4.75 (s, 2H), 2.62 (s, 3H).

Step 8: Synthesis of 4-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-5-methyl-2-(trifluoromethyl)oxazole (I-62)

To a stirred solution of (4-(5-methyl-2-(trifluoromethyl)oxazol-4-yl)phenyl)methanol 8 (0.120 g, 0.466 mmol) in THF (5 mL), was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.072 g, 0.47 mmol), DTAD (0.161 g, 0.699 mmol) and TPP (0.183 g, 0.699 mmol) at room temperature. The resulting mixture was stirred for 3 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (10 mL) and extracted with EA (3×10 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated wider reduced pressure. The crude was purified by silica gel chromatography using 15-20% EA in hexane as eluent to afford the title compound (0.100 g). LC-MS (Method B) (ESI+): m/z 393.95 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ9.31 (s, 1H), 8.51 (s, 1H), 7.67 (d, J=8.31 Hz, 21H), 7.38 (d, J=8.31 Hz, 2H), 5.69 (s, 2H), 2.61 (s, 3H).

Preparation of Common Intermediate I-63

Step 1: Synthesis of 3-fluoro-N-methyl-2-nitroaniline

To a stirred solution of 1,3-difluoro-2-nitrobenzene 1 (14.0 g, 88.1 mmol) in DCM (150 mL) at 0° C., was added methylamine (7.00 g, 228 mmol) and the mixture was stirred for 3 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with ice water (50 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to afford the crude title compound (9.00 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 8.29 (s, 1H), 7.41 (dd, J=4.24, 8.73 Hz, 1H), 7.01 (dd, J=8.73, 10.22 Hz, 1H), 4.09 (s, 3H).

Step 2: Synthesis of 3-fluoro-M-methylbenzene-1,2-diamine

To a stirred solution of 3-fluoro-N-methyl-2-nitroaniline 2 (9.0 g, 53 mmol) in IPA:H₂O (4:1, 100 mL), was added ammonium chloride (28.2 g, 529 mmol) and iron powder (29.5 g, 529 mmol) at room temperature. The reaction mixture was then heated in a sealed tube at 100° C. for 3 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and filtered through Celite. The filtrate was concentrated under reduced pressure and the residue was diluted with water (25 mL) and extracted with DCM (3×100 mL). The combined organic layer was washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound thus obtained was purified by silica gel chromatography using 0-15% EA in hexane as eluent to afford the title compound (4.67 g). LC-MS (Method B) (ESI+): m/z 141.0 (M+H)⁺.

Step 3: Synthesis of 4-fluoro-1-methyl-1,3-dihydro-2H-benzo[d]imidazol-2-one

To a stirred solution of 3-fluoro-N′-methylbenzene-1,2-diamine 3 (1.5 g, 10.70 mmol) in DCM, was added triethylamine (1.4 g, 14 mmol) and triphosgene (0.950 g, 3.21 mmol) at room temperature. The mixture was stirred for 12 h, and the progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with DCM (10 mL) and washed with saturated solution of NaHCO₃ (10 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-40% EA in hexane to afford the title compound (0.770 g). LC-MS (Method B) (ESI+): m/z 166 (M+H)⁺.

Step 4: Synthesis oft-bromo-4-fluoro-1-methyl-1H-benzo[d]imidazole

To a stirred solution of 4-fluoro-1-methyl-1,3-dihydro-2H-benzo[d]imidazol-2-one 4 (0.770 g, 4.63 mmol) in dichloroethane (15 mL) at 0° C., was added POBr₃ (0.650 g, 2.27 mmol). The reaction mixture was further heated at 90° C. for 12 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and concentrated under reduced pressure. The crude residue obtained was diluted with ice cold water (20 mL), and the pH was adjusted to 8 using NaHCO₃ 0.500 g). The mixture was then extracted with DCM (3×10 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-5% EA in hexane as eluent to afford the title compound (0.806 g). LC-MS (Method B) (ESI+): m/z 230.95 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) θ 7.46 (d, J=7.98 Hz, 1H), 7.27 (dt, J=4.74, 8.10 Hz, 1H), 7.05 (dd, J=7.98, 10.97 Hz, 1H), 3.81 (s, 3H).

Step 5: Synthesis of 4-(4-fluoro-1-methyl-1H-benzo[d]imidazol-2-yl)benzaldehyde

To a stirred solution of 2-bromo-4-fluoro-1-methyl-1H-benzo[d]imidazole 5 (0.600 g, 2.62 mmol) in dioxane:H₂O (7:3 mL) was added K₃PO₄ (1.2 g, 7.9 mmol) and (4-formylphenyl) boronic acid 6 (0.471 g, 3.14 mmol) at room temperature. The mixture was then degassed with argon for 15 min, followed by addition of X-phos (0.099 g, 0.21 mmol) and X-phos-Pd-G₂ (0.082 g, 0.10 mmol) at room temperature. The reaction mixture was further degassed with argon for 5 min, and then heated in a sealed tube at 100° C. for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The residue obtained was dissolved in DCM (10 mL) and washed with H₂O (10 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-20% EA in hexane as eluent to afford the title compound (0.433 g). LC-MS (Method C) (ESI+): m/z 255.0 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 10.14 (s, 1H), 8.09-8.15 (in 4H), 7.53 (d, J=8.48 Hz, 1H), 7.32 (dt, J=4.74, 8.10 Hz, 1H), 7.10 (dd, J=7.98, 10.97 Hz, 1H), 3.95 (s, 3H).

Step 6: Synthesis of (4-(4-fluoro-1-methyl-1H-benzo[d]imidazol-2-yl)phenyl)methanol

To a stirred solution of 4 (4-fluoro-1-methyl-1H-benzo[d]imidazol-2-yl)benzaldehyde 5 (0.432 g, 1.70 mmol) in methanol (15 mL) at 0° C., was added sodium borohydride (0.128 g, 3.40 mmol). The reaction mixture was allowed to warm to room temperature and then stirred for 3 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with saturated NH₄Cl solution (5 mL) and concentrated under reduced pressure. The crude residue obtained was dissolved DCM (20 mL) and washed with brine (5 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-50% EA in hexane as eluent to afford the title compound (0.300 g). LC-MS (Method B) (ESI+): m/z 256.90 (M+H)⁺.

Step 7: Synthesis of 6-chloro-1-(4-(4-fluoro-1-methyl-1H-benzo[d]imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-63)

To an ice cooled solution of (4-(4-fluoro-1-methyl-1H-benzo[d]imidazol-2-yl)phenyl)methanol 8 (0.300 g, 1.17 mmol) in THF (10 mL), was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.162 g, 1.05 mmol), DTAD (0.403 g, 1.76 mmol) and TPP (0.460 g, 1.76 mmol). The reaction mixture was allowed to warm to room temperature and was then stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (10 mL) and extracted with DCM (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-60% EA in hexane as eluent to afford the title compound (0.160 g). LC-MS (Method C) (ESI+): in/z 393.00 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.33 (s, 1H), 8.54 (s, 1H), 7.85 (d, J=7.98 Hz, 2H), 7.43-7.49 (m, 3H), 7.27 (dt, J=4.49, 7.98 Hz, 1H), 7.05 (dd, J=8.23, 10.72 Hz, 1H), 5.77 (s, 2H), 3.87 (s, 3H).

Preparation of Common Intermediate I-64

Step 1: Synthesis of 4-(4-(trifluoromethyl)pyrimidin-2-yl)benzaldehyde

A solution of 2-bromo-4-(trifluoromethyl)pyrimidine 1 (2.00 g, 8.81 mmol), (4-formylphenyl) boronic acid 2 (1.50 g, 10.6 mmol) and Cs₂CO₃ (7.15 g, 22.0 mmol) in dioxane-H₂O (5:1, 25 mL), was purged with argon for 30 min. To the resulting reaction mixture was added Pd(PPh₃)₄ (1.01 g, 0.881 mmol) at room temperature. The reaction mixture was heated in a sealed tube at 100° C. for 12 h. Progress of the reaction was monitored by TLC and LCMS. After completion, the reaction mixture was cooled to room temperature, diluted with water (250 mL) and extracted with EA (2×250 mL). The combined organic layer was dried over anhydrous sodium sulfate and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 20-50% EA in hexane as eluent to afford the title compound (1.50 g). LC-MS (Method B) (ESI+): m/z 253.2 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 10.14 (s, 1H), 9.11 (d, J=4.99 Hz, 1H), 8.70 (d, J=8.48 Hz, 2H), 8.04 (d, J=7.98 Hz, 2H), 7.60 (d, J=4.99 Hz, 1H).

Step 2: Synthesis (4-(4-(trifluoromethyl)pyrimidin-2-yl)phenyl)methanol

To a stirred solution of 4-(4-(trifluoromethyl) pyrimidin-2-yl) benzaldehyde 3 (1.50 g, 5.95 mmol) in methanol (30 mL) at 0° C., was added NaBH₄ (0.449 g, 11.9 mmol) portion-wise. The reaction mixture was further stirred at room temperature for 2 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure, quenched with ice cold water (50 mL) and extracted with EA (100 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 20-40% EA in hexane as eluent to afford the title compound (0.400 g).

Step 3: Synthesis of 6-chloro-1-(4-(4-(trifluoromethyl)pyrimidin-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (I-64)

To a stirred solution of (4-(4-(trifluoromethyl)pyrimidin-2-yl)phenyl)methanol 4 (0.700 g, 2.75 mmol) in THF (7 mL), was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.388 g, 2.48 mmol) and triphenylphosphine (1.083 g, 4.130 mmol) at room temperature. The resulting mixture was stirred for 5 min. The mixture was then cooled to 0° C., and was treated with DEAD (0.719 g, 4.13 mmol). The reaction mixture was allowed to warm to room temperature and was then stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (100 mL) and extracted with EA (2×250 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-30% EA in hexane as eluent to afford the title compound (0.550 g). LC-MS (Method B) (ESI+): m/z 390.90 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.32 (s, 1H), 9.26 (d, J=4.49 Hz, 1H), 8.53 (s, 1H), 8.37 (d, J=7.98 Hz, 2H), 7.95 (d, J=4.49 Hz, 1H), 7.44 (d, J=7.98 Hz, 2H), 5.73-5.77 (m, 2H).

Preparation of Common Building Block (BB-1)

Step 1: Synthesis of 2-Isopropylpyridin-3-yl trifluoromethanesulfonate

To a solution of 2-isopropylpyridin-3-ol (0.40 g, 2.92 mmol) in pyridine (4 mL) was added Tf₂O (0.82 g, 2.92 mmol) dropwise at 0° C. over 2 min. After addition, the mixture was warmed to room temperature, and stirred for 2 hours. After the reaction was complete as indicated by TLC analysis, the mixture was quenched with cold water (10 mL) and neutralized with saturated aqueous NaHCO₃ solution. The resulting mixture was extracted with DCM (50 mL×3), dried with anhydrous Na₂SO₄ (30 g), filtered and concentrated in vacuo. The residue was purified by column chromatography (EA:Hex=0:1 to 1:100) to give 420 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 8.60 (d, J=4.2 Hz, 1H), 7.57 (m, 1H), 7.24 (m, 1H), 3.42 (m, 1H), 1.32-1.37 (d, J=7.2 Hz, 6H).

Step 2: Synthesis oft-Isopropyl-3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyridine (BB-1)

Under N₂ atmosphere, a mixture of 2-isopropylpyridin-3-yl trifluoromethanesulfonate (0.28 g, 1.04 mmol), (Bpin)₂ (0.53 g, 2.08 mmol), KOAc (0.20 g, 2.08 mmol) and Pd(dppf)Cl₂ (85 mg, 10 mol %) in dioxane (5 mL), was stirred at 95° C. for 5 hours. The mixture was then quenched with water (15 mL) and extracted with EA (50 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (30 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (EA:n-Hex=1:20 to 1:5) to give 300 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ8.60 (dd, J=4.8, 2.1 Hz, 1H), 8.00 (m, 1H), 7.08 (m, 1H), 3.75 (m, 1H), 1.32-1.37 (d, J=7.2 Hz, 6H), 1.24-1.29 (s, 12H).

Preparation of Common Building Block (BB-2)

Step 1: Synthesis of 3-Fluoro-2-(prop-1-en-2-yl)phenol

To a mixture of 2-bromo-3-fluorophenol (2 g, 10.5 mmol), 4,4,5,5-tetramethyl-2-(prop-1-en-2-yl)-1,3,2-dioxaborolane (2.37 g, 14.1 mmol), and K₂CO₃ (2.9 g, 21 mmol) in dioxane and water (30 mL:6 mL), was added Pd(dppf)Cl₂ (800 mg, 1 mmol) under nitrogen atmosphere. The resulting mixture was stirred at 90° C. overnight, and then quenched with water (50 mL) and extracted with EA (100 mL×2). The combined organic layer was dried over Na₂SO₄ (30 g) and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EA=20:1 to 5:1) to afford 1.5 g of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 7.12 (m, 1H), 6.74 (d, J=8.1 Hz, 1H), 6.63 (t, J=8.4 Hz, 1H), 5.72 (s, 1H), 5.54 (s, 1H), 5.16 (s, 1H), 2.08 (s, 3H).

Step 2: Synthesis of 3-Fluoro-2-isopropylphenol

To a solution of 3-fluoro-2-(prop-1-en-2-yl)phenol (1.5 g, 0.98 mmol) in MeOH (20 mL) was added Pd/C (100 mg, 10% wt) and stirred under hydrogen atmosphere. After the reaction was complete as indicated by TLC analysis, the suspension was filtered through a pad of Celite. The filter cake was washed with MeOH (10 mL). The filtrate was concentrated to dryness to afford 1.3 g of the crude title compound, which was used for the next step directly. ¹H-NMR (300 MHz, CDCl₃) δ 6.96 (m, 1H), 6.59 (m, 1H), 6.51 (d, J=8.1 Hz, 1H), 4.96 (br s, 1H), 3.40 (m, 1H), 1.32-1.35 (d, J=6.6 Hz, 6H).

Step 3: Synthesis of 3-Fluoro-2-isopropylphenyl trifluoromethanesulfonate

To a solution of 3-fluoro-2-isopropylphenol (1.2 g, 7.8 mmol) and pyridine (3 mL) in DCM (20 mL) at 0° C., was added an excess amount of Tf₂O (2 mL). The reaction was stirred at 0-5° C. for 2 hours, then quenched by pouring into cold water (20 mL). The resulting mixture was treated with a saturated NH₄Cl solution (20 mL), and then extracted with DCM (100 mL×2). The combined organic layer was dried with Na₂SO₄ (30 g) and concentrated to dryness to afford the crude product. The crude product was purified by silica gel chromatography (PE:EA=100:1) to afford 1.8 g of the title compound. ¹H-NMR (300 MHz CDCl₃) δ 7.19 (m, 1H), 7.04-7.10 (m, 2H), 3.32 (m, 1H), 1.33-1.37 (d, J=6.6 Hz, 6H)

Step 4: Synthesis of 2-(3-Fluoro-2-isopropylphenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (BB-2)

To a solution of 3-fluoro-2-isopropylphenyl trifluoromethanesulfonate (100 mg, 0.35 mmol), (Bpin)₂ (178 mg, 0.7 mmol) and KOAc (69 mg, 0.7 mmol) in dioxane (3 mL), was added Pd(dppf)Cl₂ (29 mg, 0.035 mmol). After addition, the resulting mixture was warmed to 90° C. and stirred for 16 hours. The reaction mixture was filtered, and the filter cake was washed with EA (5 mL). The filtrate was concentrated to dryness and the residue was purified by silica gel chromatography (eluent: PE/EA=100:1 to 30:1) to afford 47 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 7.43 (d, J=6.3 Hz, 1H), 7.14 (m, 1H), 7.02 (m, 1H), 3. 62 (m, 1H), 1.35 (s, 12H), 1.24-1.26 (d, J=6.0 Hz, 6H)

Preparation of Common Building Block (BB-3)

Step 1: Synthesis of (2-Bromo-6-methoxyphenoxy)(tert-butyl)dimethylsilane

To a solution of 2-bromo-6-methoxyphenol (500 mg, 2.46 mmol) in DCM (10 mL), was added TBSCl (446 mg, 2.96 mmol), DMAP (30 mg, 0.246 mmol) and TEA (373 mg, 3.69 mmol). After the reaction was complete as indicated by TLC analysis, the reaction was quenched with water (10 mL) and extracted with EA (20 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (20 g), filtered and concentrated to dryness in vacuo to give 800 mg of the crude title compound. ¹H-NMR (300 MHz, CDCl₃) δ 7.10 (m, 1H), 6.74-6.78 (m, 2H), 3.78 (s, 3H), 1.05 (s, 9H), 0.25 (s, 6H).

Step 2: Synthesis of tert-Butyl(2-cyclopropyl-6-methoxyphenoxy)dimethylsilane

A mixture of (2-bromo-6-methoxyphenoxy)(tert-butyl)dimethylsilane (700 mg, 2.21 mmol), cycloprop-ylboronic acid (379 mg, 4.42 mmol), K₃PO₄ (2.81 mg, 13.3 mmol), and Pd(PPh₃)₄ (255 mg, 0.220 mmol) in toluene (35 mL) and H₂O (1.75 mL), was stirred at 95° C. overnight. The resulting mixture was extracted with EA (50 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (30 g), filtered and concentrated to dryness in vacuo. The concentrated residue was purified by silica gel chromatography (EA:n-hex=0:1 to 1:200) to give 500 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 6.78 (t, J=7.8 Hz, 1H), 6.67 (d, J=8.1 Hz, 1H), 6.38 (d, J=8.1 Hz, 1H), 3.77 (s, 3H), 2.21 (m, 1H), 1.05 (s, 9H), 0.89-0.95 (m, 2H), 0.63-0.68 (m, 2H), 0.19 (s, 6H).

Step 3: Synthesis of 2-Cyclopropyl-6-methoxyphenol

To a solution of tert-butyl-(2-cyclopropyl-6-methoxyphenoxy)dimethylsilane (500 mg, 1.8 mmol) in THF (5 mL) at room temperature, was added TBAF solution (3.6 mL, 1M) in one portion. After the addition, the reaction was stirred at room temperature for 1 hour, then quenched by water (15 mL) and extracted with EA (10 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (30 g), filtered and concentrated to dryness in vacuo. The concentrated residue was purified by silica gel chromatography (EA:n-hex=0:1 to 1:100) to give 210 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 6.69-6.79 (m, 2H), 6.47 (d, J=7.8 Hz, 1H), 5.77 (s, 1H), 3.88 (s, 3H), 2.13 (m, 1H), 0.91-0.98 (m, 2H), 0.65-0.71 (m, 2H).

Step 4: Synthesis of 2-Cyclopropyl-6-methoxyphenyl trifluoromethane sulfonate

A solution of 2-cyclopropyl-6-methoxyphenol (90 mg, 0.55 mmol), pyridine (0.5 mL) and Tf₂O (0.5 mL) in DCM (5 mL), was stirred under reflux for 30 min. The reaction mixture was then cooled to room temperature and quenched with saturated NH₄Cl solution (15 mL). The mixture was then extracted with DCM (10 mL×3), and the combined organic layer was dried over anhydrous Na₂SO₄ (20 g), filtered and concentrated to dryness in vacuo. The residue was purified by silica gel chromatography (EA:n-Hex=1:200 to 1:100) to give 160 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 7.19 (t, J=8.1 Hz, 1H), 6.82 (dd, J=8.1, 0.9 Hz, 1H), 6.54 (dd, J=8.1, 0.9 Hz, 1H), 3.88 (s, 3H), 2.08 (m, 1H), 1.01-1.09 (m, 2H), 0.71-0.79 (m, 2H).

Step 5: Synthesis of 2-(2-Cyclopropyl-6-methoxyphenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (BB-3)

Under N₂ atmosphere, a mixture of 2-cyclopropyl-6-methoxyphenyl trifluoromethanesulfonate (96 mg, 0.33 mmol), (BPin)₂ (166 mg, 0.650 mmol), KOAc (96 mg, 0.98 mmol) and Pd(PPh₃)₄ (35 mg, 0.03 mmol) in dioxane (2 mL) was stirred at 80° C. overnight. The reaction mixture was then diluted with water (10 mL) and extracted with EA (10 mL×3). The combined organic phases were dried over anhydrous Na₂SO₄ (20 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (EA:n-Hex=1:200 to 1:100) to give 30 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) (δ 7.16-7.21 (t, J=8.1 Hz, 1H), 6.62 (d, J=8.1 Hz, 1H), 6.50 (d, J=8.1 Hz, 1H), 3.76 (s, 3H), 1.96 (m, 1H), 1.37 (s, 12H), 0.85-0.91 (m, 2H), 0.71-0.73 (m, 2H).

Preparation of Common Building Block (BB-4)

Step 1: Synthesis of (4-Cyclopropyl-6-methoxypyrimidin-5-yl)boronic acid

To a solution of 5-bromo-4-cyclopropyl-6-methoxypyrimidine (500 mg, 2.2 mmol) and triisopropyl-borate (533.7 mg, 2.8 mmol) in toluene (5 mL) and THF (1.5 mL) at −78° C., was added n-BuLi (1.1 mL, 2.8 mmol) dropwise over 30 min. After the reaction mixture was stirred at −78° C. for 30 min, the reaction was warmed to −20° C. for 1 hour. The reaction was then quenched with aqueous 1N HCl solution (3.4 mL). After the mixture was stirred at room temperature for 30 min, the mixture was treated with saturated aqueous Na₂CO₃ solution to adjust the pH to 8. The mixture was extracted with EA (100 mL×2). The combined organic layer was dried over anhydrous Na₂SO₄ (30 g) and concentrated in vacuo to give the crude title compound (0.450 g). ¹H-NMR (300 MHz, CDCl₃) δ 8.61 (s, 1H), 6.56 (br s, 2H), 4.01 (s, 3H), 3.02 (m, 1H), 1.38-1.35 (m, 1H), 1.18-1.23 (m, 2H), 1.00-1.06 (m, 2H).

The Following Compound was Prepared from the Commercial Bromide According to the Procedure of BB-4:

Example	Structure	Analytical data
BB-5		LC-MS (Method A) (ESI+): m/z 169 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 8.68 (s, 1H), 6.17 (br s, 2H), 4.06 (s, 3H), 2.73 (s, 3H).

Preparation of Common Building Block (BB-6)

Step 1: Synthesis of (2-Iodo-3-methylphenyl)(methyl)sulfane

A solution of 2-methyl-6-(methylthio)aniline (1.0 g, 6.53 mmol) in acetone (20 mL) and conc. HCl (1.36 mL) was stirred at 0° C. for 10 min. A solution of NaNO₂ (540 mg, 7.84 mmol) in H₂O (8 mL) and a solution of NaI (2.06 g, 13.7 mmol) in H₂O (8 mL) were added to the resulting mixture subsequently over 10 min. After addition, the reaction was stirred at room temperature for 1 hour. The reaction mixture was then quenched with a saturated NH₄Cl solution (20 mL) and extracted with EA (10 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (20 g), filtered and concentrated in vacuo. The residue was purified by column chromatography (EA:n-Hex=0:100 to 1:100) to give 970 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 7.22 (m, 1H), 7.02 (dd, J=8.4, 0.6 Hz, 1H), 6.88 (d, J=8.4, 0.6 Hz, 1H), 2.47 (s, 3H), 2.45 (s, 3H).

Step 2: Synthesis of (2-Methyl-6-(methylthio)phenyl)boronic acid (BB-6)

To a solution of (2-iodo-3-methylphenyl)(methyl)sulfane (200 mg, 0.76 mmol) in anhydrous THF (4 mL), was added n-BuLi (0.37 mL, 2.5 M) at −78° C. over 10 min. After the reaction was stirred at −78° C. for 45 min, B(OCH₃)₃ (237 mg, 2.28 mmol) was added dropwise over 10 min. After addition, the resulting mixture was stirred at −78° C. for additional 30 min and allowed to warm to rt over 40 min. After the reaction was quenched by aqueous 1N HCl solution (2 mL), the reaction mixture was stirred at room temperature for about 30 mm. The resulting mixture was extracted with EA (5 mL×3). The combined organics were dried over anhydrous Na₂SO₄ (10 g), filtered and concentrated in vacuo. The residue was slurried in n-hex (5 mL), then filtered to collect the solids that were subsequently dried in vacuo to give 75 mg of the title compound. ¹H-NMR (300 MHz, DMSO-d₆) δ 7.11-7.21 (m, 2H), 6.95 (d, J=7.2 Hz, 1H), 2.40 (s, 3H), 2.23 (s, 3H).

General Procedure for the Preparation of Alkylated Pyrimidine Boronic Acid Building Blocks by S_NAr: Synthesis of (4-Cyclopropyl-6-((tetrahydrofuran-3-yl)oxy)pyrimidin-5-yl)boronic acid (BB-7):

Step 1: Synthesis of 5-Bromo-4-cyclopropyl-6-((tetrahydrofuran-3-yl)oxy)pyrimidine

To a solution of tetrahydrofuran-3-ol (107 mg, 1.95 mmol) in dry THF (5 mL) at 0° C. was added 60% sodium hydride dispersion (76 mg, 1.95 mmol) portion-wise over 5 mat. After the mixture was stirred at 0° C. for 1 h, a solution of 5-bromo-4-chloro-6-cyclopropylpyrimidine (300 mg, 1.30 mmol) in dry THF (5 mL) was added to the reaction mixture dropwise over 5 min. After the reaction was stirred at rt for 1 h, the reaction was quenched with water (10 mL) and extracted with EA (5 mL×3). The combined organic layer was dried over sodium sulfate (20 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EA=20:1) to afford 358 mg of the title compound. LC-MS (Method A) (ESI+): m/z 285 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 8.33 (s, 1H), 5.53 (m, 1H), 3.98-4.06 (m, 2H), 3.84-3.97 (m, 2H), 2.45 (m, 1H), 2.12-2.23 (m, 2H), 1.06-1.13 (m, 2H), 1.00-1.06 (m, 2H).

Step 2: Synthesis of (4-Cyclopropyl-6-((tetrahydrofuran-3-yl)oxy)pyrimidin-5-yl)boronic acid (BB-7)

To a mixture of 5-bromo-4-cyclopropyl-6-((tetrahydrofuran-3-yl)oxy) pyrimidine (200 mg, 0.7 mmol) and triisopropylborate (171 mg, 0.9 mmol) in toluene (4 mL) and THF (1 mL) at −78° C., was added n-butyl lithium (0.36 mL, 0.9 mmol) dropwise over 10 min. The mixture was stirred at −78° C. for 30 min, then warmed to −20° C. and stirred for 1 h. The reaction was quenched with aqueous 1N HCl solution (3 mL), and then stirred at rt for 30 min. Saturated aqueous Na₂CO₃ solution was added to adjust the pH to 8, and then the mixture was extracted with EA (25 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (30 g), filtered and concentrated in vacuo to give 146 mg of the crude title compound. LC-MS (Method A) (ESI+): m/z 251 (M+H)⁺; ¹H-NMR (300 MHz, DMSO-d₄) δ 8.51 (s, 1H), 8.44 (s, 2H), 5.50 (m, 1H), 3.90 (m, 1H), 3.70-3.88 (m, 3H), 2.18 (m, 1H), 1.86-1.98 (m, 2H), 0.90-1.05 (m, 4H).

The Following Compounds were Prepared According to the Method for the Preparation of BB-7:

Example	Structure	Analytical data
BB-8		LC-MS (Method A) (ESI+): m/z 239 (M + H)+; 1H- NMR (300 MHz, CD3OD) δ 8.49 (s, 1H), 4.50 (t, J = 4.5 Hz, 2H), 3.71 (t, J = 4.5 Hz, 2H), 3.38 (s, 3H), 1.80 (m, 1H), 1.10-1.14 (m, 2H), 0.95-1.05 (m, 2H)
BB-9		LC-MS (Method A) (ESI+): m/z 185 (M + H)+
BB-10		1H-NMR (300 MHz, CD3OD) δ 8.67 (s, 1H), 4.51-4.59 (m, 2H), 3.69-3.76 (m, 2H), 3.48 (s, 3H), 2.69 (s, 3H).
BB-11		LC-MS (Method A) (ESI+): m/z 227 (M + H)+; 1H- NMR (300 MHz, CD3OD) δ 8.51 (s, 1H), 4.78 (m, 1H), 4.60-4.70 (m, 2H), 4.56 (m, 1H), 1.82 (m, 1H), 1.00-1.16 (m, 2H), 0.98-1.03 (m, 2H)
BB-12		LC-MS (Method A) (ESI+): m/z 235 (M + H)+;
BB-13		LC-MS (Method A) (ESI+): m/z 235 (M + H)+; 1H- NMR (300 MHz, DMSO-d6) δ 8.47 (s, 1H), 8.44 (s, 2H), 5.12 (m, 1H), 2.29-2.41 (m, 2H), 2.01- 2.2.15 (m, 2H), 1.88 (m, 1H), 1.77 (m, 1H), 1.62 (m, 1H), 0.93-0.98 (m, 4H)
BB-14		1H-NMR (300 MHz, CDCl3) δ 8.69 (s, 1H), 5.69 (s, 2H), 4.40 (m, 1H), 2.99 (m, 1H), 1.18-1.25 (m, 2H), 1.01-1.18 (m, 2H), 0.85-0.91 (m, 2H), 0.78- 0.84 (m, 2H).
BB-15		LC-MS (Method A) (ESI+): m/z 198 (M + H)+; 1H- NMR (300 MHz, CD3OD) δ 8.58 (s, 1H), 8.54 (s, 2H), 1.94 (m, 1H), 1.01-1.04 (m, 4H)
BB-16		LC-MS (Method B): (ESI+); m/z 209.10 (M + H)+, 1H-NMR (400 MHz, DMSO-d6) δ 8.49 (s, 1H), 8.40 (s, 2H), 4.31 (q, J = 6.8 Hz, 2H), 1.85-1.93 (m, 1H), 1.28 (t, J = 7.1 Hz, 3H), 0.91-1.02 (m, 4H).
BB-17		LC-MS (Method C): (ESI+); m/z 270.95 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 8.48-8.54 (m, 3H), 7.29-7.44 (m, 5H), 5.37 (s, 2H), 1.90-1.94 (m, 1H), 0.93-1.04 (m, 4H).

Preparation of Common Building Block (BB-18)

Step 1: Synthesis of 4-Methoxy-6-(prop-1-en-2-yl)pyrimidine

To a stirred solution of 4-chloro-1-methoxypyrimidine (10.0 g, 69.1 mmol) in dioxane (100 mL) and water (15 mL), was added K₂CO₃ (19.1 g, 138 mmol). The resulting mixture was degassed with argon for 15 min, followed by addition of 4,4,5,5-tetramethyl-2-(prop-1-en-2-yl)-1,3,2-dioxaborolane (13.90 g, 83.00 mmol) and Pd(dppf)Cl₂-DCM (2.80 g, 3.40 mmol). The reaction mixture was further degassed with argon for 10 min and heated to 90° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with EA and filtered through Celite bed. The organic layer was collected and dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-15% EA in hexane to afford 7.80 g of the title compound LC-MS (Method B) (ESI+): m/z 150.85 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ8.74 (s, 1H), 7.00 (s, 1H), 6.18 (s, 1H), 5.44 (s, 1H), 3.93 (s, 3H), 2.09 (s, 3H)

Step 2: Synthesis of 4-Methoxy-6-(1-methylcyclopropyl)pyrimidine

To a stirred solution of trimethylsulfoxonium iodide (16.5 g, 74.9 mmol) in DMSO (100 mL) was added KOtBu (8.42 g, 74.9 mmol), and the reaction mixture was stirred at room temperature for 1 h. To the resulting reaction mixture was added a solution of 4-methoxy-6-(prop-1-en-2-yl)pyrimidine 2 (7.50 g, 49.9 mmol) in THF (10 mL), and the reaction mixture was further stirred at room temperature for 3 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with saturated NaHCO₃ solution and extracted with EA (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by column chromatography using 5-10% EA in hexane to afford 3.80 g of the title compound. LCMS (Method B) (ESI+): m/z 164.85 (M+H)¹H-NMR (400 MHz, DMSO-d₆) δ 8.59 (s, 1H), 6.79 (s, 1H), 3.89 (s, 3H), 1.40 (s, 3H), 1.19-1.25 (m, 2H), 0.85 (q, J=3.4 Hz, 2H).

Step 3: Synthesis of 5-Bromo-4-methoxy-6-(1-methylcyclopropyl)pyrimidine

To a stirred solution of 4-methoxy-6-(1-methylcyclopropyl)pyrimidine (3.00 g, 18.2 mmol) in EtOH (50 mL) at 0° C., was added Br₂ (2.91 mL, 54.0 mmol), and the resulting reaction mixture was stirred at room temperature for 72 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with saturated sodium bisulfate solution and extracted with EA (2×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 2-5% EA in hexane to afford 3.0 g of the title compound. LCMS (Method B) (ESI+): m/z 244.80 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.63 (s, 1H), 3.98 (s, 3H), 1.35 (s, 3H), 0.88-0.93 (m, 2H), 0.78-0.84 (m, 2H).

Step 4: Synthesis of (4-Methoxy-6-(1-methylcyclopropyl)pyrimidin-5-yl)boronic acid (BB-18)

To a stirred solution 5-bromo-4-methoxy-6-(1-methylcyclopropyl)pyrimidine (0.50 g, 2.1 mmol) in toluene:THF (3:1, 8 mL), was added trimethyl borate (0.32 g, 3.1 mmol). To the resulting reaction mixture at −78° C., was added n-BuLi (1.6M, 1.93 mL, 3.1 mmol) and the reaction mixture was stirred at room temperature for 2 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with 2N HCl (10 mL) and stirred at room temperature for 2 h. Then the pH was adjusted to 7 by addition of aq. NaHCO₃ solution. The mixture was then extracted with EA (2×10 mL), and the combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was triturated with Et₂O, filtered and dried to afford the 0.11 g of the title compound. LCMS (Method C) (ESI+): m/z 209.00 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.56 (s, 1H), 8.29 (s, 2H), 3.84 (s, 3H), 1.41 (s, 3H), 1.10 (d, J=2.0 HA, 2H), 0.65-0.69 (m, 2H)

Preparation of Common Building Block (BB-19)

Step 1: Synthesis of 4-methoxy-6-(2-methylprop-1-en-1-yl)pyrimidine

To a stirred solution of 4-chloro-6-methoxypyrimidine 1 (5.00 g, 34.7 mmol), 4,4,5,5-tetramethyl-2-(2-methylprop-1-en-1-yl)-1,3,2-dioxaborolane 2 (7.50 g, 41.7 mmol) in dioxane (50 mL) and water (8 mL), was added K₂CO₃ (14.30 g, 104.2 mmol) at room temperature. The mixture was purged with argon for 30 min, and then treated with Pd(dppf)Cl₂-DCM (2.83 g, 3.47 mmol). The mixture was then heated in a sealed tube at 100° C. for 16 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with water (50 mL) and extracted with EA (2×30 mL). The combined organic layer was dried over anhydrous sodium sulfate and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-2% EA in hexane as eluent to afford the title compound (5.20 g). LC-MS (Method B) (ESI+): m/z 164.8 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.70 (s, 1H), 6.70 (s, 1H), 6.20 (s, 1H), 3.90 (s, 3H), 2.18 (s, 3H), 1.93 (s, 3H).

Step 2: Synthesis of 4-(2,2-dimethylcyclopropyl)-6-methoxypyrimidine

To a stirred solution of trimethylsulfoxonium iodide (9.09 g, 41.1 mmol) and potassium tert-butoxide (4.5 g, 41.1 mmol) in DMSO (50 mL) and THF (5 mL), was added 4-methoxy-6-(2-methylprop-1-en-1-yl) pyrimidine 3 (4.5 g, 27.4 mmol) at room temperature. The resulting mixture was stirred for 16 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (50 mL) and extracted with EA (2×40 mL). The combined organic layer was dried over anhydrous sodium sulfate and concentrated under reduced pressure to afford the title compound (4.5 g) which was used as such in next step without further purification. LC-MS (Method B) (ESI+): m/z 178.9 (M+H)⁺.

Step 3: Synthesis of 4-(2,2-dimethylcyclopropyl)-6-methoxypyrimidine

To a stirred solution of 4-(2,2-dimethylcyclopropyl)-6-methoxypyrimidine 4 (4.50 g, 2.53 mmol) in ethanol (50 mL) at 0° C., was added bromine (6.02 g, 3.79 mmol) dropwise. Upon complete addition, the reaction mixture was stirred at room temperature for 16 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (50 mL) and extracted with hexane (3×20 mL). The combined organic layer was dried over anhydrous sodium sulfate and concentrated under reduced pressure to afford the crude title compound (1.50 g) that was used without purification in the next step. LC-MS (Method B) (ESI+): m/z 256.8 (M+); ¹H-NMR (400 MHz, DMSO-d₆) δ 8.60 (s, 1H), 3.99 (s, 3H), 2.21 (dd, J=5.98, 7.48 Hz, 1H), 1.47 (t, J=4.74 Hz, 1H), 1.30 (s, 3H), 0.97 (dd, J=3.99, 7.48 Hz, 1H), 0.84 (s, 3H).

Step 4: Synthesis of 4-(2,2-dimethylcyclopropyl)-6-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) pyrimidine (BB-19)

To a solution of 5-bromo-4-(2,2-dimethylcyclopropyl)-6-methoxypyrimidine 5 (0.500 g, 1.95 mmol) and 4,4,4′,4′,5,5,5′,5′-octamethyl-2,2′-bi(1,3,2-dioxaborolane) (2.40 g, 9.77 mmol) in dioxane (10 mL), was added KOAc (0.382 g, 3.91 mmol) at room temperature. The resulting mixture was purged with argon for 30 min, and then treated with Pd(dppf)Cl₂-DCM (0.159 g, 0.195 mmol). The reaction mixture was then heated in a sealed tube at 100° C. for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-20% EA in hexane as eluent to afford the title compound (0.330 g). LC-MS (Method B) (ESI+): m/z 304.00 (M+).

Preparation of Common Building Block (BB-20)

Step 1: Synthesis of 6-Cyclobutylpyrimidin-4-ol

Sodium metal (1.47 g, 64.0 mmol) was added to MeOH (40 mL) and stirred at room temperature for 1 h. To the resulting reaction mixture were added formamidine acetate (4.00 g, 38.4 mmol) and methyl 3-cyclobutyl-3-oxopropanoate (4.00 g, 25.6 mmol) at 0° C. The resulting mixture was stirred at room temperature for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (20 mL) and adjusted to pH=4 with AcOH. Then the reaction mixture was concentrated under reduced pressure. The crude reaction mixture was extracted with 10% MeOH in DCM (3×50 mL), and the combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography on silica using 5-10% MeOH in DCM to afford 1.70 g of the title compound. LC-MS (Method C) (ESI+): m/z 150.93 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 11.66-12.56 (m, 1H), 8.12 (s, 1H), 6.09 (s, 1H), 3.27-3.40 (m, 1H), 2.08-2.19 (m, 4H), 1.87-2.01 (m, 1H), 1.74-1.86 (m, 1H).

Step 2: Synthesis of 5-Bromo-6-cyclobutylpyrimidin-4-ol

To an ice cooled solution of 6-cyclobutylpyrimidin-4-ol (1.70 g, 11.3 mmol) in EtOH (30 mL), was slowly added Br₂ (1.80 g, 11.3 mmol) and the resulting mixture was stirred at room temperature for 16b. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude reaction mixture was quenched with saturated aq. Na₂S₂O₃ solution (50 mL), and the solid obtained was filtered, washed with excess Na₂S₂O₃ solution, and dried to afford 2.0 g of the title compound. LC-MS (Method C) (ESI+): m/z 230.86 (M+H)^{+ 81} Br.

Step 3: Synthesis of 5-Bromo-4-chloro-6-cyclobutylpyrimidine

To a stirred solution of 5-bromo-6-cyclobutylpyrimidin-4-ol (2.00 g, 8.70 mmol) in 1,2-DCE (30 mL), was added POCl₃ (5 mL) and the reaction mixture was heated to 100° C. for 3 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude reaction mixture was diluted with H₂O (15 mL), basified to pH=8 using saturated NaHCO₃ solution, and extracted with EA (3×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by flash chromatography on silica using 0-10% EA in hexane to afford 1.30 g of the title compound. LC-MS (Method C) (ESI+): m/z 248.80 (M+H)^{+ 81}Br; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.96 (s, 1H), 3.92-4.02 (m, 1H), 2.29-2.39 (m, 4H), 1.96-2.10 (m, 1H), 1.76-1.88 (m, 1H).

Step 4: Synthesis of 5-Bromo-4-cyclobutyl-6-methoxypyrimidine

To an ice cooled solution of 5-bromo-4-chloro-6-cyclobutylpyrimidine (1.30 g, 5.20 mmol) in MeOH (30 mL) was added sodium methoxide (1.17 g, 21.00 mmol). The reaction mixture was stirred at room temperature for 16 h and the progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The residue was dissolved in water (10 mL) and extracted with EA (3×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 1.0 g of the title compound. LC-MS (Method C) (ESI+): m/z 244.90 (M+H)^{+ 81}Br; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.71 (s, 1H), 3.98 (s, 3H), 3.85-3.94 (m, 1H), 2.23-2.39 (m, 4H), 1.95-2.08 (m, 1H), 1.77-1.87 (m, 1H).

Step 5: Synthesis of (4-Cyclobutyl-6-methoxypyrimidin-5-yl)boronic acid (BB-20)

To a stirred solution of 5-bromo-4-cyclobutyl-6-methoxypyrimidine (1.00 g, 4.11 mmol) in toluene:THF (5:1, 30 mL) under nitrogen atmosphere was added triisopropylborate (2.86 mL, 12.30 mmol) and the reaction mixture was cooled to −78° C. Then n-BuLi (1.6M, 3.85 mL, 6.17 mmol) was added dropwise over a period of 45 man. Stirring was continued at the same temperature for 30 man, and then the reaction mixture was further stirred at room temperature for 3 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with 2N HCl (10 mL) and stirred at room temperature for 16K The reaction mixture was basified to pH=8 using K₂CO₃ (solid) and extracted with EA (3×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was triturated with Et₂O and n-pentane (10 mL), filtered to collect the solid, and dried to afford 0.42 g of the title compound. LC-MS (Method C) (ESI+): m/z 209.03 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.70 (s, 1H), 8.33 (s, 2H), 3.85 (s, 3H), 3.46-3.58 (m, 1H), 2.26-2.38 (m, 2H), 2.10-2.20 (m, 2H), 1.89-2.03 (m, 1H), 1.74-1.86 (m, 1H).

The Following Building Blocks were Prepared According to the Procedure of BB-20 from the Appropriate β-Ketoester or 6-alkylpyrimidin-4-ol:

Example	Structure	Analytical data
BB-21		LC-MS (Method C) (ESI+): m/z 210.95 (M + H)+, 1H-NMR (400 MHz, DMSO-d6) δ 8.65 (s, 1H), 8.24 (s, 2H), 3.86 (s, 3H), 1.30 (s, 9H).
BB-22		LC-MS (Method C) (ESI+): m/z 196.85 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 8.66 (d, J = 1.47 Hz, 1H), 8.37 (d, J = 1.47 Hz, 2H), 3.86 (d, J = 1.96 Hz, 3H), 2.79-2.89 (m, 1H), 1.14-1.21 (m, 6H).
BB-23		LC-MS (Method C) (ESI+): m/z 214.95 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 8.68 (s, 1H), 7.89 (s, 2H), 3.89 (s, 3H), 1.63 (s, 3H), 1.57 (s, 3H).
BB-24		LC-MS (Method C) (ESI+): m/z 198.80 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 8.19 (s, 2H), 3.85 (s, 3H), 3.83 (s, 3H), 2.29 (s, 3H)

Preparation of Common Building Block (BB-25)

Step 1: Synthesis of 5-Bromo-4-cyclopropyl-6-(difluoromethoxy)pyrimidine

To a suspension of 5-bromo-6-cyclopropylpyrimidin-4-ol (1.0 g, 4.7 mmol) in ACN (100 mL) at rt, was added NaH (60% dispersion, 560 mg, 14.0 mmol) portion-wise over 10 mm. After the mixture was stirred at rt for 20 min, 2,2-difluoro-2-(fluorosulfonyl)acetic acid (1.4 g, 7.9 mmol) was added dropwise over 10 min. After the addition, the mixture was stirred at rt overnight. After the reaction was completed as indicated by TLC analysis, the reaction was quenched with a saturated NH₄Cl solution (20 mL) and extracted with EA (50 mL×2). The combined organic layer was dried over sodium sulfate (30 g), filtered, and concentrated. The residue was purified by silica gel chromatography (PE:EA=20:1 to 10:1) to afford 600 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 8.46 (s, 1H), 7.48 (t, J=71.4 Hz), 2.58 (m, 1H), 1.10-1.30 (m, 4H).

Step 2: Synthesis of 4-Cyclopropyl-6-(difluoromethoxy)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (BB-25)

To a mixture of 5-bromo-4-cyclopropyl-6-(difluoromethoxy)pyrimidine (100 mg, 0.38 mmol), 4,4,4′,4′,5,5,5′,5′-octamethyl-2,2′-bi(1,3,2-dioxaborolane) (192 mg, 0.75 mmol), and KOAc (112 mg, 1.14 mmol) in dioxane (3 mL) under nitrogen, was added Pd(dppf)Cl₂ (33.00 mg, 10 mol %). The resulting mixture was stirred at 95° C. overnight. After the reaction was completed based on TLC analysis, the reaction was quenched with water (15 mL) and extracted with EA (20 ml×3). The combined organic phase was dried over anhydrous Na₂SO₄ (20 g), filtered, and concentrated. The residue was purified by silica gel chromatography (EA:n-Hex=1:20) to give 93 mg of the title compound. LC-MS (Method A) (ESI+): m/z 313 (M+H)⁺.

Preparation of Common Building Block (BB-26)

Step 1: Synthesis of 4-Chloro-6-isopropoxypyrimidine

A mixture of sodium hydride (60% dispersion, 1.07 g, 26.8 mmol) in THF (40 mL) was cooled to 0° C. and a solution of isopropyl alcohol (2.04 mL, 26.8 mmol) in THF (15 mL) was added dropwise. Upon addition, the reaction was stirred at room temperature for 30 min, and then 4,6-dichloropyrimidine (4.0 g, 26.84 mmol) in THF (15 mL) was added dropwise at room temperature. The resulting mixture was stirred for another 1.5 h, and then quenched with cold water (100 mL) and extracted with EA (3×50 mL). The combined organic layer was dried over anhydrous Na₂SO₄, filtered, and dried under vacuum. The crude compound was purified by silica gel chromatography (0-10% EA in n-hexane) to afford 1.75 g of the title compound. ¹H-NMR (400 MHz, CDCl₃) δ8.55 (s, 1H), 6.70 (s, 1H), 5.34-5.42 (m, 1H), 1.36 (dd, J=1.22, 6.11 Hz, 6H).

Step 2: Synthesis of 4-Cyclopropyl-6-isopropoxypyrimidine

A mixture of 4-chloro-6-isopropoxypyrimidine (1.50 g, 8.720 mmol), cyclopropylboronic acid (1.49 g, 17.4 mmol), tripotassium phosphate (5.54 g, 26.2 mmol) and Ag₂O (1.00 g, 4.36 mmol) in 1,4 dioxane (15 mL) was purged with argon gas for 20 min. To the resulting solution was added PdCl₂(dppf) (0.637 g, 0.872 mmol) at room temperature. The reaction mixture was then heated at 90° C. for 8 h. After completion of the reaction (monitored by TLC), the mixture was filtered through a pad of Celite and washed with DCM (50 mL). The filtrate was concentrated under reduced pressure. The resulting crude compound was purified by silica gel chromatography (0-5% EA in n-hexane) to afford 0.700 g of the title compound. ¹H-NMR (400 MHz, DMSO-d₆) δ 8.53 (s, 1H), 6.76 (s, 1H), 5.27 (td, J=6.11, 12.23 Hz, 1H), 1.95-2.05 (m, 1H), 1.35 (d, J=6.36 Hz, 2H), 1.28 (d, J=6.36 Hz, 6H), 0.98 (d, J=3.91 Hz, 2H).

Step 3: Synthesis of 5-Bromo-4-cyclopropyl-6-isopropoxypyrimidine

To a stirred solution of 4-cyclopropyl-6-isopropoxypyrimidine (0.600 g, 3.370 mmol) in ethanol (7 mL) at 0° C., was added bromine (0.20 mL, 4.04 mmol) dropwise. The reaction mixture was warmed to room temperature and stirred for 4 h. After completion of the reaction (monitored by TLC), the mixture was quenched with saturated NaHCO₃ solution (30 mL). The aqueous layer was extracted with EA (3×30 mL) and the combined organic layer was dried over anhydrous Na₂SO₄, filtered, and concentrated under reduced pressure. The resulting crude compound was purified by silica gel chromatography (0-10% EA in n-hexane) to afford 0.610 g of the title compound. ¹H-NMR (400 MHz, CDCl₃) δ 8.40 (s, 1H), 5.38 (td, J=6.11, 12.23 Hz, 1H), 2.47-2.57 (m, 1H), 1.40 (d, J=5.87 Hz, 6H), 1.16 (d, J=1.96 Hz, 2H), 1.08 (dd, J=3.18, 4.65 Hz, 2H).

Step 4: Synthesis of 4-Cyclopropyl-6-isopropoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (BB-26)

A mixture of 5-bromo-4-cyclopropyl-6-isopropoxypyrimidine 4 (0.250 g, 0.972 mmol), bispinacolato diborane (0.246 g, 0.972 mmol), and KOAc (0.095 g, 0.972 mmol) in Toluene:DME:EtOH:H₂O (32:2:1, 3 mL) was combined at room temperature and purged with argon gas for 20 min. To the resulting solution, was added PdCl₂(dppf) (0.071 g, 0.097 mmol). The reaction mixture was heated in a microwave at 90° C. for 20 min. After completion of the reaction (monitored by TLC), the mixture was used without work up in subsequent coupling reactions.

Preparation of Common Building Block (BB-27)

Step 1: Synthesis of 5-Bromo-4-chloro-6-methoxypyrimidine

To a stirred solution of 4-chloro-6-methoxypyrimidine (5.00 g, 34.70 mmol) in EtOH (50 mL) was added Br₂ (3.20 g, 41.60 mmol) at room temperature, and the reaction mixture was stirred at room temperature for 16 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with sodium bisulfate solution and extracted with n-hexane (3×100 mL). Combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography on silica using 0-3% EA in hexane to afford 3.90 g of the title compound. LC-MS (Method B) (ESI+): m/z 224.70 (M+H)^{+ 81}Br: ¹H-NMR (400 MHz, DMSO-d₆) δ 8.64 (s, 1H), 4.04 (s, 3H).

Step 2: Synthesis of 5-Bromo-4,6-diethoxypyrimidine

To a stirred solution of EtOH (20 mL) was added sodium metal (0.092 g) in portion at room temperature under argon atmosphere. To the resulting reaction mixture, S-bromo-4-chloro-6-methoxypyrimidine (0.90 g, 4.00 mmol) was added, and the reaction mixture was stirred at room temperature for 2 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure, and the residue thus obtained was quenched with water (50 mL) and extracted with EA (2×25 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The same sequence was repeated on another 500 mg scale batch of starting material, and the combined crude compound of the two batches was purified together by prep HPLC to afford 0.38 g of the title compound. LC-MS (Method C) (ESI+): m/z 246.85 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.40 (s, 1H), 4.44 (q, J=7.2 Hz, 4H), 1.33 (t, J=7.1 Hz, 6H).

Step 3: Synthesis of (4,6-Diethoxypyrimidin-5-yl)boronic acid (BB-27)

To a stirred solution of 5-bromo-4,6-diethoxypyrimidine (0.38 g, 1.54 mmol) in THF (2.5 mL) and toluene (5 mL) was added triisopropylborate (0.435 g, 2.31 mmol) wider argon atmosphere. To the resulting reaction mixture n-BuLi (1.6M in hexane, 1.35 mL, 2.16 mmol) was added dropwise at −76° C., stirred for 30 min at same temperature and further stirred at room temperature for 30 min. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with 2N HCl (5 mL), stirred for 2 h and adjusted to pH=7.5-8 using Na₂CO₃ (2 g). The aqueous layer was extracted with EA (3×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was triturated with n-pentane (10 mL), and the resulting solid was collected and dried to afford 0.065 g of the crude title compound which was used as is in next step without further purification. LC-MS (Method C) (ESI+): m/z 212.90 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) (δ 8.35-8.43 (m, 1H), 8.11 (s, 1H), 4.27-4.37 (m, 4H), 1.21-1.35 (m, 6H).

The Following Intermediate was Made from the Commercially Available Aryl Bromide Via the Procedure Described to Prepare BB-27:

Example	Structure	Analytical data
BB-28		LC-MS (Method B) (ESI+): m/z 184.80 (M + H)+
BB-29		LC-MS (Method B) (ESI+): m/z 198.90 (M + H)+
BB-30		Prepared in situ via Pd-catalyzed borylation according to the procedure of BB-26 step-4, and used in next step without isolation

Preparation of Common Building Block (BB-31)

Step 1: Synthesis of 1-Isopropyl-4-methyl-1H-pyrazole

To a solution of 4-methyl-1H-pyrazole (1.0 g, 12.2 mmol) in THF (30 mL) at 0° C., was added NaH (60% dispersion, 730 mg, 18.3 mmol) portion-wise over 5 min. The mixture was stirred at 0° C. for 30 min, then allowed to warm to rt. A solution of isopropyl 4-methylbenzenesulfonate (2.6 g, 12.2 mmol) in THF (10 mL) was added to the reaction mixture in one portion. After addition, the reaction was heated to reflux overnight. The reaction was then quenched with water (50 mL) and extracted with EA (50 mL×2). The combined organic layer was dried over sodium sulfate (30 g), filtered, and concentrated. The residue was purified by silica gel chromatography (PE:EA=50:1 to 10:1) to afford 0.44 g of the title compound. ¹H-NMR (300 MHz, CD₃OD) δ 7.30 (s, 1H), 7.20 (s, 3H), 4.44 (m, 1H), 2.07 (s, 3H), 1.48 (d, J=6.6 Hz, 6H).

Step 2: Synthesis of 1-Isopropyl-4-methyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrazole (BB-31)

To a solution of 1-isopropyl-4-methyl-1H-pyrazole (350 mg, 2.82 mmol) in THE (10 ml) at 0° C., was added n-BuLi (2.3 mL, 5.7 mmol) dropwise over 10 nom. After the mixture was stirred at 0° C. for 1 h, the reaction was cooled to −78° C. A solution of 2-isopropoxy-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (1.05 g, 5.65 mmol) in THF (5 mL) was added dropwise to the reaction mixture over 5 min. After the reaction was stirred at 78° C. for 30 min, the reaction was warmed to rt and stirred for 4 h. The reaction was quenched with water (20 mL) and extracted with EA (20 mL×2). The combined organic layer was dried over sodium sulfate (10 g), filtered, and concentrated. The residue was purified by column chromatography on silica (eluent: PE/EA=100/1 to 20/1) to afford 180 mg of the title compound. LC-MS (Method A) (ESI+): m/z 251 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 7.34 (s, 1H), 5.05 (m, 1H), 2.22 (s, 3H), 1.45 (d, J=6.6 Hz, 6H), 1.33 (s, 12H).

The Following Compounds Weir Made from the Appropriate Heterocycle and Alkylating Agent According the Procedure Described for BB-31:

Example	Structure	Analytical data
BB-32		LC-MS (Method A) (ESI+): m/z 263 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 7.03 (s, 1H), 4.35-4.45 (q, J = 7.2 Hz, 2H), 2.21 (m, 1H), 1.30-1.45 (m, 15H), 0.85-0.94 (m, 2H), 0.51-0.59 (m, 2H).
BB-33		LC-MS (Method A) (ESI+): m/z 265 (M + H)+.
BB-34		LC-MS (Method A) (ESI+): m/z 197 (M + H)+.

Preparation of Common Building Block BB-35

Step 1: Synthesis of 4-Isopropyl-6-methylpyrimidine

To a solution of 4-chloro-6-met ylpyrimidine (2 g, 15.63 mmol) in Et₂O (10 mL) at rt, was added Ni(dppe)Cl₂ (165 mg, 0.3 mmol) in one portion. After the mixture was cooled −10° C. for 10 min, isopropyl magnesium bromide solution (1 M, 18.75 mmol, 18.75 mL) was added dropwise to the reaction mixture over 5 min. The mixture was stirred at −10° C. for 1 h, and then quenched with water (30 mL) and extracted with EA (30 mL×3). The combined organic layer was dried over sodium sulfate (50 g), filtered, and concentrated. The residue was purified by silica gel chromatography on silica (PE:EA=100:1 to 20:1) to afford 2.02 g of the title compound. LC-MS (Method A) (ESI+): m/z 137 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.00 (s, 1H), 7.06 (s, 1H), 2.98 (m, 1H), 2.51 (s, 3H), 1.30 (d, J=6.9 Hz, 6H).

Step 2: Synthesis of 5-Bromo-4-isopropyl-6-methylpyrimidine

To a solution of 4-isopropyl-6-methylpyrimidine (500 mg, 3.6 mmol) in EtOH (5 mL) at 0° C., was added Br₂ (588 mg, 3.6 mmol) in one portion. The resulting mixture was stirred at rt overnight, then quenched with water (20 mL) and extracted with EA (15 mL×3). The combined organic layer was dried over sodium sulfate (20 g), filtered, and concentrated. The residue was purified by silica gel chromatography on silica (PE:EA=20:1) to afford 400 mg of the title compound. LC-MS (Method A) (ESI+): m/z 215 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 8.88 (s, 1H), 3.56 (m, 1H), 2.66 (s, 3H), 1.25-1.31 (m, 6H).

Step 3: Synthesis of 4-Isopropyl-6-methyl-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (BB-35)

To a solution of 5-bromo-4-isopropyl-6-methylpyrimidine (400 mg, 1.86 mmol) and triisopropylborate (457 mg, 2.43 mmol) in toluene (4 mL) and THF (1 mL) at −78° C., was added n-butyllithium (1 mL, 2.6 mmol) dropwise over 10 min. After 30 min at −78° C., the reaction was warmed to −20° C. and stirred for 1 h. The reaction was then quenched with aqueous HCl solution (3 mL, 1 N), and stirred at rt for 30 min. The pH was then adjusted to 8 with a saturated aqueous Na₂CO₃ solution and extracted with EA (25 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (30 g), filtered, and concentrated in vacuo to give 140 mg of the crude title compound. LC-MS (Method A) (ESI+): m/z 181 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 8.91 (s, 1H), 2.78 (m, 1H), 2.44 (s, 3H), 1.26-1.32 (d, J=6.6 Hz, 6H).

Preparation of Common Building Block BB-36

Step 1: Synthesis of tert-butyl 3-(6-methoxypyrimidin-4-yl)azetidine-1-carboxylate

To a stirred solution of zinc (3.78 g, 58.3 mmol) in THF (150 mL), was added TMSCl (0.574 g, 5.30 mmol) and 1,2-dibromoethane (0.962 g, 5.30 mmol). The mixture was stirred for 5 min at room temperature, and was then treated with tert-butyl 3-iodoazetidine-1-carboxylate 2 (15 g, 53.0 mmol) at a rate that maintained the internal reaction temperature below 40° C. The resulting mixture was further stirred for 30 min at room temperature. To the resulting reaction mixture was added 4-chloro-6-methoxypyrimidine 1 (7.64 g, 53.0 mmol), X-Phos (5 g, 10.6 mmol) and Pd₂(dba)₃ (4.84 g, 5.30 mmol). The reaction mixture was heated to 60° C. in a sealed tube for 4 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (200 mL), extracted with EA (200 mL), and filtered through Celite. The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-70% EA in hexane to afford title compound (10.00 g). LC-MS (Method C) (ESI+): m/z 266.3 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.80 (s, 1H), 6.89 (s, 1H), 4.09-4.20 (m, 2H), 3.95-4.06 (m, 2H), 3.91 (s, 3H), 3.79-3.86 (m, 1H), 1.39 (s, 9H).

Step 2: Synthesis of 4-(azetidin-3-yl)-5-bromo-6-methoxypyrimidine

To a stirred solution of tert-butyl 3-(6-methoxypyrimidin-4-yl)azetidine-1-carboxylate 3 (3.0 g, 11.3 mmol) in ethanol (DX) mL), was added bromine (5.42 g, 33.9 mmol) at 0° C. The resulting mixture was allowed to warm to room temperature and was stirred for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The residue was dissolved in aqueous ammonia solution (30 mL) and extracted with DCM (100 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-10% methanol in DCM as eluent to afford title compound (1.7 g). LC-MS (Method C) (ESI+): m/z 245.90 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.77 (s, 1H), 4.31 (td, J=8.35, 16.21 Hz, 2H), 4.01 (s, 3H), 3.87-3.94 (m, 3H).

Step 3: Synthesis of 5-bromo-4-methoxy-6-(1-methylazetidin-3-yl)pyrimidine

To a stirred solution of 4-(azetidin-3-91)-5-bromo-6-methoxypyrimidine 4 (1.0 g, 4.08 mmol) in methanol (20 mL), was added formaldehyde solution (10 mL, 37% in water) and the reaction mixture was stirred at room temperature for 1 h. To the resulting reaction mixture was added sodium triacetoxyborohydride (4.3 g, 20.4 mmol) at room temperature. The resulting mixture was stirred for 5 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with DCM (50 mL) and the solution was adjusted to pH 8 using saturated sodium bicarbonate solution (10 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-10% methanol in DCM as eluent to afford title compound (0.719 g). LC-MS (Method C) (ESI): m/z 257.88 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.75 (s, 1H), 4.11 (quip, J=7.83 Hz, 1H), 4.01 (s, 3H), 3.90 (t, J=8.07 Hz, 2H), 3.62 (t, J=7.58 Hz, 2H), 2.45 (s, 3H).

Step 4: Synthesis of 4-methoxy-6-(1-methylazetidin-3-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (BB-36)

To a stirred solution of 5-bromo-4-methoxy-6-(1-methylazetidin-3-yl)pyrimidine 5 (0.600 g, 2.32 mmol) and B₂Pin₂ (1.77 g, 6.97 mmol) in dioxane (30 mL), was added KOAc (0.676 g, 6.97 mmol) and the reaction mixture was degassed with argon gas for 15 min. To the resulting reaction mixture was added Pd(dppf)Cl₂-DCM (0.375 g, 0.465 mmol) at room temperature, and the mixture was heated in a sealed tube at 80° C. for 2 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with EA (100 mL) and filtered through a pad of Celite. The filtrate obtained was concentrated under reduced pressure to afford the crude title compound (0.709 g). The crude compound was used as such in next step without further purification.

Preparation of Common Building Block BB-37

Step 1: 2-amino-6-cyclopropylpyrimidin-4-ol

To a suspension of methyl 3-cyclopropyl-3-oxopropanoate (8.1 g, 57 mmol) and guanidine carbonate (5.65 g, 63 mmol) in ethanol (70 mL) at rt, was added NaOEt (7.75 g, 114 mmol) portion-wise over 20 min. After the addition, the resulting mixture was warmed to reflux and stirred overnight. After the reaction was complete as indicated by TLC analysis, the resulting suspension was concentrated under reduced pressure to remove most of the ethanol. The residue was diluted with a saturated NH₄Cl solution (100 mL) and extracted with EA (3×200 mL). The combined organic layer was dried with Na₂SO₄ (50 g), filtered and concentrated to give 9 g of crude product. The crude product was slurried in a mixed solvent (Methanol/MTBE=1/10, 33 mL) at rt overnight. After filtration and drying, 7.2 g of the title compound was obtained. LC-MS (Method A) (ESI+): m/z 152 (M+H)⁺; ¹H-NMR (300 MHz, DMSO-d₆) δ 10.45 (s, 1H), 6.37 (s, 2H), 5.48 (s, 1H), 1.65 (m, 1H), 078-0.83 (m, 4H).

Step 2: 4-chloro-6-cyclopropylpyrimidin-2-amine

To a suspension of 2-amino-6-cyclopropylpyrimidin-4-ol (1.5 g, 9.9 mmol) in DCE (30 mL), was added POCl₃ (20 mL). The reaction was stirred at 75° C. overnight. After the reaction was complete as indicated by TLC, the mixture was concentrated to dryness. The residue was quenched with a cold saturated sodium carbonate solution (60 mL) and extracted with DCM (100 mL×2). The combined organic layer was dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (PE/EA=10:1) to provide 1.0 g of the title compound. LC-MS (Method A) (ESI+): m/z 170 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 6.52 (s, 1H), 5.05 (br s, 2H), 1.79 (m, 1H), 0.94-1.10 (m, 4H).

Step 3: 4-cyclopropyl-6-methoxypyrimidin-2-amine

To a solution of 4-chloro-6-cyclopropylpyrimidin-2-amine (850 mg, 5.03 mmol) in MeOH (50 mL), was added NaOMe solution (2.72 g, 15.1 mmol, 30 wt. % in MeOH) in one portion. The reaction was stirred at 60° C. for 3 h. After the reaction was complete as indicated by TLC, the mixture was quenched with water (60 mL) and extracted with EA (100 mL×2). The combined organic layer was washed with brine (120 mL), dried over sodium sulfate (30 g), filtered and concentrated to provide 800 mg of the crude title compound. LC-MS (Method A) (ESI+): m/z 166 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 5.91 (s, 1H), 4.80 (br s, 2H), 3.84 (s, 3H), 1.79 (m, 1H), 0.91-1.08 (m, 2H), 0.85-0.91 (m 2H).

Step 4: Di-Boc protected 4-cyclopropyl-6-methoxypyrimidin-2-amine

To a solution of 4-cyclopropyl-6-methoxypyrimidin-2-amine (900 mg, 5.45 mmol) and Boc₂O (5.96 g, 27.3 mmol) in THF (50 mL), was added NaH (654 mg, 16.4 mmol, 60 wt. %) portion-wise over 5 nan. The reaction was stirred at 60° C. overnight. After the reaction was complete as indicated by TLC analysis, the mixture was quenched with an aqueous NH₄Cl solution (100 mL) and extracted with EA (100 mL×2). The combined organic layer was washed with brine (120 mL), dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (PE/EA=50:1 to 25:1) to provide 1.27 g of the title compound. LC-MS (Method A) (ESI+): m/z 366 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 6.43 (s, 1H), 3.92 (s, 3H), 1.89 (m, 1H), 1.44 (s, 18H), 1.02-1.10 (m, 2H), 0.91-1.02 (m, 2H).

Step 5: Di-Boc protected 5-bromo-4-cyclopropyl-6-methoxypyrimidin-2-amine

To a solution of di-Boc protected 4-cyclopropyl-6-methoxypyrimidin-2-amine (1.27 g, 3.47 mmol) in DCM (35 mL) at 0° C., was added NBS (1.24 g, 6.96 mmol) portion-wise over 5 min. The reaction was stirred at rt overnight. After the reaction was complete as indicated by TLC, the mixture was quenched with water (30 mL) and extracted with DCM (40 mL×2). The organic layer was washed with brine (60 mL), dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (PE/EA=60:1 to 30:1) to provide 1.4 g of the title compound. LC-MS (Method A) (ESI+): m/z 444 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 4.01 (s, 3H), 2.52 (m, 1H), 1.45 (s, 18H), 1.09-1.17 (m, 2H), 1.02-1.09 (m, 2H).

Step 6: Di-Boc protected 4-cyclopropyl-6-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) pyrimidin-2-amine (BB-37)

To a solution of di-Boc protected 5-bromo-4-cyclopropyl-6-methoxy-pyrimidin-2-amine (1.5 g, 3.4 mmol) in 1,4-dioxane (34 mL), was added bis(pinacolato)diboron (1.72 g, 6.77 mmol), potassium acetate (997 mg, 10.2 mmol) and Pd(dppf)Cl₂ (249 mg, 0.34 mmol). The reaction was then heated to 95° C. overnight. After most of bromo starting material was consumed based on TLC analysis, the mixture was quenched with water (40 mL), and the un-dissolved solid was filtered. The filtrate was extracted with EA (100 mL×2). The combined organic layer was washed with brine (60 mL), dried over sodium sulfate (30 g), filtered and concentrated. The resulting residue was purified by silica gel chromatography (PE/EA=30:1 to 10:1) to provide 650 mg of the title compound. LC-MS (Method A) (ESI+): m/z 492 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 3.90 (s, 3H), 2.18 (m, 1H), 1.45 (s, 18H), 1.33 (s, 12H), 1.09-1.13 (m, 2H), 0.89-0.96 (m, 2H).

General Experimental Procedure 1. Preparation of Example 1

A mixture of 6-chloro-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (100 mg, 0.25 mmol). K₃PO₄·3H₂O (208 mg, 0.78 mmol), (2-isopropylphenyl)boronic acid (84 mg, 0.51 mmol) and Pd(PPh₃)₄ (30 mg, 0.025 mmol) in 1,4-dioxane (4 ml) and water (0.3 ml), was stirred at 100° C. for 2 hours. The resulting mixture was diluted with water (10 mL) and extracted with EA (20 mL×2). The combined organic layer was dried with Na₂SO₄ (10 g), filtered and concentrated to dryness. The concentrated residue was purified by silica gel chromatography (PE:EA=30:1 to 5:1), followed by preparative HPLC to afford 62 mg of the title compound. LC-MS (Method A) (ESI+): m/z 477 (M+H)⁺; ¹H-NMR (300 MHz CDCl₃) δ 9.30 (s, 1H), 8.20 (s, 1H), 7.72 (d, J=7.2 Hz, 1H), 7.59 (d, J=8.1 Hz, 2H), 7.44-7.51 (m, 4H), 7.26-7.35 (in 2H), 5.75 (s, 2H), 3.73 (s, 3H), 3.56 (m, 1H), 1.27 (d, J=6.9 Hz, 6H).

The Following Compounds were Prepared According to the General Experimental Procedure 1 Using Pd(PPh₃)₄/K₃PO₄ or XPhos-Pd-G2/XPhos/K₃PO₄ and the Appropriate Boron Species (Structures of Commercial Boronic Acids and Boronates Indicated):

Ex-
am-		Starting
ple	Structure	material	Analytical data
2		I-1,	LC-MS (Method A) (ESI+): m/z 465 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.31 (s, 1H), 8.18 (s, 1H), 7.80 (d, J = 7.5 Hz, 1H), 7.60 (d, J = 8.1 Hz, 2H), 7.52 (d, J = 8.1 Hz, 2H), 7.47 (d, J = 7.5 Hz, 1H), 7.29 (s, 1H), 7.07-7.15 (m, 2H), 5.77 (s, 2H), 3.91 (s, 3H), 3.73 (s, 3H).
3		I-1,	LC-MS (Method A) (ESI+): m/z 513 (M + H)+; 1H-NMR (300 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.55 (s, 1H), 8.11 (d, J = 7.8 Hz, 1H), 7.91 (s, 1H), 7.86 (d, J = 7.8 Hz, 1H), 7.79-7.84 (m, 2H), 7.68 (d, J = 8.1 Hz, 2H), 7.39 (d, J = 8.1 Hz, 2H), 5.80 (s, 2H), 3.75 (s, 3H), 3.50 (s, 3H).
4		I-1,	LC-MS (Method A) (ESI+): m/z 495 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.31 (s, 1H), 8.37 (s, 1H), 7.67 (s, 1H), 7.62 (d, J = 8.4 Hz, 2H), 7.52 (d, J = 8.4 Hz, 2H), 7.44 (t, J = 8.4 Hz, 1H), 6.79 (d, J = 8.4 Hz, 2H), 5.79 (s, 2H), 3.74 (s, 3H), 3.72 (s, 6H).
5		I-1,	LC-MS (Method A) (ESI+): m/z 479 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.32 (s, 1H), 8.21 (s, 1H), 7.57 (d, J = 8.4 Hz, 2H), 7.47 (d, J = 8.4 Hz, 2H), 7.26-7.32 (m, 2H), 6.88-6.95 (m, 2H), 5.76 (s, 2H), 3.75 (s, 3H), 3.73 (s, 3H), 2.08 (s, 3H).
6		I-1,	LC-MS (Method A) (ESI+): m/z 480 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.32 (s, 1H), 8.22 (s, 1H), 8.14 (d, J = 5.1 Hz, 1H), 7.59 (d, J = 8.1 Hz, 2H), 7.48 (d, J = 8.1 Hz, 2H), 7.30 (s, 1H), 6.88 (d, J = 5.1 Hz, 1H), 5.75 (s, 2H), 3.90 (s, 3H), 3.73 (s, 3H), 2.13 (s, 3H).
7		I-1,	LC-MS (Method A) (ESI+): m/z 527 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.37 (s, 1H), 8.42 (s, 1H), 8.12 (d, J = 7.5 Hz, 1H), 7.72-7.90 (m, 3H), 7.67 (s, 1H), 7.62 (d, J = 8.1 Hz, 2H), 7.42 (d, J = 8.1 Hz, 2H), 5.82 (s, 2H), 3.74 (s, 3H), 3.61-3.68 (q, J = 7.5 Hz, 2H), 1.17-1.28 (t, J = 7.5 Hz, 3H).
8		I-1,	LC-MS (Method A) (ESI+): m/z 466 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.33 (s, 1H), 8.53 (s, 1H), 8.42 (d, J = 5.1 Hz, 1H), 8.22 (s, 1H), 7.72 (d, J = 5.1 Hz, 1H), 7.61 (d, J = 8.4 Hz, 2H), 7.53 (d, J = 8.4 Hz, 2H), 7.30 (s, 1H), 5.78 (s, 2H), 4.02 (s, 3H), 3.73 (s, 3H).
9		I-1 and BB-1	LC-MS (Method A) (ESI+): m/z 478 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.61 (dd, J = 4.8, 1.5 Hz, 1H), 8.39 (s, 1H), 8.14 (dd, J = 7.8, 1.5 Hz, 1H), 7.67 (s, 1H), 7.62 (d, J = 8.1 Hz, 2H), 7.50 (d, J = 8.1 Hz, 2H), 7.39 (m, 1H), 5.82 (s, 2H), 3.74 (s, 3H), 3.65 (m, 1H), 1.24-1.29 (d, J = 6.6 Hz, 6H).
10		I-1 and BB-2	LC-MS (Method A) (ESI+): m/z 495 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.36 (s, 1H), 8.39 (s, 1H), 7.67 (s, 1H), 7.62 (d, J = 8.1 Hz, 2H), 7.49 (d, J = 8.1 Hz, 2H), 7.28- 7.40 (m, 2H), 7.18 (m, 1H), 5.80 (s, 2H), 3.74 (s, 3H), 3.21 (m, 1H), 1.31 (dd, J = 7.2, 1.2 Hz, 6H).
11		I-1 and BB-3	LC-MS (Method A) (ESI+): m/z 505 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.35 (s, 1H), 8.39 (s, 1H), 7.67 (s, 1H), 7.60 (d, J = 8.4 Hz, 2H), 7.49 (d, J = 8.4 Hz, 2H), 7.36 (t, J = 8.1 Hz, 2H), 6.96 (d, J = 8.1 Hz, 1H), 6.70 (d, J = 8.1 Hz, 1H), 5.80 (s, 2H), 3.74 (s, 3H), 3.71 (s, 3H), 1.49 (m, 1H), 0.55-0.57 (d, J = 6.9 Hz, 4H).
12		I-1 and BB-4	LC-MS (Method A) (ESI+): m/z 507 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.64 (s, 1H), 8.41 (s, 1H), 7.68 (s, 1H), 7.61 (d, J = 8.1 Hz, 2H), 7.51 (d, J = 8.1 Hz, 2H), 5.80 (s, 2H), 3.91 (s, 3H), 3.74 (s, 3H), 1.68 (m, 1H), 1.12-1.19 (m, 2H), 0.85-0.92 (m, 2H).
13		I-16 and BB-4	LC-MS (Method B) (ESI+): m/z 507.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.71 (s, 1H), 8.49(s, 1H), 7.94 (s,1H), 7.70 (d, J = 7.8 Hz, 2H), 7.33 (d, J = 8.3 Hz, 2H), 5.69 (s, 2H), 3.86 (s, 3H), 3.82 (s, 3H), 1.60-1.69 (m, 1H), 1.03-1.09 (m, 2H), 0.85 (dd, J = 3.2, 7.6 Hz, 2H).
14		I-15 and BB-4	LC-MS (Method C) (ESI+): m/z 510.20 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.92 (s, 1H), 7.68 (d, J = 8.31 Hz, 2H), 7.41 (d, J = 8.31 Hz, 2H), 5.78 (s, 2H), 3.85 (s, 3H), 1.65 (td, J = 3.73, 7.70 Hz, 1H), 1.04-1.08 (m, 2H), 0.86 (dd, J = 2.93, 7.83 Hz, 2H).
15		I-1 and BB-20	LC-MS (Method B) (ESI+): m/z 521.20 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.48 (s, 1H), 8.89 (s, 1H), 8.53 (s, 1H), 7.92 (s, 1H), 7.68 (d, J = 8.31 Hz, 2H), 7.38 (d, J = 8.31 Hz, 2H), 5.77 (s, 2H), 3.86 (s, 3H), 3.74 (s, 3H), 3.35-3.40 (m, 1H), 2.24 (t, J = 9.54 Hz, 2H), 1.65-1.78 (m, 4H).
16		I-6 and BB-20	LC-MS (Method B) (ESI+): m/z 549.20 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.48 (s, 1H), 8.89 (s, 1H), 8.53 (s, 1H), 8.17 (s, 1H), 7.53 (d, J = 8.03 Hz, 2H), 7.39 (d, J = 8.03 Hz, 2H), 5.78 (s, 2H), 4.41 (td, J = 6.43, 12.99 Hz, 1H), 3.86 (s, 3H), 2.19-2.28 (m, 2H), 1.62-1.84 (m, 5H), 1.37 (d, J = 6.53 Hz, 6H).
17		I-8 and BB-4	LC-MS (Method B) (ESI+): m/z 525.05 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.42 (s, 1H), 8.61 (s, 1H), 8.44 (s, 1H), 7.89 (s, 1H), 7.46 (t, J = 7.6 Hz, 1H), 7.25 (d, J = 11.2 Hz, 1H), 7.14 (d, J = 7.8 Hz, 1H), 5.72 (s, 2H), 3.74 (s, 3H), 3.46 (s, 3H), 1.52-1.61 (m, 1H), 0.96 (s, 2H), 0.73-0.80 (m, 2H).
18		I-10 and BB-4	LC-MS (Method B) (ESI+): m/z 539.05 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.71 (s, 1H), 8.54 (s, 1H), 8.10 (s, 1H), 7.54 (t, J = 7.73 Hz, 1H), 7.35 (d, J = 10.97 Hz, 1H), 7.23 (d, J = 7.98 Hz, 1H), 5.82 (s, 2H), 3.86-3.88 (m, 1H), 3.85 (s, 3H), 3.81-3.84 (m, 1H), 1.63-1.71 (m, 1H), 1.24 (t, J = 7.23 Hz, 3H), 1.03-1.08 (m, 2H), 0.82-0.89 (m, 2H).
19		I-11 and BB-4	LC-MS (Method B) (ESI+): m/z 553.30 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.70-8.73 (m, 1H), 8.54 (s, 1H), 8.24 (s, 1H), 7.52 (t, J = 7.83 Hz, 1H), 7.35 (d, J = 10.76 Hz, 1H), 7.23 (d, J = 9.29 Hz, 1H), 5.82 (s, 2H), 4.09 (td, J = 6.54, 12.84 Hz, 1H), 3.85 (s, 3H), 1.62-1.70 (m, 1H), 1.33 (d, J = 6.36 Hz, 6H), 1.06 (td, J = 3.61, 6.97 Hz, 2H), 0.83- 0.88 (m, 2H).
20		I-9 and BB-4	LC-MS (Method C) (ESI+): m/z 525.05 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.72 (s, 1H), 8.51 (s, 1H), 7.96 (s, 1H), 7.52-7.61 (m, 2H), 7.42 (t, J = 7.8 Hz, 1H), 5.80 (s, 2H), 3.85 (s, 3H), 3.78 (s, 3H), 1.61-1.70 (m, 1H), 1.06 (s, 2H), 0.87 (dd, J = 3.2, 8.1 Hz, 2H).
21		I-1 and BB-6	LC-MS (Method A) (ESI+): m/z 495 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.33 (s, 1H), 8.22 (s, 1H), 7.57 (d, J = 8.1 Hz, 2H), 7.49 (d, J = 8.4 Hz, 2H), 7.26-7.35 (m, 3H), 7.12 (d, J = 5.1 Hz, 1H), 5.76 (s, 2H), 3.73 (s, 3H), 2.38 (s, 3H), 2.11 (s, 3H).
22		I-2 and	LC-MS (Method A) (ESI+): m/z 491 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 8.19 (s, 1H), 7.67 (d, J = 7.5 Hz, 1H), 7.58 (d, J = 8.1 Hz, 2H), 7.42- 7.52 (m, 4H), 7.27-7.35 (m, 2H), 5.73 (s, 2H), 3.72 (s, 3H), 3.49 (m, 1H), 2.87 (s, 3H), 1.25-1.28 (d, J = 6.9 Hz, 6H).
23		I-19 and	LC-MS (Method A) (ESI+): m/z 477 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.31 (s, 1H), 8.21 (s, 1H), 7.71 (d, J = 7.5 Hz, 1H), 7.50-7.70 (m, 4H), 7.42-7.49 (m, 2H), 7.30- 7.39 (m, 1H), 6.44 (s, 1H), 5.76 (s, 2H), 3.56 (m, 1H), 2.30 (s, 3H), 1.27 (d, J = 6.6 Hz, 6H).
24		I-24 and	LC-MS (Method A) (ESI+): m/z 491 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.28 (s, 1H), 8.21 (s, 1H), 7.70 (d, J = 7.5 Hz, 1H), 7.50-7.60 (m, 4H), 7.40-7.49 (m, 2H), 7.27- 7.35 (m, 2H), 6.35 (q, J = 7.2 Hz, 1H), 3.73 (s, 3H), 3.56 (m, 1H), 2.06-2.08 (d, J = 7.2 Hz, 3H), 1.29-1.31 (d, J = 6.6 Hz, 3H), 1.21-1.23 (d, J = 6.6 Hz, 3H).
25		I-4 and	LC-MS (Method A) (ESI+): m/z 491 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.21 (s, 1H), 7.69 (d, J = 7.2 Hz, 1H), 7.57 (d, J = 8.1 Hz, 2H), 7.42- 7.50 (m, 4H), 7.27-7.35 (m, 2H), 5.67 (s, 2H), 3.73 (s, 3H), 3.54 (m, 1H), 2.66 (s, 3H), 1.24-1.26 (d, J = 6.9 Hz, 6H).
26		I-19 and BB-1	LC-MS (Method A) (ESI+): m/z 478 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.41 (s, 1H), 8.62 (dd, J = 4.8, 1.8 Hz, 1H), 8.41 (s, 1H), 8.17 (d, J = 8.1 Hz, 1H), 7.45-7.53 (m, 4H), 7.41 (m, 1H), 6.56 (s, 1H), 5.84 (s, 2H), 3.66 (m, 1H), 2.31 (s, 3H), 1.27-1.29 (d, J = 6.9 Hz, 6H).
27		I-19 and BB-4	LC-MS (Method A) (ESI+): m/z 507 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.64 (s, 1H), 8.42 (s, 1H), 7.54 (d, J = 8.4 Hz, 2H), 7.46 (d, J = 8.4 Hz, 2H), 6.56 (s, 1H), 5.82 (s, 2H), 3.91 (s, 3H), 2.31 (s, 3H), 1.61 (m, 1H), 1.12-1.19 (m, 2H), 0.82- 0.91 (m, 2H).
28		I-22 and BB-4	LC-MS (Method A) (ESI+): m/z 537 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 8.61 (s, 1H), 8.22 (s, 1H), 7.40- 7.64 (m, 4H), 6.56 (s, 1H), 5.75 (s, 2H), 4.17 (s, 3H), 3.92 (s, 3H), 2.31 (s, 3H), 1.77 (m, 1H), 1.10-1.20 (m, 2H), 0.85-0.97 (m, 2H).
29		I-20 and BB-4	LC-MS (Method B) (ESI+): m/z 535.15 (M + H)+; 1H- NMR (400 MHz, DMSO- d6) δ 9.52 (s, 1H), 8.71 (s, 1H), 8.54 (s, 1H), 7.43-7.52 (m, 4H), 6.81 (s, 1H), 5.82 (s, 2H), 3.85 (s, 3H), 2.92 (td, J = 6.73, 13.46 Hz, 1H), 1.61-1.68 (m, 1H), 1.11 (d, J = 6.98 Hz, 6H), 1.03-1.07 (m, 2H), 0.85 (dd, J = 3.24, 7.73 Hz, 2H).
30		I-21 and B-4	LC-MS (Method B) (ESI+): m/z 559.30 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.71 (s, 1H), 8.53-8.55 (m, 1H), 7.75 (s, 1H), 7.41-7.49 (m, 4H), 7.26 (s, 1H), 6.53 (dd, J = 1.75, 3.24 Hz, 1H), 6.26 (d, J = 2.99 Hz, 1H), 5.82 (s, 2H), 3.84 (s, 3H), 1.60-1.68 (m, 1H), 1.02-1.07 (m, 2H), 0.82- 0.87 (m, 2H).
31		I-23 and BB-4	LC-MS (Method B) (ESI+): m/z 537.3 (M + H)+; 1H- NMR (300 MHz, DMSO- d6) δ 9.52 (s, 1H), 8.71 (s, 1H), 8.54 (s, 1H), 7.30-7.34 (m, 2H), 6.87 (d, J = 7.48 Hz, 1H), 6.66 (s, 1H), 5.80 (s, 2H), 3.84 (s, 3H), 3.74 (s, 3H), 2.06 (s, 3H), 1.62 (dt, J = 3.99, 7.73 Hz, 1H), 1.06 (d, J = 2.49 Hz, 2H), 0.84 (dd, J = 2.99, 7.48 Hz, 2H).
32		I-32 and BB-1	LC-MS (Method A) (ESI+): m/z 460 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.61 (dd, J = 4.8, 1.5 Hz, 1H), 8.40 (s, 1H), 8.14 (dd, J = 7.8, 1.5 Hz, 1H), 7.52 (d, J = 8.7 Hz, 2H), 7.46 (d, J = 8.7 Hz, 2H), 7.39 (m, 1H), 6.70 (t, J = 54.9 Hz, 1H), 6.45 (s, 1H), 5.83 (s, 2H), 3.64 (m, 1H), 2.30 (s, 3H), 1.26- 1.28 (d, J = 6.6 Hz, 6H).
33		I-1 and BB-5	LC-MS (Method A) (ESI+): m/z 481 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.74 (s, 1H), 8.42 (s, 1H), 7.68 (s, 1H), 7.65 (d, J = 8.7 Hz, 2H), 7.51 (d, J = 8.7 Hz, 2H), 5.80 (s, 2H), 3.95 (s, 3H), 3.74 (s, 3H), 2.29 (s, 3H).
34		I-17 and BB-4	LC-MS (Method B) (ESI+): m/z 535.15 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.72 (s, 1H), 8.50 (s, 1H), 8.25 (s, 1H), 7.75 (d, J = 8.48 Hz, 2H), 7.34 (d, J = 7.98 Hz, 2H), 5.69 (s, 2H), 4.56 (td, J = 6.48, 12.96 Hz, 1H), 3.86 (s, 3H), 1.62-1.69 (m, 1H), 1.48 (d, J = 6.48 Hz, 6H), 1.07 (td, J = 3.49, 6.98 Hz, 2H), 0.84-0.89 (m, 2H).
35		I-18 and BB-4	LC-MS (Method B) (ESI+): m/z 537.15 (M + H)+; 1H- NMR (400 MHz, DMSO- d6) δ 9.50 (s, 1H), 8.71 (s, 1H), 8.50 (s, 1H), 7.90 (d, J = 7.98 Hz, 1H), 7.85 (s, 1H), 7.11 (s, 1H), 6.86 (d, J = 7.98 Hz, 1H), 5.70 (s, 2H), 3.85 (br s, 3H), 3.84 (br. s, 6H), 1.61 (td, J = 3.62, 7.73 Hz, 1H), 1.02-1.07 (m, 2H), 0.83 (dd, J = 2.74, 7.23 Hz, 2H).
36		I-34 and BB-4	LC-MS (Method A) (ESI+): m/z 490 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.34 (s, 1H), 8.69 (s, 1H), 8.23 (s, 1H), 8.00 (d, J = 8.1 Hz, 2H), 7.48 (d, J = 8.1 Hz, 2H), 6.86 (t, J = 52.5 Hz, 1H), 5.75 (s, 2H), 4.08 (s, 3H), 3.94 (s, 3H), 1.68 (m, 1H), 1.21-1.25 (m, 2H), 0.85-0.93 (m, 2H).
37		I-39 and BB-4	LC-MS (Method A) (ESI+): m/z 523 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.39 (s, 1H), 8.64 (s, 1H), 8.41 (s, 1H), 7.63 (d, J = 8.4 Hz, 2H), 7.47 (d, J = 8.4 Hz, 2H), 6.20 (s, 1H), 5.78 (s, 2H), 3.99 (s, 3H), 3.91 (s, 3H), 1.63 (m, 1H), 1.13-1.17 (m, 2H), 0.86-0.90 (m, 2H).
38		I-50 and BB-4	LC-MS (Method A) (ESI+): m/z 539 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.64 (s, 1H), 8.43 (s, 1H), 7.53 (s, 4H), 6.77 (s, 1H), 5.82 (s, 2H), 3.91 (s, 3H), 2.46 (s, 1H), 1.65 (m, 1H), 1.11-1.19 (m, 2H), 0.84-0.93 (m, 2H).
39		I-1 and BB-16	LC-MS (Method B) (ESI+): m/z 520.20 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.48 (s, 1H), 8.65 (s, 1H), 8.49 (s, 1H), 7.89 (s, 1H), 7.64 (br d, J = 8.31 Hz, 2H), 7.37 (br d, J = 8.31 Hz, 2H), 5.76 (s, 2H), 4.32 (q, J = 7.01 Hz, 2H), 3.71 (s, 3H), 1.57- 1.65 (m, 1H), 1.10 (t, J = 6.85 Hz, 3H), 1.02 (s, 2H), 0.82 (dd, J = 3.18, 7.58 Hz, 2H).
40		I-1 and BB-26	LC-MS (Method C) (ESI+): m/z 535.15 (M + H)+; 1H- NMR (400 MHz, DMSO- d6) δ 9.51 (s, 1H), 8.67 (s, 1H), 8.52 (s, 1H), 7.92 (s, 1H), 7.66 (d, J = 8.31 Hz, 2H), 7.38 (d, J = 8.31 Hz, 2H), 5.79 (s, 2H), 5.30 (td, J = 6.30, 12.35 Hz, 1H), 3.74 (s, 3H), 1.60-1.68 (m, 1H), 1.12 (d, J = 5.87 Hz, 6H), 1.02-1.07 (m, 2H), 0.82-0.87 (m, 2H).
41		I-1 and BB-7	LC-MS (Method A) (ESI+): m/z 563 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.41 (s, 1H), 8.63 (s, 1H), 8.42 (s, 1H), 7.67 (s, 1H), 7.62 (d, J = 8.1 Hz, 2H), 7.49 (d, J = 8.1 Hz, 2H), 5.81 (s, 2H), 5.67 (m, 1H), 3.92 (m, 1H), 3.74 (s, 3H), 3.55-3.73 (m, 3 H), 2.18 (m, 1H), 1.92 (m, 1H), 1.66 (m, 1H), 1.12-1.21 (m, 2H), 0.85-0.95 (m, 2H).
42		I-1 and BB-8	LC-MS (Method A) (ESI+): m/z 551 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.33 (s, 1H), 8.66 (s, 1H), 8.24 (s, 1H), 7.59 (d, J = 8.4 Hz, 2H), 7.50 (d, J = 8.4 Hz, 2H), 7.30 (s, 1H), 5.76 (s, 2H), 4.54 (t, J = 4.8 Hz, 2H), 3.73 (s, 3H), 3.61 (t, J = 4.8 Hz, 2H), 3.23 (s, 3H), 1.70 (m, 1H), 1.22- 1.28 (m, 2H), 0.85-0.92 (m, 2H).
43		I-19 and BB-8	LC-MS (Method A) (ESI+): m/z 551 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.33 (s, 1H), 8.66 (s, 1H), 8.24 (s, 1H), 7.55 (d, J = 8.4 Hz, 2H), 7.41 (d, J = 8.4 Hz, 2H), 6.44 (s, 1H), 5.76 (s, 2H), 4.54 (t, J = 4.8 Hz, 2H), 3.61 (t, J = 4.8 Hz, 2H), 3.23 (s, 3H), 2.32 (s, 3H), 1.69 (m, 1H), 1.22-1.28 (m, 2H), 0.86-0.93 (m, 2H).
44		I-19 and BB-31	LC-MS (Method A) (ESI+): m/z 481 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.39 (s, 1H), 8.36 (s, 1H), 7.46- 7.54 (m, 4H), 7.44 (s, 1H), 6.56 (s, 1H), 5.82 (s, 2H), 5.48 (m, 1H), 2.35 (s, 3H), 2.30 (s, 3H), 1.46 (d, J = 6.6 Hz, 6H).
45		I-19 and BB-35	LC-MS (Method A) (ESI+): m/z 515 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.44 (s, 1H), 9.04 (s, 1H), 8.46 (s, 1H), 7.52 (d, J = 8.4 Hz, 2H), 7.46 (d, J = 8.4 Hz, 2H), 6.56 (s, 1H), 5.83 (s, 2H), 2.73 (m, 1H), 2.31 (s, 3H), 2.27 (s, 3H), 1.16 (d, J = 6.6 Hz, 6H).
46		I-19 and BB-9	LC-MS (Method A) (ESI+): m/z 497 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.43 (s, 1H), 8.88 (s, 1H), 8.44 (s, 1H), 7.56 (d, J = 8.4 Hz, 2H), 7.47 (d, J = 8.4 Hz, 2H), 6.57 (s, 1H), 5.83 (s, 2H), 2.52 (s, 3H), 2.31 (s, 3H), 2.30 (s, 3H).
47		I-19 and BB-10	LC-MS (Method A) (ESI+): m/z 525 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.72 (s, 1H), 8.42 (s, 1H), 7.54 (d, J = 8.4 Hz, 2H), 7.47 (d, J = 8.4 Hz, 2H), 6.56 (s, 1H), 5.82 (s, 2H), 4.53 (t, J = 4.5 Hz, 2H), 3.57 (t, J = 4.5 Hz, 2H), 3.16 (s, 3H), 2.31 (s, 3H), 2.29 (s, 3H).
48		I-19 and BB-5	LC-MS (Method A) (ESI+): m/z 481 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.33 (s, 1H), 8.77 (s, 1H), 8.25 (s, 1H), 7.53 (d, J = 8.7 Hz, 2H), 7.41 (d, J = 8.7 Hz, 2H), 6.44 (s, 1H), 5.76 (s, 2H), 3.96 (s, 3H), 2.34 (s, 3H), 2.32 (s, 3H).
49		I-19 and	LC-MS (Method A) (ESI+): m/z 461 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.34 (s, 1H), 8.93 (d, J = 8.1 Hz, 1H), 8.84 (t, J = 1.5 Hz, 1H), 8.25 (s, 1H), 7.68-7.72 (m, 3H), 7.41 (d, J = 8.4 Hz, 2H), 6.43 (s, 1H), 5.86 (s, 2H), 2.32 (s, 2H).
50		I-32 and BB-4	LC-MS (Method A) (ESI+): m/z 489 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.64 (s, 1H), 8.41 (s, 1H), 7.52 (d, J = 8.1 Hz, 2H), 7.44 (d, J = 8.1 Hz, 2H), 6.70 (t, J = 54.9 Hz, 1H), 6.45 (s, 1H), 5.81 (s, 2H), 3.91 (s, 3H), 2.30 (s, 3H), 1.67 (m, 1H), 1.22-1.28 (m, 2H), 0.86- 0.93 (m, 2H).
51		I-5 and BB-4	LC-MS (Method C) (ESI+): m/z 521.20 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 8.01 (s, 1H), 7.59 (d, J = 8.31 Hz, 2H), 7.41 (d, J = 7.83 Hz, 2H), 5.79 (s, 2H), 4.04 (q, J = 7.01 Hz, 2H), 3.85 (s, 3H), 1.61-1.69 (m, 1H), 1.29 (t, J = 7.34 Hz, 3H), 1.03-1.08 (m, 2H), 0.85 (dd, J = 3.18, 7.58 Hz, 2H).
52		I-22b and BB-4	LC-MS (Method A) (ESI+): m/z 551 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 8.61 (s, 1H), 8.22 (s, 1H), 7.54 (d, J = 8.4 Hz, 2H), 7.48 (d, J = 8.4 Hz, 2H), 5.74 (s, 1H), 4.19 (3, 3H), 4.04-4.11 (q, J = 7.5 Hz, 2H), 3.93 (s, 3H), 1.78 (m, 1H), 1.11-1.19 (m, 2H), 0.84-0.93 (m, 2H).
53		I-3 and BB-4	LC-MS (Method B) (ESI+): m/z 535.15 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 8.68 (s, 1H), 8.57 (s, 1H), 7.98 (s, 1H), 7.57 (d, J = 7.83 Hz, 2H), 7.38 (d, J = 7.82 Hz, 2H), 5.74 (s, 2H), 4.00-4.07 (m, 2H), 3.84 (s, 3H), 2.83 (s, 3H), 1.58-1.62 (m, 1H), 1.27 (t, J = 7.09 Hz, 3H), 1.01-1.06 (m, 2H), 0.84 (d, J = 4.40 Hz, 2H).
54		I-5 and BB-11	LC-MS (Method A) (ESI+): m/z 553 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.42 (s, 1H), 8.64 (s, 1H), 8.42 (s, 1H), 7.78 (s, 1H), 7.50-7.57 (m, 4H), 5.81 (s, 2H), 4.64 (s, 2H), 4.55 (m, 1H), 4.47 (m, 1H), 4.06 (q, J = 7.2 Hz, 2H), 1.68 (m, 1H), 1.34 (t, J = 7.2 Hz, 3H), 1.16-1.19 (m, 2H), 0.87-0.94 (m, 2H).
55		I-33 and BB-4	LC-MS (Method A) (ESI+): m/z 490 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.36 (s, 1H), 8.69 (s, 1H), 8.23 (s, 1H), 7.66 (d, J = 8.4 Hz, 2H), 7.56 (d, J = 8.4 Hz, 2H), 6.72 (t, J = 53.7 Hz, 1H), 5.79 (s, 2H), 4.00 (s, 3H), 3.94 (s, 3H), 1.68 (m, 1H), 1.21-1.24 (m, 2H), 0.85-0.93 (m, 2H).
56		I-36 and BB-4	LC-MS (Method A) (ESI+): m/z 509 (M + H)+; 1HNMR (300 MHz, CDCl3) δ 9.36 (s, 1H), 8.69 (s, 1H), 8.26 (s, 1H), 7.67 (d, J = 8.1 Hz, 2H), 7.57 (d, J = 8.1 Hz, 2H), 5.79 (s, 2H), 4.02 (s, 3H), 3.94 (s, 3H), 1.67 (m, 1H), 1.25-1.28 (m, 2H), 0.87-0.92 (m, 2H).
57		I-37 and BB-4	LC-MS (Method B) (ESI+): m/z 526.30 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.71 (s, 1H), 8.55 (s, 1H), 7.70 (t, J = 7.83 Hz, 1H), 7.42 (d, J = 10.76 Hz, 1H), 7.31 (d, J = 7.83 Hz, 1H), 5.85 (s, 2H), 3.87 (s, 3H), 3.85 (s, 3H), 1.63- 1.71 (m, 1H), 1.03-1.09 (m, 2H), 0.82-0.89 (m, 2H).
58		I-38 and BB-4	LC-MS (Method B) (ESI+): m/z 536.35 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 7.66 (d, J = 7.83 Hz, 2H), 7.49 (d, J = 7.83 Hz, 2H), 5.83 (s, 2H), 4.69 (td, J = 6.42, 13.08 Hz, 1H), 3.85 (s, 3H), 1.62-1.69 (m, 1H), 1.42 (d, J = 6.85 Hz, 6H), 1.03-1.08 (m, 2H), 0.85 (dd, J = 2.93, 7.34 Hz, 2H).
59		I-5 and BB-12	LC-MS (Method A) (ESI+): m/z 563 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.57 (s, 1H), 8.41 (s, 1H), 7.78 (s, 1H), 7.50-7.57 (m, 4H), 5.82 (s, 2H), 4.07 (q, J = 7.2 Hz, 2H), 1.56 (m, 1H), 1.46 (s, 9H), 1.42 (t, J = 7.2 Hz, 3H), 1.11-1.14 (m, 2H), 0.85-0.89 (m, 2H).
60		I-51 and BB-4	LC-MS (Method A) (ESI+): m/z 541 (M + H)+; 1H-NMR (300 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.72 (s, 1H), 8.51 (s, 1H), 7.84 (d, J = 8.1 Hz, 2H), 7.35 (d, J = 8.1 Hz, 2H), 5.73 (s, 2H), 4.07 (s, 3H), 3.85 (s, 3H), 3.59 (s, 3H), 1.64 (m, 1H), 1.01-1.06 (m, 2H), 0.82- 0.89 (m, 2H).
61		I-5 and BB-25	LC-MS (Method A) (ESI+): m/z 557 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.44 (s, 1H), 8.73 (s, 1H), 8.43 (s, 1H), 7.78 (s, 1H), 7.67 (t, J = 72.0 Hz, 1H), 7.43 (s, 4H), 5.82 (s, 2H), 4.06 (q, J = 7.2 Hz, 2H), 1.82 (m, 1H), 1.32 (t, J = 7.2 Hz, 3H), 1.22-1.26 (m, 2H), 0.95-1.02 (m, 2H).
62		I-6 and BB-25	LC-MS (Method C) (ESI+): m/z 570.95 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.72 (s, 1H), 8.52 (s, 1H), 8.16 (s, 1H), 7.64-7.94 (m, 1H), 7.52 (d, J = 7.98 Hz, 2H), 7.39 (d, J = 7.98 Hz, 2H), 5.79 (s, 2H), 4.42 (td, J = 6.54, 13.34 Hz, 1H), 1.56-1.64 (m, 1H), 1.37 (d, J = 6.48 Hz, 6H), 1.09 (d, J = 2.99 Hz, 2H), 0.88 (dd, J = 2.99, 7.48 Hz, 2H).
63		I-5 and BB-14	LC-MS (Method A) (ESI+): m/z 547 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.32 (s, 1H), 8.75 (s, 1H), 8.24 (s, 1H), 7.45-7.54 (m, 4H), 7.36 (s, 1H), 5.75 (s, 2H), 4.38 (m, 1H), 4.02 (q, J = 7.2 Hz, 2H), 1.70 (m, 1H), 1.38-1.44 (t, J = 7.2 Hz, 3H), 1.21-1.29 (m, 2H), 0.85-0.91 (m, 2H), 0.71-0.77 (m, 2H), 0.55-0.65 (m, 2H).
64		I-5 and BB-13	LC-MS (Method A) (ESI+): m/z 561 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.41 (s, 1H), 8.58 (s, 1H), 8.42 (s, 1H), 7.78 (s, 1H), 7.49-7.58 (m, 4H), 5.82 (s, 2H), 5.24 (m, 1H), 4.06 (q, J = 7.2 Hz, 2H), 2.32-2.38 (m, 2H), 1.90- 1.97 (m, 2H), 1.62-1.68 (m, 3H), 1.34 (t, J = 7.2 Hz, 3H), 1.11-1.16 (m, 2H), 0.84-0.92 (m, 2H).
65		I-39 and BB-5	LC-MS (Method A) (ESI+): m/z 497 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.39 (s, 1H), 8.74 (s, 1H), 8.41 (s, 1H), 7.64 (d, J = 8.7 Hz, 2H), 7.47 (d, J = 8.7 Hz, 2H), 6.20 (s, 1H), 5.77 (s, 2H), 3.99 (s, 3H), 3.95 (s, 3H), 2.28 (s, 3H).
66		I-44 and BB-5	LC-MS (Method A) (ESI+): m/z 511 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.36 (s, 1H), 8.73 (s, 1H), 8.42 (s, 1H), 7.62 (d, J = 8.7 Hz, 2H), 7.53 (d, J = 8.7 Hz, 2H), 6.32 (q, J = 6.9 Hz, 1H), 6.19 (s, 1H), 3.99 (s, 3H), 3.93 (s, 3H), 2.23 (s, 3H), 2.07 (d, J = 6.9 Hz, 3H).
67		I-5 and BB-15	LC-MS (Method A) (ESI+): m/z 524 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.64 (s, 1H), 8.42 (s, 1H), 7.78 (s, 1H), 7.50-7.58 (m, 4H), 5.81 (s, 2H), 4.07 (q, J = 7.5 Hz, 2H), 1.68 (m, 1H), 1.34 (t, J = 7.5 Hz, 3H), 1.13-1.19 (m, 2H), 0.91-0.94 (m, 2H).
68		I-5 and BB-32	LC-MS (Method A) (ESI+): m/z 507 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.29 (s, 1H), 8.21 (s 1H), 7.54 (d, J = 8.1 Hz, 2H), 7.44 (d, J = 8.1 Hz, 2H), 7.36 (s, 1H), 7.21 (s, 1H), 5.75 (s, 2H), 4.68 (q, J = 6.9 Hz, 2H), 4.03 (q, J = 6.9 Hz, 2H), 2.51 (m, 1H), 1.38-1.46 (m, 6H), 0.85- 0.94 (m, 2H), 0.61-0.65 (m, 2H).
69		I-53 and BB-4	LC-MS (Method A) (ESI+): m/z 464 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.36 (s, 1H), 8.69 (s, 1H), 8.25 (s, 1H), 7.57 (d, J = 8.4 Hz, 2H), 7.39 (d, J = 8.4 Hz, 2H), 6.58 (s, 1H), 5.78 (s, 2H), 3.94 (s, 3H), 2.32 (s, 3H), 1.67 (m, 1H), 1.23-1.28 (m, 2H), 0.87-0.97 (m, 2H).
70		I-45 and BB-4	LC-MS (Method A) (ESI+): m/z 480 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.34 (s, 1H), 8.69 (s, 1H), 8.23 (s, 1H), 7.63 (d, J = 8.4 Hz, 2H), 7.52 (d, J = 8.4 Hz, 2H), 6.04 (s, 1H), 5.75 (s, 2H), 3.96 (s, 3H), 3.94 (s, 3H), 1.65 (m, 1H), 1.20-1.29 (m, 2H), 0.81- 0.92 (m, 2H).
71		I-54 and BB-4	LC-MS (Method A) (ESI+): m/z 518 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.41 (s, 1H), 8.63 (s, 1H) 8.43 (s, 1H), 7.73 (d, J = 8.4 Hz, 2H), 7.61 (s, 1H), 7.60 (d, J = 8.4 Hz, 2H), 5.85 (s, 2H), 3.91 (s, 3H), 1.65 (m, 1H), 1.12- 1.18 (m, 2H), 0.85-0.92 (m, 2H).
72		I-57 and BB-4	LC-MS (Method C) (ESI+): m/z 492.15 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 8.23 (s, 1H), 7.44-7.51 (m, 4H), 5.81 (s, 2H), 4.23 (td, J = 6.42, 13.08 Hz, 1H), 3.85 (s, 3H), 1.61-1.69 (m, 1H), 1.37 (d, J = 6.36 Hz, 6H), 1.02-1.08 (m, 2H), 0.84 (d, J = 3.91 Hz, 2H).
73		I-58 and BB-4	LC-MS (Method C) (ESI+): m/z 512.35 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.71 (s, 1H), 8.54 (s, 1H), 8.19 (s, 1H), 7.40-7.49 (m, 4H), 5.81 (s, 2H), 3.91-3.99 (m, 1H), 3.85 (s, 3H), 1.63-1.70 (m, 1H), 1.34 (d, J = 6.98 Hz, 6H), 1.05 (td, J = 3.49, 6.98 Hz, 2H), 0.82-0.87 (m, 2H).
74		I-56 and BB-4	LC-MS (Method B) (ESI+): m/z 497.60 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.71 (s, 1H), 8.51 (s, 1H), 7.41-7.45 (m, 2H), 7.35-7.39 (m, 2H), 6.75 (s, 1H), 5.75 (s, 2H), 4.33- 4.39 (m, 2H), 3.85 (s, 3H), 3.68 (s, 3H), 1.32 (d, J = 6.85 Hz, 6H), 1.03-1.07 (m, 2H), 0.84 (dd, J = 3.18, 7.58 Hz, 2H).
75		I-7 and BB-4	LC-MS (Method A) (ESI+): m/z 522 (M + H)+; 1H-NMR (300 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.73 (s, 1H), 8.69 (d, J = 1.8 Hz, 1H), 8.53 (s, 1H), 8.08 (s, 1H), 8.06 (d, J = 8.4 Hz, 1H), 7.85 (dd, J = 8.4, 2.1 Hz, 1H), 5.83 (s, 2H), 4.57 (q, J = 7.2 Hz, 2H), 3.86 (s, 3H), 1.67 (m, 1H), 1.34 (t, J = 7.2 Hz, 3H), 1.02- 1.10 (m, 2H), 0.86-0.89 (m, 2H).
76		I-40 and BB-4	LC-MS (Method A) (ESI+): m/z 537 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.33 (s, 1H), 8.69 (s, 1H), 8.22 (s, 1H), 7.67 (d, J = 8.4Hz, 2H), 7.50 (d, J = 8.4 Hz, 2H), 5.90 (s, 1H), 5.74 (s, 2H), 4.19 (q, J = 7.2 Hz, 2H), 3.94 (s, 3H), 1.67 (m, 1H), 1.44 (t, J = 7.2 Hz, 3H), 1.20-1.28 (m, 2H), 0.82-0.91 (m, 2H).
77		I-41 and BB-4	LC-MS (Method A) (ESI+): m/z 567 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.33 (s, 1H), 8.69 (s, 1H), 8.23 (s, 1H), 7.68 (d, J = 8.7 Hz, 2H), 7.50 (d, J = 8.7 Hz, 2H), 5.94 (s, 1H), 5.73 (s, 2H), 4.26 (t, J = 4.5 Hz, 2H), 3.94 (s, 3H), 3.72 (t, J = 4.5 Hz, 2H), 3.38 (s, 3H), 1.65 (m, 1H), 1.24-1.26 (m, 2H), 0.87- 0.91 (m, 2H).
78		I-42 and BB-4	LC-MS (Method A) (ESI+): m/z 553 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.34 (s, 1H), 8.69 (s, 1H), 8.23 (s, 1H), 7.65 (d, J = 8.7 Hz, 2H), 7.51 (d, J = 8.7 Hz, 2H), 5.95 (s, 1H), 5.74 (s, 2H), 4.25 (t, J = 4.5 Hz, 2H), 3.97 (m, 2H), 3.94 (s, 3H), 1.78 (t, J = 6.0 Hz, 2H), 1.66 (m, 1H), 1.22- 1.26 (m, 2H), 0.87-0.91 (m, 2H).
79		I-43 and BB-4	LC-MS (Method A) (ESI+): m/z 524 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.64 (s, 1H), 8.58 (d, J = 1.5 Hz, 1H), 8.42 (s, 1H), 8.01 (dd, J = 8.4, 1.5 Hz, 1H), 7.71 (d, J = 8.4, 1H), 6.25 (s, 1H), 5.84 (s, 2H), 3.02 (s, 3H), 3.91 (s, 3H), 1.62 (m, 1H), 1.13- 1.17 (m, 2H), 0.86-0.95 (m, 2H).
80		I-59 and BB-33	LC-MS (Method A) (ESI+): m/z 481 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.34 (s, 1H), 8.35 (s, 1H), 7.85 (d, J = 8.4 Hz, 2H), 7.63 (s, 1H), 7.47 (d, J = 8.4 Hz, 2H), 7.42 (s, 1H), 5.79 (s, 2H), 4.18 (m, 1H), 3.88 (s, 3H), 0.91-0.97 (m, 2H), 0.72-0.81 (m, 2H).
81		I-1 and BB-33	LC-MS (Method A) (ESI+): m/z 495 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.35 (s, 1H), 8.35 (s, 1H), 7.67 (s, 1H), 7.60 (d, J = 8.1 Hz, 2H). 7.51 (d, J = 8.4 Hz, 2H), 7.43 (s, 1H), 5.82 (s, 2H), 4.25 (m, 1H), 3.88 (s, 3H), 3.73 (s, 3H), 0.95-1.01 (m, 2H), 0.72-0.85 (m, 2H).
82		I-5 and BB-33	LC-MS (Method A) (ESI+): m/z 509 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.33 (s, 1H), 8.19 (s, 1H), 7.53 (d, J = 8.7 Hz, 2H), 7.44 (d, J = 8.7 Hz, 2H), 7.36 (s, 1H), 7.35 (s, 1H), 5.75 (s, 2H), 4.32 (m, 1H), 4.03 (q, J = 7.8 Hz, 2H), 3.94 (s, 3H), 1.38-1.45 (t, J = 7.8 Hz, 3H), 1.09-1.15 (m, 2H), 0.81-0.88 (m, 2H).
83		I-6 and BB-33	LC-MS (Method A) (ESI+): m/z 523 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.34 (s, 1H), 8.35 (s, 1H) 7.89 (s, 1H), 7.51 (s, 4H), 7.42 (s, 1H), 5.83 (s, 2H), 4.47 (m, 1H), 4.23 (m, 1H), 3.88 (s, 3H), 1.41 (d, J = 6.9 Hz, 6H), 0.94-1.01 (m, 2H), 0.78-0.81 (m, 2H).
84		I-5 and BB-34	LC-MS (Method A) (ESI+): m/z 523 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.34 (s, 1H), 8.34 (s, 1H), 7.77 (s, 1H), 7.52-7.61 (m, 5H), 5.84 (s, 2H), 5.65 (m, 1H), 4.03- 4.12 (q, J = 7.2 Hz, 2H), 3.89 (s, 3H), 2.55-2.71 (m, 2H), 2.26-2.41 (m, 2H), 1.68-1.90 (m, 2H), 1.29-1.39 (t, J = 7.2 Hz, 3H).
85		I-52 and BB-4	LC-MS (Method A) (ESI+): m/z 508 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.39 (s, 1H), 8.64 (s, 1H), 8.41 (s, 1H), 8.01 (d, J = 8.1 Hz, 2H), 7.44 (d, J = 8.1 Hz, 2H), 5.77 (s, 2H), 4.10 (s, 3H), 3.92 (s, 3H), 1.64 (m, 1H), 1.10-1.18 (m, 2H), 0.81-0.88 (m, 2H).
86		I-1 and BB-29	LC-MS (Method B): (ESI+): m/z 497.15 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.45 (s, 1H), 8.65 (s, 1H), 8.49 (s, 1H), 7.92 (s, 1H), 7.69 (d, J = 7.82 Hz, 2H), 7.42 (d, J = 7.83 Hz, 2H), 5.75 (s, 2H), 3.88 (s, 6H), 3.75 (s, 3H).
87		I-5 and BB-29*	LC-MS (Method B) (ESI+): m/z 511.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.45 (s, 1H), 8.64 (s, 1H), 8.49 (s, 1H), 8.01 (s, 1H), 7.60 (d, J = 7.8 Hz, 2H), 7.42 (d, J = 7.8 Hz, 2H), 5.76 (s, 2H), 4.05 (q, J = 7.2 Hz, 2H), 3.87 (s, 6H), 1.29 (t, J = 7.1 Hz, 3H).
88		I-28 and BB-29	LC-MS (Method B) (ESI+): m/z 525.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.42 (s, 1H), 8.64 (s, 1H), 8.51 (s, 1H), 8.01 (s, 1H), 7.59 (d, J = 7.83 Hz, 2H), 7.49 (d, J = 7.83 Hz, 2H), 6.33 (q, J = 6.85 Hz, 1H), 4.04 (q, J = 7.17 Hz, 2H), 3.83-3.88 (m, 6H), 1.98 (d, J = 6.85 Hz, 3H), 1.29 (t, J = 7.34 Hz, 3H).
89		I-25 and BB-29	LC-MS (Method B) (ESI+): m/z 525.15 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.43 (s, 1H), 8.64 (s, 1H), 8.51 (s, 1H), 8.01 (s, 1H), 7.59 (d, J = 7.78 Hz, 2H), 7.49 (d, J = 8.03 Hz, 2H), 6.33 (q, J = 6.78 Hz, 1H), 4.04 (q, J = 7.11 Hz, 2H), 3.85 (s, 6H), 1.98 (d, J = 7.03 Hz, 3H), 1.29 (t, J = 7.28 Hz, 3H).
90		I-6 and BB-29	LC-MS (Method B) (ESI+): m/z 525.20 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.45 (s, 1H), 8.64 (s, 1H), 8.49 (s, 1H), 8.16 (s, 1H), 7.53 (d, J = 8.28 Hz, 2H), 7.43 (d, J = 8.28 Hz, 2H), 5.76 (s, 2H), 4.42 (td, J = 6.40, 13.30 Hz, 1H), 3.87 (s, 6H), 1.37 (d, J = 6.78 Hz, 6H).
91		I-5 and BB-27	LC-MS (Method C) (ESI+): m/z 539.10 (M + H)+; 1H- NMR (400 MHz, CDCl3) δ 9.49 (s, 1H), 8.55 (s, 1H), 8.39 (s, 1H), 7.49-7.60 (m, 4H), 7.37 (s, 1H), 5.79 (s, 2H), 4.46-4.57 (m, 4H), 3.99-4.09 (m, 2H), 1.35-1.45 (m, 3H), 1.32 (t, J = 7.0 Hz, 6H).
92*		I-24 and BB-4	LC-MS (Method B) (ESI+): m/z 521.10 (M + H; 1H- NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.71 (s, 1H), 8.54 (s, 1H), 7.91 (s, 1H), 7.67 (d, J = 8.37 Hz, 2H), 7.48 (d, J = 8.37 Hz, 2H), 6.31-6.39 (m, 1H), 3.83 (s, 3H), 3.74 (s, 3H), 1.99 (d, J = 6.89 Hz, 3H), 1.57-1.66 (m, 1H), 1.05 (s, 2H), 0.78- 0.88 (m, 2H).
93*		I-24 and BB-4	LC-MS (Method B) (ESI+); m/z 521.10 (M + H; 1H- NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.71 (s, 1H), 8.54 (s, 1H), 7.91 (s, 1H), 7.67 (d, J = 8.37 Hz, 2H), 7.48 (d, J = 8.37 Hz, 2H), 6.35 (q, J = 6.89 Hz, 1H), 3.83 (s, 3H), 3.74 (s, 3H), 1.99 (d, J = 6.89 Hz, 3H), 1.56-1.66 (m, 1H), 1.04 (d, J = 3.94 Hz, 2H), 0.77-0.88 (m, 2H).
94*		I-25 and BB-4	LC-MS (Method B) (ESI+): m/z 535.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.70 (s, 1H), 8.54 (s, 1H), 8.01 (s, 1H), 7.58 (d, J = 7.9 Hz, 2H), 7.48 (d, J = 8.3 Hz, 2H), 6.35 (q, J = 7.0 Hz, 1H), 4.04 (q, J = 7.3 Hz, 2H), 3.83 (s, 3H), 2.00 (d, J = 7.0 Hz, 3H), 1.57-1.65 (m, 1H), 1.29 (t, J = 7.2 Hz, 3H), 1.04 (d, J = 3.1 Hz, 2H), 0.82 (d, J = 7.5 Hz, 2H).
95*		I-25 and BB-4	LC-MS (Method B) (ESI+): m/z 535.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.70 (s, 1H), 8.54 (s, 1H), 8.01 (s, 1H), 7.58 (d, J = 7.8 Hz, 2H), 7.48 (d, J = 7.8 Hz, 2H), 6.35 (q, J = 6.7 Hz, 1H), 4.04 (q, J = 6.8 Hz, 2H), 3.83 (s, 3H), 1.99 (d, J = 6.8 Hz, 3H), 1.60 (d, J = 3.9 Hz, 1H), 1.29 (t, J = 7.1 Hz, 3H), 1.04 (s, 2H), 0.82 (d, J = 6.8 Hz, 2H).
96		I-27 and BB-4	LC-MS (Method C) (ESI+): m/z 553.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.71 (s, 1H), 8.56 (s, 1H), 8.09 (s, 1H), 7.52 (t, J = 7.83 Hz, 1H), 7.42 (d, J = 11.25 Hz, 1H), 7.29 (dd, J = 1.22, 8.07 Hz, 1H), 6.39 (q, J = 6.85 Hz, 1H), 3.84-3.87 (m, 2H), 3.83 (s, 3H), 1.99 (d, J = 7.34 Hz, 3H), 1.57-1.66 (m, 1H), 1.24 (t, J = 7.34 Hz, 3H), 1.03- 1.07 (m, 2H), 0.83 (d, J = 7.83 Hz, 2H).
97		I-29 and BB-4	LC-MS (Method C) (ESI+): m/z 549.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.71 (s, 1H), 8.54 (s, 1H), 8.16 (s, 1H), 7.46-7.55 (m, 4H), 6.36 (q, J = 6.98 Hz, 1H), 4.41 (td, J = 6.48, 12.96 Hz, 1H), 3.83 (s, 3H), 2.00 (d, J = 6.98 Hz, 3H), 1.58-1.65 (m, 1H), 1.37 (d, J = 6.48 Hz, 6H), 1.04 (d, J = 2.99 Hz, 2H), 0.76-0.87 (m, 2H).
98		I-30 and BB-4	LC-MS (Method C) (ESI+): m/z 548.94 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.71 (s, 1H), 8.54 (s, 1H), 8.16 (s, 1H), 7.47-7.54 (m, 4H), 6.36 (d, J = 6.98 Hz, 1H), 4.41 (td, J = 6.36, 13.22 Hz, 1H), 3.83 (s, 3H), 2.00 (d, J = 6.98 Hz, 3H), 1.61 (d, J = 3.99 Hz, 1H), 1.37 (d, J = 6.48 Hz, 6H), 1.04 (d, J = 3.49 Hz, 2H), 0.78-0.87 (m, 2H).
99*		I-25 and BB-20	LC-MS (Method C) (ESI+): m/z 549.14 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.46 (s, 1H), 8.88 (s, 1H), 8.55 (s, 1H), 8.01 (s, 1H), 7.59 (d, J = 8.3 Hz, 2H), 7.44 (d, J = 8.3 Hz, 2H), 6.31 (q, J = 6.5 Hz, 1H), 4.04 (q, J = 7.3 Hz, 2H), 3.85 (s, 3H), 3.24-3.28 (m, 1H), 2.13-2.27 (m, 2H), 2.00 (d, J = 7.3 Hz, 3H), 1.58-1.78 (m, 4H), 1.29 (t, J = 7.3 Hz, 3H).
100*		I-25 and BB-20	LC-MS (Method C) (ESI+): m/z 549.14 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.46 (s, 1H), 8.88 (s, 1H), 8.55 (s, 1H), 8.01 (s, 1H), 7.59 (d, J = 8.3 Hz, 2H), 7.44 (d, J = 8.3 Hz, 2H), 6.31 (q, J = 6.8 Hz, 1H), 4.04 (q, J = 7.3 Hz, 2H), 3.85 (s, 3H), 3.24 3.29 (m, 1H), 2.12-2.27 (m, 2H), 2.00 (d, J = 6.8 Hz, 3H), 1.58-1.77 (m, 4H), 1.29 (t, J = 7.3 Hz, 3H).
101		I-5 and BB-36	LC-MS (Method B) (ESI+): m/z 550.15 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.48 (s, 1H), 8.90 (s, 1H), 8.54 (s, 1H), 8.01 (s, 1H), 7.61 (d, J = 7.98 Hz, 2H), 7.40 (d, J = 7.98 Hz, 2H), 5.78 (s, 2H), 4.06 (q, J = 7.15 Hz, 2H), 3.88 (s, 3H), 3.51 (t, J = 7.98 Hz, 1H), 3.05-3.16 (m, 4H), 2.07 (s, 3H), 1.29 (t, J = 7.23 Hz, 3H).
102		I-1 and BB-17	LC-MS (Method C) (ESI+): m/z 583.05 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.53 (s, 1H), 8.70 (s, 1H), 8.52 (s, 1H), 7.91 (s, 1H), 7.62 (d, J = 8.3 Hz, 2H), 7.38 (d, J = 8.3 Hz, 2H), 7.20-7.26 (m, 5H), 5.79 (s, 2H), 5.44 (s, 2H), 3.71 (s, 3H), 1.65-1.72 (m, 1H), 1.07 (s, 2H), 0.88 (dd, J = 3.2, 7.6 Hz, 2H).
103		I-5 and BB-17	LC-MS (Method B) (ESI+): m/z 597.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.53 (s, 1H), 8.70 (s, 1H), 8.53 (s, 1H), 8.00 (s, 1H), 7.54 (d, J = 8.3 Hz, 2H), 7.38 (d, J = 7.8 Hz, 2H), 7.18-7.29 (m, 5H), 5.80 (s, 2H), 5.44 (s, 2H), 4.01 (q, J = 7.3 Hz, 2H), 1.64-1.74 (m, 1H), 1.26 (t, J = 7.1 Hz, 3H), 1.07 (s, 2H), 0.82-0.91 (m, 2H).
104		I-1 and BB-18	LCMS (Method B) (ESI+): m/z 521.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.80 (s, 1H), 8.54 (s, 1H), 7.91 (s, 1H), 7.66 (d, J = 7.8 Hz, 2H), 7.33 (d, J = 8.3 Hz, 2H), 5.79 (s, 2H), 3.85 (s, 3H), 3.73 (s, 3H), 1.05 (s, 3H), 0.65 (s, 2H), 0.28-0.33 (m, 2H)
105		I-19 and BB-18	LCMS (Method B) (ESI+): m/z 521.15 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.80 (s, 1H), 8.55 (s, 1H), 7.53 (d, J = 8.48 Hz, 2H), 7.37 (d, J = 8.48 Hz, 2H), 6.74 (s, 1H), 5.81 (s, 2H), 3.84 (s, 3H), 2.29 (s, 3H), 1.04 (s, 3H), 0.63-0.66 (m, 2H), 0.27-0.31 (m, 2H).
106		I-39 and BB-18	LCMS (Method B) (ESI+): m/z 537.05 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.80 (s, 1H), 8.53 (s, 1H), 7.58 (d, J = 8.48 Hz, 2H), 7.36 (d, J = 8.48 Hz, 2H), 6.45 (s, 1H), 5.76 (s, 2H), 3.96 (s, 3H), 3.84 (s, 3H), 1.04 (s, 3H), 0.62-0.67 (m, 2H), 0.27-0.33 (m, 2H).
107		I-6 and BB-18	LCMS (Method B) (ESI+): m/z 549.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.80 (s, 1H), 8.55 (s, 1H), 8.16 (s, 1H), 7.51 (d, J = 7.98 Hz, 2H), 7.33 (d, J = 7.98 Hz, 2H), 5.80 (s, 2H), 4.39 (td, J = 6.48, 12.96 Hz, 1H), 3.85 (s, 3H), 1.36 (d, J = 6.48 Hz, 6H), 1.04 (s, 3H), 0.61-0.66 (m, 2H), 0.27-0.31 (m, 2H).
108		I-6 and BB-19	LCMS (Method B) (ESI+): m/z 563.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.77 (s, 1H), 8.54 (s, 1H), 8.16 (s, 1H), 7.52 (d, J = 7.83 Hz, 2H), 7.37-7.42 (m, 2H), 4.40 (td, J = 6.24, 12.96 Hz, 2H), 3.87 (s, 3H), 1.47-1.52 (m, 2H), 1.42-1.46 (m, 1H), 1.37 (d, J = 6.36 Hz, 6H), 0.86 (s, 3H), 0.69-0.74 (m, 1H), 0.64 (s, 3H).
109		I-1 and BB-21	LC-MS (Method B) (ESI+): m/z 523.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.47 (s, 1H), 8.85 (s, 1H), 8.53 (s, 1H), 7.92 (s, 1H), 7.65 (d, J = 7.8 Hz, 2H), 7.33 (d, J = 7.8 Hz, 2H), 5.55-5.89 (m, 2H), 3.80 (s, 3H), 3.73 (s, 3H), 0.99 (s, 9H).
110		I-1 and BB-23	LC-MS (Method B) (ESI+): m/z 527.15 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.41 (s, 1H), 8.90 (s, 1H), 8.48 (s, 1H), 7.92 (s, 1H), 7.66 (d, J = 7.8 Hz, 2H), 7.36 (d, J = 8.3 Hz, 2H), 5.65-5.84 (m, 2H), 3.87 (s, 3H), 3.74 (s, 3H), 1.56-1.68 (m, 6H).
111		I-1 and BB-24	LC-MS (Method B) (ESI+): m/z 511.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.46 (s, 1H), 8.49 (s, 1H), 7.92 (s, 1H), 7.68 (d, J = 7.9 Hz, 2H), 7.42 (d, J = 7.9 Hz, 2H), 5.76 (s, 2H), 3.96 (s, 3H), 3.85 (s, 3H), 3.74 (s, 3H), 2.18 (s, 3H).
112		I-19 and BB-37	LC-MS (Method A) (ESI+): m/z 522 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.30 (s, 1H), 8.19 (s, 1H), 7.54 (d, J = 8.4 Hz, 2H), 7.38 (d, J = 8.4 Hz, 2H), 6.43 (s, 1H), 5.76 (s, 2H), 4.87 (s, 2H), 3.85 (s, 3H), 2.31 (s, 3H), 1.71 (m, 1H), 1.09-1.17 (m, 2H), 0.69-0.78 (m, 2H).
113		I-5 and BB-29	LC-MS (Method B) (ESI+): m/z 525.05 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.45 (s, 1H), 8.61 (s, 1H), 8.49 (s, 1H), 8.01 (s, 1H), 7.59 (d, J = 7.34 Hz, 2H), 7.41 (d, J = 7.83 Hz, 2H), 5.76 (s, 2H), 4.37 (q, J = 7.17 Hz, 2H), 4.04 (q, J = 7.01 Hz, 2H), 3.87 (s, 3H), 1.29 (t, J = 7.09 Hz, 3H), 1.14 (t, J = 7.09 Hz, 3H).
114		I-5 and BB-30	LC-MS (Method B) (ESI+): m/z 537.15 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.43 (s, 1H), 8.67 (s, 1H), 8.48 (s, 1H), 8.01 (s, 1H), 7.60 (d, J = 7.83 Hz, 2H), 7.39 (d, J = 8.31 Hz, 2H), 5.75 (s, 2H), 4.34-4.39 (m, 1H), 4.05 (q, J = 7.01 Hz, 2H), 3.88 (s, 3H), 1.30 (t, J = 7.34 Hz, 3H), 0.69 (q, J = 6.52 Hz, 2H), 0.45-0.50 (m, 2H).
115		I-19 and BB-22	LC-MS (Method B) (ESI+): m/z 509.70 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.86 (s, 1H), 8.54 (s, 1H), 7.35-7.46 (m, 4H), 6.92 (s, 1H), 5.79 (s, 2H), 3.85 (s, 3H), 2.59-2.69 (m, 1H), 2.26 (s, 3H), 1.07 (d, J = 6.36 Hz, 6H).
116		I-26 and BB-22	LC-MS (Method C) (ESI+): m/z 555.20 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.48 (s, 1H), 8.86 (s, 1H), 8.56 (s, 1H), 8.08 (s, 1H), 7.52 (t, J = 7.83 Hz, 1H), 7.38 (d, J = 11.25 Hz, 1H), 7.25 (d, J = 7.83 Hz, 1H), 6.35 (q, J = 6.85 Hz, 1H), 3.84 (s, 3H), 3.78-3.83 (m, 1H), 2.53-2.60 (m, 2H), 2.00 (d, J = 6.85 Hz, 3H), 1.24 (t, J = 7.34 Hz, 3H), 1.05 (t, J = 6.85 Hz, 6H).
117		I-28 and BB-22	LC-MS (Method B) (ESI+): m/z 537.18 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.47 (s, 1H), 8.86 (s, 1H), 8.54 (s, 1H), 8.00 (d, J = 1.00 Hz, 1H), 7.58 (d, J = 8.48 Hz, 2H), 7.43-7.47 (m, 2H), 6.28- 6.35 (m, 1H), 4.03 (q, J = 7.48 Hz, 2H), 3.84 (s, 3H), 2.58 (dd, J = 6.48, 13.46 Hz, 1H), 2.00 (d, J = 6.98 Hz, 3H), 1.28 (t, J = 7.23 Hz, 3H), 1.05 (t, J = 7.48 Hz, 6H).
118		1-27 and BB-22	LC-MS (Method B) (ESI+): m/z 555.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.48 (s, 1H), 8.86 (s, 1H), 8.56 (s, 1H), 8.08 (s, 1H), 7.52 (t, J = 7.58 Hz, 1H), 7.38 (d, J = 11.25 Hz, 1H), 7.25 (d, J = 7.83 Hz, 1H), 6.31-6.40 (m, 1H), 3.84 (s, 3H), 3.78-3.83 (m, 1H), 2.53-2.65 (m, 2H), 2.00 (d, J = 6.85 Hz, 3H), 1.24 (t, J = 7.09 Hz, 3H), 1.05 (t, J = 6.85 Hz, 6H).
119		I-6 and BB-22	LC-MS (Method B) (ESI+): m/z 537.15 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.86 (s, 1H), 8.53 (s, 1H), 8.16 (s, 1H), 7.52 (d, J = 8.03 Hz, 2H), 7.40 (d, J = 8.03 Hz, 2H), 5.78 (s, 2H), 4.41 (td, J = 6.56, 13.24 Hz, 1H), 3.86 (s, 3H), 2.65 (td, J = 6.49, 13.36 Hz, 1H), 1.37 (d, J = 6.53 Hz, 6H), 1.08 (d, J = 6.78 Hz, 6H).
120		I-46 and BB-4	LC-MS (Method C) (ESI+): m/z 522.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.72 (s, 1H), 8.51 (s, 1H), 7.45-7.53 (m, 4H), 5.88 (s, 2H), 5.77 (s, 2H), 3.86 (s, 3H), 2.65 (d, J = 4.99 Hz, 3H), 1.66 (td, J = 3.86, 8.23 Hz, 1H), 1.06 (d, J = 2.99 Hz, 2H), 0.88 (dd, J = 2.99, 7.48 Hz, 2H).
121		I-48 and BB-4	LC-MS (Method A) (ESI+): m/z 536 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.34 (s, 1H), 8.69 (s, 1H), 8.23 (s, 1H), 7.67 (d, J = 8.4 Hz, 2H), 7.50 (d, J = 8.4 Hz, 2H), 6.05 (s, 1H), 5.74 (s, 2H), 3.94 (s, 3H), 2.59 (s, 6H), 1.67 (m, 1H), 1.21-1.30 (m, 2H), 0.88- 0.92 (m, 2H).
122		I-47 and BB-4	LC-MS (Method C) (ESI+): m/z 554.05 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.71 (s, 1H), 8.55 (s, 1H), 7.60 (t, J = 7.98 Hz, 1H), 7.41 (dd, J = 1.25, 10.72 Hz, 1H), 7.21-7.26 (m, 1H), 6.35 (s, 1H), 5.83 (s, 2H), 3.84 (s, 3H), 2.48 (s, 6H), 1.62-1.69 (m, 1H), 1.05 (td, J = 3.49, 6.98 Hz, 2H), 0.82-0.89 (m, 2H).
123		I-49 and BB-4	LC-MS (Method B) (ESI+): m/z 518.35 (M + H)+; 1H- NMR (400 MHz, CD3OD) δ 9.40 (s, 1H), 8.64 (s, 1H), 8.41 (s, 1H), 7.64 (d, J = 7.98 Hz, 2H), 7.50 (d, J = 8.48 Hz, 2H), 6.46-6.76 (m, 1H), 6.11 (s, 1H), 5.79 (s, 2H), 3.92 (s, 3H), 2.57 (s, 6H), 1.62-1.71 (m, 1H), 1.13- 1.18 (m, 2H), 0.86-0.92 (m, 2H).
125		I-60 and BB-4	LC-MS (Method B) (ESI+): m/z 524.30 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.65 (d, J = 7.83 Hz, 2H), 7.42 (d, J = 7.83 Hz, 2H), 5.77 (s, 2H), 3.85 (s, 3H), 2.62 (s, 3H), 1.61-1.69 (m, 1H), 1.03- 1.08 (m, 2H), 0.82-0.88 (m, 2H).
126		I-61 and BB-4	LC-MS (Method B) (ESI+): m/z 510.65 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.71 (s, 1H), 8.56 (s, 1H), 8.51 (s, 1H), 7.94 (d, J = 7.98 Hz, 2H), 7.41 (d, J = 7.98 Hz, 2H), 5.75 (s, 2H), 3.85 (s, 3H), 1.60-1.68 (m, 1H), 1.03-1.08 (m, 2H), 0.82-0.88 (m, 2H).
127		I-62 and BB-4	LC-MS (Method B) (ESI+): m/z 508.10 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.71 (s, 1H), 8.51 (s, 1H), 7.65 (d, J = 8.31 Hz, 2H), 7.41 (d, J = 7.82 Hz, 2H), 5.75 (s, 2H), 3.85 (s, 3H), 2.61 (s, 3H), 1.61-1.68 (m, 1H), 1.03-1.08 (m, 2H), 0.82-0.88 (m, 2H).
128		I-12 and BB-4	LC-MS (Method B) (ESI+): m/z 551.10 (M + H)+; 1H- NMR(400 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 7.97 (s, 1H), 7.28 (d, J = 7.48 Hz, 1H), 7.20 (s, 1H), 6.85 (d, J = 7.98 Hz, 1H), 5.78 (s, 2H), 3.84 (s, 3H), 3.74-3.75 (m, 3H), 3.68- 3.73 (m, 2H), 1.59-1.67 (m, 1H), 1.20 (t, J = 7.23 Hz, 3H), 1.03-1.08 (m, 2H), 0.84 (dd, J = 2.99, 7.48 Hz, 2H).
129		I-13 and BB-4	LC-MS (Method B) (ESI+): m/z 569.30 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 7.94 (s, 1H), 7.29 (d, J = 7.82 Hz, 1H), 7.21 (s, 1H), 6.86 (d, J = 7.34 Hz, 1H), 5.78 (s, 2H), 4.63 (t, J = 4.65 Hz, 1H), 4.51 (t, J = 4.40 Hz, 1H), 4.11 (t, J = 4.40 Hz, 1H), 4.04 (t, J = 4.40 Hz, 1H), 3.84 (s, 3H), 3.74 (s, 3H), 1.59-1.67 (m, 1H), 1.06 (d, J = 2.45 Hz, 2H), 0.85 (dd, J = 2.93, 7.83 Hz, 2H).
130		I-14 and BB-4	LC-MS (Method C) (ESI+): m/z 565.05 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 8.11 (s, 1H), 7.27 (d, J = 7.83 Hz, 1H), 7.20 (s, 1H), 6.85 (d, J = 7.34 Hz, 1H), 5.78 (s, 2H), 3.92- 4.00 (m, 1H), 3.84 (s, 3H), 3.73 (s, 3H), 1.59-1.66 (m, 1H), 1.29 (d, J = 6.85 Hz, 6H), 1.02-1.07 (m, 2H), 0.81-0.87 (m, 2H).
131		I-63 and BB-4	LC-MS (Method C) (ESI+): m/z 507.05 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.70 (s, 1H), 8.52 (s, 1H), 7.82 (d, J = 7.98 Hz, 2H), 7.44-7.49 (m, 3H), 7.25 (dt, J = 4.74, 8.10 Hz, 1H), 7.04 (dd, J = 8.23, 10.72 Hz, 1H), 5.81 (s, 2H), 3.85 (s, 3H), 3.84 (s, 3H), 1.62-1.70 (m, 1H), 1.02-1.08 (m, 2H), 0.81-0.89 (m, 2H).
132		I-64 and BB-4	LC-MS (Method B) (ESI+): m/z 505.15 (M + H)+; 1H- NMR (400 MHz, DMSO-d6) δ 9.44 (br s, 1H), 9.14-9.17 (m, 1H), 8.63 (br s, 1H), 8.47 (br s, 1H), 8.28 (d, J = 7.48 Hz, 2H), 7.84 (br s, 1H), 7.41 (d, J = 6.48 Hz, 2H), 5.75 (br. s, 2H), 3.80 (br. s, 3H), 1.52- 1.59 (m, 1H), 0.96-1.02 (m, 2H), 0.76-0.83 (m, 2H).
*Stereochemistry of discrete enantiomers arbitrarily assigned after chiral SFC separation of racemate.

Example 133: Synthesis of 6-(4-Cyclopropyl-6-methoxy-2-methylpyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (133)

Step 1: Synthesis of 5-Bromo-6-cyclopropyl-2-methylpyrimidin-4-ol

A solution of 6-cyclopropyl-2-methylpyrimidin-4-ol (2.0 g, 13.33 mmol) in DCM (50 mL) cooled to 0° C., was treated dropwise with bromine (0.75 mL, 14.66 mmol). The resulting mixture was stirred at 0° C. for 4 h. After completion of reaction (monitored by TLC), the reaction mixture was quenched with saturated sodium thiosulphate solution (50 mL). The aqueous layer was extracted with 10% methanol in DCM (3×50 mL). The combined organic layer was dried over anhydrous Na₂SO₄, filtered, and concentrated under reduced pressure resulting in the crude compound. The crude compound was purified by silica gel chromatography (0-10% methanol in DCM) to afford 1.50 g of the title compound. LC-MS (Method B) (ESI+): m/z 230.90 (M+H)⁺; ¹H-NMR (400 MHz DMSO-d₆) δ 12.62 (br. s, 1H), 2.31 (td, J=6.17, 12.59 Hz, 1H), 2.20 (s, 3H), 0.96-1.02 (m, 4H).

Step 2: Synthesis of 5-Bromo-4-chloro-6-cyclopropyl-2-methylpyrimidine

A solution of 5-bromo-6-cyclopropyl-2-methylpyrimidin-4-ol (1.5 g, 6.550 mmol) in POCl₃ (20 mL) was heated at 90° C. for 2 h. After completion of the reaction (monitored by TLC), the reaction mixture was quenched with ice and extracted with EA (3×50 mL). The combined organic layer was dried over anhydrous Na₂SO₄, filtered, and concentrated under vacuum. The crude compound was purified by column chromatography (silica gel; 0-20% EA in n-hexane) to afford 1.20 g of the title compound. LC-MS (Method B) (ESI+): m/z 248.95 (M+H)⁺.

Step 3: Synthesis of 5-Bromo-4-cyclopropyl-6-methoxy-2-methylpyrimidine

To an ice-cold solution of 5-bromo-4-chloro-6-cyclopropyl-2-methylpyrimidine (1.1 g, 4.453 mmol) in methanol (20 mL), was added 2 M sodium methoxide solution (20 mL). The reaction mixture was stirred at 0° C. for 2 h. After completion of reaction (monitored by TLC), the reaction mixture was quenched with ice cold water (50 mL) and EA (50 mL). The organic layer was separated, dried over anhydrous Na₂SO₄, filtered, and concentrated under vacuum. The crude compound was purified by column chromatography (silica gel; 0-10% EA in n-hexane) to afford 0.90 g the title compound. LC-MS (Method B) (ESI+): m/z 242.95 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 4.00 (s, 3H), 2.47-2.51 (m, 1H), 2.46 (s, 3H), 1.12-1.17 (m, 2H), 1.00-1.05 (m, 2H).

Step 4: Synthesis of 6-(4-Cyclopropyl-6-methoxy-2-methylpyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (133)

Step 1

To a 30 mL microwave vial, was added 5-bromo-4-cyclopropyl-6-methoxy-2-methylpyrimidine (0.100 g, 0.411 mmol), bispinacolatodiboron (0.104 g, 0.411 mmol), KOAc (0.040 g, 0.41 mmol) and Toluene:DME:EtOH:H₂O (32:2:1, 6 mL). The mixture was purged with argon for 20 min, whereupon PdCl₂(dppf) (0.030 g, 0.041 mmol) was added. The reaction mixture was then heated in a microwave at 90° C. for 20 min. After completion of the reaction (monitored by TLC), the mixture was used without work-up in Step 3.

Step 2

To another 30 mL microwave vial, was added 6-chloro-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (0.160 g, 0.408 mmol), bispinacolatodiborane (0.103 g, 0.408 mmol), and KOAc (0.119 g, 1.224 mmol) in 1,4 dioxane (6 mL). The resulting mixture was purged with argon for 20 min, whereupon Pd(amphos)Cl₂ (0.028 g, 0.040 mmol) was added. The reaction mixture was then heated in a microwave at 90° C. for 20 min. After completion of the reaction (monitored by TLC), the reaction mixture was used without work up in Step 3.

Step 3

Both the reaction mixtures from Step 1 and Step 2 were combined, and 2M aqueous Na₂CO₃ (4 mL) was added at room temperature. The resulting reaction mixture was heated in a microwave at 120° C. for 30 min. After completion of the reaction (monitored by TLC), the mixture was diluted with water (50 mL) and extracted with EA (3×30 mL). The combined organic layer was dried over anhydrous Na₂SO₄, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography (0-10% methanol in DCM) to afford 0.025 g of the title compound. LC-MS (Method B) (ESI+); m/z 521.10 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.48 (s, 1H), 8.50 (s, 1H), 7.91 (s, 1H), 7.67 (d, J=8.31 Hz, 2H), 7.41 (d, J=8.31 Hz, 2H), 5.76 (s, 2H), 3.82 (s, 3H), 3.74 (s, 3H), 2.50 (br. s, 3H, OCH₃ protons merged in residual solvent peak), 1.59-1.67 (m, 1H), 1.00-1.05 (m, 2H), 0.81 (dd, J=3.18, 7.58 Hz, 2H).

Example 134: Synthesis of 6-(4-Cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (134)

Step 1: Synthesis of 6-(4-Cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(trifluoromethyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine

To a stirred solution of 6-chloro-1-(4-(4-(trifluoromethyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine I-59 (0.50 g, 0.98 mmol) and (4-cyclopropyl-6-methoxypyrimidin-5-yl)boronic acid (BB-4) (0.25 g, 1.27 mmol) in dioxane:H₂O (5:1, 12 mL), was added Cs₂CO₃ (0.801 g, 2.46 mmol). The reaction mixture was degassed with argon for 10 man followed by addition of Pd(PPh₃)₄ (0.113 g, 0.09 mmol). The reaction mixture was degassed with argon for 5 min and heated to 90° C. for 12 h. Progress of the reaction was monitored by TLC and LCMS. After completion, the reaction mixture was diluted with water (100 mL) and extracted with EA (2×200 mL). The combined organic layer was washed with brine (200 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-30% EA in hexane to afford 0.41 g of the title compound. LC-MS (Method B) (ESI+): m/z 623.25 (M+H)⁺.

Step 2: Synthesis of 6-(4-Cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (134)

To a stirred solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(trifluoromethyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (0.07 g, 0.11 mmol) in DCM (5 mL) at 0° C., was slowly added TFA (2 mL), and the reaction mixture was stirred at room temperature for 4 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. To the residue, water was added, adjusted to pH=7 using NaHCO₃ solution, and extracted with EA. The organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-40% EA in hexane to afford 0.025 g of the title compound. LC-MS (Method C) (ESI+): m/z 493.05 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 13.17 (s, 1H), 9.50 (s, 1H), 8.71 (s, 1H), 8.51 (s, 1H), 7.88-7.94 (m, 3H), 7.40 (d, J=7.8 Hz, 2H), 5.74 (s, 2H), 3.86 (s, 3H), 1.66 (s, 1H), 1.06 (s, 2H), 0.86 (d, J=3.9 Hz, 2H).

Example 135: Synthesis of 6-(4-(azetidin-3-yl)-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (135)

Step 1: Synthesis of tert-butyl 3-(5-bromo-6-methoxypyrimidin-4-yl)azetidine-1-carboxylate

To a stirred solution of tert-butyl 3-(6-methoxypyrimidin-4-yl)azetidine-1-carboxylate (10.0 g, 37.7 mmol) in ethanol (200 mL) was added bromine (9.0 g, 57 mmol) at 0° C. The resulting mixture was then allowed to warm to rt and stirred for 16 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The resulting residue was dissolved in aqueous ammonia solution (30 mL) and extracted with EA (200 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-50°/o EA in n hexane to afford title compound (10.0 g). LC-MS (Method C) (ESI+): m/z 289.90 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.77 (s, 1H), 4.15-4.21 (m, 3H), 4.05-4.10 (m, 2H), 4.01 (5, 3H), 1.38 (s, 9H).

Step 2: Synthesis of tert-butyl 3-(6-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-4-yl)azetidine-1-carboxylate

To a stirred solution of tert-butyl 3-(5-bromo-6-methoxypyrimidin-4-yl)azetidine-1-carboxylate 2 (5.0 g, 14.5 mmol) and B₂Pin₂ (11.1 g, 43.6 mmol) in dioxane (50 mL) was added and KOAc (4.26 g, 43.6 mmol) and the reaction mixture was degassed with argon gas for 15 min. To the resulting reaction mixture was added Pd(dppf)Cl₂-DCM (2.36 g, 2.90 mmol) and then the mixture was heated in sealed tube at 80° C. for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with EA (100 mL) and filtered through a pad of Celite. The filtrate was concentrated under reduced pressure and the crude residue was purified by silica gel chromatography using 10-30% EA in n hexane to afford the title compound (3.9 g). LC-MS (Method C) (ESI+): m/z 392.10 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.93 (s, 1H), 4.05-4.15 (m, 3H), 3.90-3.94 (m, 2H), 3.89 (s, 3H), 1.38 (s, 9H), 1.16 (s, 12H).

Step 3: Synthesis of tert-butyl 3-(5-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)-6-methoxypyrimidin-4-yl)azetidine-1-carboxylate

To a stirred solution of tert-butyl 3-(6-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-pyrimidin-4-yl)azetidine-1-carboxylate 3 (1.0 g, 2.6 mmol) in dioxane (20 mL) and water (10 mL) was added 1-5 (1.03 g, 2.6 mmol) and potassium phosphate (0.811 g, 3.83 mmol)) at room temperature. The resulting reaction mixture was degassed with argon gas for 30 men, and then treated with X-Phos-Pd-G2 (0.200 g, 0.255 mmol) and X-Phos (0.243 g, 0.511 mmol) at room temperature. The reaction mixture was then heated in sealed tube at 90° C. for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with water (20 mL) and extracted with EA (100 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-100% EA in n hexane to afford title compound (0.714 g). LC-MS (Condition 03) (ESI+): m/z 636.12 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.49 (s, 1H), 8.97 (s, 1H), 8.54 (s, 1H), 8.01 (s, 1H), 7.61 (d, J=7.83 Hz, 2H), 7.41 (d, J=7.83 Hz, 2H), 5.77 (s, 2H), 4.04 (q, J=7.34 Hz, 3H), 3.90 (s, 3H), 3.74-3.87 (m, 3H), 3.61-3.71 (m, 2H), 1.31 (s, 9H), 1.24-1.29 (m, 2H).

Step 5: Synthesis of 6-(4-(azetidin-3-yl)-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (135)

To a stirred solution of tert-butyl 3-(5-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)-6-methoxypyrimidin-4-yl)azetidine-1-carboxylate 4 (0.250 g, 0.393 mmol) in DCM (20 mL) was added TFA (0.224 g, 1.97 mmol) at 0 T. The resulting solution was further stirred at room temperature for 4 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The remaining residue was dissolved in DCM (10 mL) and the pH was adjusted to 9 using aqueous ammonia solution (10 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-10% methanol in DCM to afford title compound (0.050 g). LC-MS (Method B) (ESI+): m/z 536.15 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.41 (br s, 1H), 8.94 (br s, 1H), 8.49 (br s, 1H), 7.88 (br s, 1H), 7.54 (d, J=7.82 Hz, 2H), 7.38 (d, J=7.34 Hz, 2H), 5.71 (br. s, 2H), 4.16-4.24 (m, 2H), 3.92-4.02 (m, 6H), 3.86 (br s, 3H), 1.23 (d, J=6.85 Hz, 3H).

Example 136: Synthesis of 6-(4-Cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(trifluoromethyl)-5,6,7,8-tetrahydroimidazo[1,5-a]pyrazin-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (136)

Step 1: Synthesis of tert-Butyl 1-(trifluoromethyl)-5,6-dihydroimidazo[1,5-a]pyrazine-7(8H)-carboxylate

To a stirred solution of 1-(trifluoromethyl)-5,6,7,8-tetrahydroimidazo[1,5-a]pyrazine (2.00 g, 10.40 mmol) in THF (20 mL) at 0° C., were added trimethyl amine (2.10 g, 20.80 mmol) followed by DMAP (0.12 g, 1.00 mmol), and the reaction mixture was stirred for 10 min. To the resulting reaction mixture, Boc₂O (3.42 g, 15.70 mmol) was added and the reaction mixture was stirred at room temperature for 15 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water and extracted with EA (3×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-30% EA in hexane followed by washing with n-pentane to afford 3.00 g of the title compound. LC-MS (Method B) (ESI+): m/z 292.05 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.82 (s, 1H), 4.66 (s, 2H), 4.09 (t, J=5.4 Hz, 2H), 3.73 (t, J=5.4 Hz, 2H), 1.43 (s, 9H).

Step 2: Synthesis of tert-Butyl 3-bromo-1-(trifluoromethyl)-5,6-dihydroimidazo[1,5-a]pyrazine-7(8H)-carboxylate

To a stirred solution of tert-butyl 1-(trifluoromethyl)-5,6-dihydroimidazo[1,5-a]pyrazine-7(8H)-carboxylate (3.00 g, 10.00 mmol) in MeCN (30 mL), was added NBS (2.10 g, 12.00 mmol) at room temperature, and the reaction mixture was heated to 60° C. for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water and extracted with EA (2×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 3.00 g of the crude title compound which was used without purification in subsequent reactions. ¹H-NMR (400 MHz, DMSO-d₆) δ 4.65 (s, 2H), 3.91-3.96 (m, 2H), 3.77 (t, J=5.4 HA, 2H), 2.56 (s, 1H), 1.43 (s, 9H).

Step 3: Synthesis of tert-Butyl 3-(4-formylphenyl)-1-(trifluoromethyl)-5,6-dihydroimidazo[1,5-a]pyrazine-7(8H)-carboxylate

A mixture of tert-butyl 3-bromo-1-(trifluoromethyl)-5,6-dihydroimidazo[1,5-a]pyrazine-7(8H)-carboxylate (3.00 g, 8.10 mmol), (4-formylphenyl)boronic acid (1.45 g, 9.70 mmol), and aq. 2M Cs₂CO₃ (5.28 g, 16.20 mmol) in dioxane (30 mL), was degassed with argon for 15 min. To the resulting reaction mixture, Pd(PPh₃)₄ (0.92 g, 0.81 mmol) was added, and the reaction mixture was heated to 100° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (50 mL) and extracted with EA (2×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-30% EA in hexane to afford 1.40 g of the title compound. LC-MS (Method B) (ESI+): m/z 396.00 (M+H)⁺; 1H-NMR (400 MHz, DMSO-d₆) δ 10.09 (s, 1H), 7.95-8.06 (m, 4H), 4.78 (s, 2H), 4.26 (d, J=4.4 Hz, 2H), 3.73 (s, 2H), 1.46 (s, 9H).

Step 4: Synthesis of tert-Butyl 3-(4-(hydroxymethyl)phenyl)-1-(trifluoromethyl)-5,6-dihydroimidazo[1,5-a]pyrazine-7(8H)-carboxylate

To a stirred solution of tert-butyl 3-(4-formylphenyl)-1-(trifluoromethyl)-5,6-dihydroimidazo[1,5-a]pyrazine-7(8H)-carboxylate (1.40 g, 3.50 mmol) in MeOH (20 mL) at 0° C., was added NaBH₄ (0.20 g, 5.30 mmol), and the reaction mixture was stirred at room temperature for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The residue obtained was quenched with water (20 mL) and extracted with DCM (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 1.20 g of the title compound, which was used in subsequent reactions without further purification. LC-MS (Method B) (ESI+): m/z 397.95 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.68 (d, J=8.0 Hz, 2H), 7.44 (d, J=8.0 Hz, 2H), 5.31 (t, J=5.5 Hz, 1H), 4.75 (s, 2H), 4.57 (d, J=5.5 Hz, 2H), 4.17 (t, J=5.0 Hz, 2H), 3.71 (d, J=4.5 Hz; 2H), 1.45 (s, 9H).

Step 5: Synthesis of tert-Butyl 3-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-(trifluoromethyl)-5,6-dihydroimidazo[1,5-a]pyrazine-7(8H)-carboxylate

To a stirred solution of tert-butyl 3-(4-(hydroxymethyl)phenyl)-1-(trifluoromethyl)-5,6-dihydroimidazo-[1,5-a]pyrazine-7(8H)-carboxylate (1.20 g, 3.02 mmol) and 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.41 g, 2.72 mmol) in THF (20 mL) at 0° C., was added polymer bound triphenyl phosphine (2.37 g, 9.06 mmol), and the reaction mixture was stirred for 25 min. To the resulting reaction mixture, diethyl azodicarboxylate (DEAD) (1.05 g, 6.04 mmol) was added, and the reaction mixture was stirred at room temperature for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was filtered through Celite, and the filtrate was concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-40% EA in hexane to afford 0.50 g of the title compound. LC-MS (Method B) (ESI+): m/z 534.10 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.32 (s, 1H), 8.52 (s, 1H), 7.69 (d, J=8.3 Hz, 2H), 7.38 (d, J=7.8 Hz, 2H), 5.72 (s, 2H), 4.74 (s, 2H), 4.15 (s, 2H), 3.68 (s, 2H), 1.44 (s, 9H).

Step 6: Synthesis of tert-Butyl 3-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-(trifluoromethyl)-5,6-dihydroimidazo[1,5-a]pyrazine-7(8H)-carboxylate

A mixture of tert-butyl 3-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-(trifluoromethyl)-5,6-dihydroimidazo[1,5-a]pyrazine-7(8H)-carboxylate (0.30 g, 0.50 mmol), (4-cyclopropyl-6-methoxypyrimidin-5-yl)boronic acid (0.11 g, 0.60 mmol), and 2M aq. K₃PO₄ solution (0.318 g, 1.50 mmol) in dioxane (5 mL), was degassed with argon for 5 min. To the resulting reaction mixture, was added PdCl₂(dppf) (0.04 g, 0.05 mmol), and the reaction mixture was heated to 100° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water and extracted with EA (2×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-60% EA in hexane to afford 0.20 g of the title compound. LC-MS (Method B) (ESI+): m/z 648.3 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.50 (s, 1H), 8.71 (s, 1H), 8.51 (s, 1H), 7.67 (d, J=7.8 Hz, 2H), 7.42 (d, J=7.8 Hz, 2H), 5.75-5.79 (m, 2H), 4.74 (s, 2H), 4.14 (s, 2H), 3.86 (s, 3H), 3.68 (s, 2H), 1.44 (s, 9H), 1.65 (s, 1H), 1.06 (s, 2H), 0.87 (d, J=4.4 Hz, 2H).

Step 7: Synthesis of 6-(4-Cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(trifluoromethyl)-5,6,7,8-tetrahydroimidazo[1,5-a]pyrazin-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (136)

To a stirred solution of tert-butyl 3-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-(trifluoromethyl)-5,6-dihydroimidazol[1,5-a]pyrazine-7(8H)-carboxy late (0.20 g, 0.40 mmol) in DCM (5 mL) at 0° C., was slowly added TFA (0.097 g, 0.80 mmol), and the reaction mixture was stirred at room temperature for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The residue thus obtained was dissolved in water, basified with 2N NaHCO₃ solution, and extracted with EA (2×10 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by prep-HPLC to afford 0.052 g of the title compound. LC-MS (Method B) (ESI+): m/z 548.10 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.50 (s, 1H), 8.71 (s, 1H), 8.51 (s, 1H), 7.66 (d, J=8.0 Hz, 2H), 7.40 (d, J=8.0 Hz, 2H), 5.76 (s, 2H), 4.03 (s, 2H), 3.98 (s, 2H), 3.85 (s, 3H), 2.94-2.99 (m, 2H), 1.61-1.69 (m, 1H), 1.06 (s, 2H), 0.85 (dd, J=3.0, 7.5 Hz, 2H).

General Procedures for the Synthesis of N-Alkylimidazoles by Functionalization of Example 134:

Example 134 can be Alkylated by Method a or Method B Below to Afford N-Functionalized Imidazoles

General Procedure:

Method-A: To an ice cooled solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (134) (1 eq) in DMF (5 mL) was added NaH (60% dispersion in mineral oil) (1.2 eq) portion wise, and the reaction mixture was stirred at same temperature for 10 min. To the resulting reaction mixture was added alkyl halides (1.20 eq) and stirring was continued at room temperature for 16 h. Progress of the reaction was monitored by TLC and LCMS. After completion, the reaction mixture was diluted with water (50 mL) and extracted with EA (2×200 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compounds were purified by prep HPLC to afford the title compounds.

Method-B:

To a stirred solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (134)(1 eq) in DMF (5 mL) were added Cs₂CO₃ (1 eq) and alkyl halide 1 (1 eq) sequentially. The reaction mixture was heated to 90° C. for 12 h. Progress of the reaction was monitored by TLC and LCMS. After completion, the reaction mixture was diluted with water (50 mL) and extracted with EA (2×100 mL). The combined organic layer was washed with cold water (3×50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compounds thus obtained were purified by prep HPLC to afford the title compounds.

Example	Structure	Method	Analytical data
137		A	LC-MS (Method C) (ESI+): m/z 539.10 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 8.02 (s, 1H), 7.58 (d, J = 7.8 Hz, 2H), 7.42 (d, J = 7.8 Hz, 2H), 5.78 (s, 2H), 4.77 (t, J = 4.6 Hz, 1H), 4.65 (t, J = 4.6 Hz, 1H), 4.39 (t, J = 4.6 Hz, 1H), 4.32 (t, J = 4.4 Hz, 1H), 3.85 (s, 3H), 1.62-1.69 (m, 1H), 1.06 (s, 2H), 0.86 (dd, J = 3.2, 7.6 Hz, 2H).
138		B	LC-MS (Method B) (ESI+): m/z 557.15 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.98 (s, 1H), 7.58 (d, J = 7.83 Hz, 2H), 7.43 (d, J = 8.31 Hz, 2H), 6.19-6.48 (m, 1H), 5.79 (s, 2H), 4.50-4.62 (m, 2H), 3.85 (s, 3H), 1.65 (dt, J = 4.16, 7.95 Hz, 1H), 1.03-1.10 (m, 2H), 0.81-0.89 (m, 2H).
139		B	LC-MS (Method A) (ESI+): m/z 526 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.64 (s, 1H), 8.41 (s, 1H), 7.77 (s, 1H), 7.51-7.58 (m, 4H), 5.81 (s, 2H), 3.92 (s, 3H), 1.66 (m, 1H), 1.10- 1.18 (m, 2H), 0.85-0.92 (m, 2H).
140		B	LC-MS (Method A) (ESI+): m/z 542 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.40 (s, 1H), 8.64 (s, 1H), 8.41 (s, 1H), 7.89 (s, 1H), 7.48-7.53 (m, 4H), 5.81 (s, 2H), 3.92 (s, 3H), 1.68 (m, 1H), 1.12- 1.30 (m, 2H), 0.85-0.92 (m, 2H).
141		A	LC-MS (Method B) (ESI+): m/z 553.20 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.71 (s, 1H), 8.54 (s, 1H), 8.01 (s, 1H), 7.55-7.60 (m, 2H), 7.49 (d, J = 8.31 Hz, 2H), 6.35 (q, J = 6.85 Hz, 1H), 4.77 (t, J = 4.40 Hz, 1H), 4.65 (t, J = 4.40 Hz, 1H), 4.38 (t, J = 4.16 Hz, 1H), 4.31 (t, J = 4.40 Hz, 1H), 3.83 (s, 3H), 1.99 (d, J = 7.34 Hz, 3H), 1.57-1.66 (m, 1H), 1.00- 1.06 (m, 2H), 0.83 (d, J = 6.36 Hz, 2H).
142		B	LC-MS (Method B) (ESI+): m/z 553.35 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.99 (s, 1H), 7.59 (d, J = 7.82 Hz, 2H), 7.42 (d, J = 8.31 Hz, 2H), 5.79 (s, 2H), 4.28-4.37 (m, 1H), 4.22-4.26 (m, 1H), 3.85 (s, 3H), 1.62-1.70 (m, 1H), 1.25 (d, J = 5.87 Hz, 2H), 1.19 (d, J = 6.36 Hz, 2H), 1.02-1.09 (m, 2H), 0.82-0.89 (m, 2H).
143		A	LC-MS (Method C) (ESI+): m/z 535.00 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.69 (s, 1H), 8.50 (s, 1H), 8.14 (s, 1H), 7.51 (d, J = 7.8 Hz, 2H), 7.40 (d, J = 7.8 Hz, 2H), 5.77 (s, 2H), 4.45-4.34 (m, 1H), 3.83 (s, 3H), 1.60-1.67 (m, 1H), 1.35 (d, J = 6.8 Hz, 6H), 1.04 (s, 2H), 0.83 (dd, J = 3.2, 7.6 Hz, 2H).
144		B	LC-MS (Method C) (ESI+): m/z 547.00 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 8.27 (s, 1H), 7.52 (d, J = 7.8 Hz, 2H), 7.41 (d, J = 7.8 Hz, 2H), 5.79 (s, 2H), 4.65-4.76 (m, 1H), 3.85 (s, 3H), 2.29-2.42 (m, 4H), 1.61-1.78 (m, 3H), 1.06 (s, 2H), 0.85 (dd, J = 2.9, 7.3 Hz, 2H).
145		B	LC-MS (Method C) (ESI+); m/z 548.95 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 8.47 (s, 1H), 7.47-7.50 (m, 2H), 7.39-7.44 (m, 2H), 5.79 (s, 2H), 5.43-5.51 (m, 1H), 4.81-4.86 (m, 2H), 4.75-4.80 (m, 2H), 3.86 (s, 3H), 1.62-1.70 (m, 1H), 1.07 (d, J = 3.0 Hz, 2H), 0.86 (dd, J = 3.0, 7.9 Hz, 2H).
146		B	LC-MS (Method C) (ESI+); m/z 563.15 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.45 (s, 1H), 8.64 (s, 1H), 8.47 (s, 1H), 7.76-7.82 (m, 1H), 7.50 (d, J = 7.83 Hz, 2H), 7.39 (d, J = 7.82 Hz, 2H), 5.74 (br. s, 2H), 4.80-4.85 (m, 1H), 3.81 (s, 3H), 3.65-3.76 (m, 3H), 2.32-2.44 (m, 2H), 1.98-2.07 (m, 1H), 1.55- 1.63 (m, 1H), 0.99-1.04 (m, 2H), 0.83 (d, J = 4.40 Hz, 2H).
147		B	LC-MS (Method B) (ESI+): m/z 578.10 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.72 (s, 1H), 8.51 (s, 1H), 7.80 (s, 1H), 7.48-7.52 (m, 2H), 7.41 (d, J = 7.8 Hz, 2H), 5.76 (s, 2H), 5.04 (s, 2H), 3.85 (s, 3H), 2.94 (s, 3H), 2.82 (s, 3H), 1.62-1.70 (m, 1H), 1.06 (s, 2H), 0.86 (dd, J = 3.2, 7.6 Hz, 2H).

Example 148: Synthesis of 2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-ethyl-1H-imidazole-4-carbonitrile (148)

Step 1: Synthesis of 1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-4-carbonitrile and 1-((2-(trimethyl silyl)ethoxy)methyl)-1H-imidazole-5-carbonitrile

To a suspension of 1H-imidazole-4-carbonitrile (1 g, 10.76 mmol) and potassium carbonate (2.96 g, 21.5 mmol) in acetone (20 mL) at 10° C., was added SEMCl (1.98 g, 11.8 mmol) dropwise over 30 min, while the internal temperature was kept below 15° C. The reaction was then allowed to warm to rt and stirred overnight. After the reaction was completed, the reaction was quenched by cold water (50 mL) and extracted with EA (50 mL×3). The combined organic layer was dried over sodium sulfate (30 g), filtered and concentrated. The concentrated residue was purified by silica gel chromatography (eluent: EA/n-Hex=1/4) to afford 1.3 g of a mixture of the title compound and its regioisomer 2a LC-MS (Method A) (ESI+): m/z 224 (M+H)⁺.

Step 2: Synthesis oft-bromo-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-4-carbonitrile

A solution of 1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-4-carbonitrile 2 and 1-((2-(trimethyl silyl)ethoxy)methyl)-1H-imidazole-5-carbonitrile 2a (1.30 g, 5.83 mmol) in CCl₄ (30 mL) at 60° C. was added NBS (1.14 g, 6.41 mmol) portion-wise over 5 min. An exothermic reaction was observed, and the internal temperature increased to 75° C. After addition, the reaction was stirred at 60° C. overnight. The reaction was allowed to cool to rt, and the resulting suspension was filtered. The filter cake was washed with CCl₄ (20 mL). The combined filtrate was washed with a saturated NaHCO₃ solution (60 mL). After separation, the organic layer was dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by silica gel chromatography (eluent: EA/n-Hex=1/10) to afford 800 mg of the title compound. LC-MS (Method A) (ESI+): m/z 324 (M+Na)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.63 (s, 1H), 5.30 (s, 2H), 3.55 (t, J=8.1 Hz, 2H), 0.93 (t, J=8.1 Hz, 2H), 0.05 (s, 9H).

Step 3: Synthesis of 4-(4-cyano-1-(2-(trimethylsilyl)ethoxy)methyl)-1H-imidazol-2-yl)benzyl acetate

To a solution of 2-bromo-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-4-carbonitrile 3 (800 mg, 2.48 mmol) in 1,4-dioxane/H₂O (20 mL, 20:1) was added 4-(acetoxymethyl)phenyl)boronic acid (568 mg, 2.93 mmol), K₃PO₄·3H₂O (2.12 g, 7.98 mmol), and Pd(PPh₃)₄ (307 mg, 0.27 mmol) in one portion. The reaction was then stirred at 110° C. overnight. The reaction was cooled to rt and quenched with water (50 mL). The resulting mixture was extracted with EA (50 mL×3). The organic layer was dried over sodium sulfate (100 g), filtered and concentrated. The residue was purified by silica gel chromatography (eluent: EA/n-Hex=1/3) to afford 650 mg of the title compound. LC-MS (Method A) (ESI+): m/z 372 (M+H)⁺; ¹H-NMR (300 MHz CDCl₃) δ 7.76 (d, J=8.1 Hz, 2H), 7.65 (s, 1H), 7.46 (d, J=8.1 Hz, 2H), 5.28 (s, 2H), 5.16 (s, 2H), 3.58 (t, J=8.4 Hz, 2H), 2.12 (s, 3H), 0.94 (t, J=8.4 Hz, 2H), 0.05 (s, 9H).

Step 4: Synthesis of 2-(4-(hydroxymethyl)phenyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-4-carbonitrile

To a solution of 4-(4-cyano-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazol-2-yl)benzyl acetate 5 (650 mg, 1.75 mmol) in 1:1 TI-IF/water (10 mL) was added LiOH H₂O (150 mg, 3.50 mmol) in one portion. The reaction was stirred at rt for 4 h. After the reaction was completed as indicated by TLC analysis, the reaction was adjusted to pH 8 with a dilute HCl solution and extracted with EA (50 mL×2). The combined organic layer was dried with sodium sulfate (30 g), filtered and concentrated to afford 690 mg of the crude title compound. LC-MS (Method A) (ESI+): m/z 330 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.75 (d, J=7.8 Hz, 2H), 7.65 (s, 1H), 7.49 (d, J=7.8 Hz, 2H), 5.28 (s, 2H), 4.78 (d, J=5.1 Hz, 2H), 3.57 (t, J=8.1 Hz; 2H), 1.80 (t, J=5.1 Hz, 1H), 0.94 (t, J=8.1 Hz, 2H), 0.05 (s, 9H).

Step 5: Synthesis of 2-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-4-carbonitrile

The compound was synthesized according to the procedure for the preparation of common intermediate 1-47. LC-MS (Method A) (ESI+): m/z 466 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.06 (s, 1H), 8.19 (s, 1H), 7.76 (d, J=8.4 Hz, 2H), 7.64 (s, 1H), 7.47 (d, J=8.4 Hz, 21H), 5.70 (s, 21H), 5.26 (s, 21H), 3.57 (t, J=8.1 Hz, 2H), 0.93 (t, J=8.1 Hz, 21-1), 0.05 (s, 9H).

Step 6: Synthesis of 2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-4-carbonitrile

The compound was synthesized according to the General Experimental Procedure 1. LC-MS (Method A) (ESI+): m/z 580 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.35 (s, 1H), 8.69 (s, 1H), 8.24 (s, 1H), 7.66-7.78 (m, 2H), 7.64 (s, 1H), 7.42-7.58 (m, 2H), 5.77 (s, 2H), 5.25 (s, 2H), 3.95 (s, 3H), 3.58 (t, J=8.4 Hz, 2H), 1.64-1.75 (m, 1H), 1.20-1.31 (m, 2H), 0.83-0.99 (m, 4H), 0.05 (s, 9H).

Step 7: Synthesis of 2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-ethyl-1H-imidazole-4-carbonitrile (148)

A solution of 2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)phenyl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-imidazole-4-carbonitrile 10 (400 mg, 0.69 mmol) in TFA (10 mL) was stirred at rt for 3 h. After the reaction was complete based on TLC analysis, the reaction was concentrated to dryness in vacuo. The residue was dissolved in EA (50 mL) and neutralized with a saturated sodium bicarbonate solution. After separation, the aqueous phase was extracted with EA (50 mL×2). The combined organic layer was dried, filtered and concentrated to give 400 mg of crude deprotected intermediate.

To a solution of the deprotected intermediate (180 mg, 0.40 mmol) in DMF (10 mL) was added cesium carbonate (156 mg, 0.48 mmol) and EtI (75 mg, 0.48 mmol). The reaction was stirred at 40° C. for 5 h. After the reaction was complete as indicated by TLC analysis, the reaction was quenched with water (30 mL) and extracted with EA (50 mL×3). The organic layer was washed with water (20 mL), dried with sodium sulfate (50 g), filtered and concentrated. The residue was purified by preparative HPLC (Method A) to afford 53 mg of the title compound. LC-MS (Method A) (ESI+): m/z 478 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 9.40 (s, 1H), 8.64 (s, 1H), 8.42 (s, 1H), 8.06 (s, 1H), 7.51-7.62 (m, 4H), 5.81 (s, 2H), 4.09 (q, J=7.2 Hz, 2H), 3.91 (s, 3H), 1.60-1.75 (m, 1H), 1.34 (t, J=7.2 Hz, 3H), 1.10-1.20 (m, 2H), 0.83-0.94 (m, 2H).

Example 149: Synthesis of 6-(2-Isopropylphenyl)-1-(4-(1-(1-methylazetidin-3-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (149)

Step 1: Synthesis of ethyl 2-(2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)propanoate

To a stirred solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (134) (0.320 g, 0.650 mmol) in DMF (10 mL), was added K₂CO₃ (0.224 g, 1.63 mmol) and ethyl 2-bromopropanoate 1 (0.141 g, 0.780 mmol) at room temperature. The reaction mixture was heated at 100° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and quenched with water (10 mL) and extracted with EA (3×5 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-10% MeOH in DCM to afford the title compound (0.240 g). LC-MS (Method C) (ESI+): m/z 593.1 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 8.15 (br s, 1H), 7.95 (s, 1H), 7.47-7.51 (m, 2H), 7.41-7.45 (m, 2H), 5.78 (s, 2H), 5.06-5.13 (m, 2H), 4.01-4.08 (m, 2H), 3.85 (s, 3H), 1.68 (d, J=6.98 Hz, 3H), 1.02-1.08 (m, 4H), 0.82-0.88 (m, 2H).

Step 2: Synthesis of 2-(2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)propan-1-ol (149)

To an ice cooled solution of ethyl 2-(2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)propanoate 2 (0.175 g, 0.2% mmol) in THF (3 mL), was added LAH (0.022 g, 0.59 mmol). The resulting mixture was then stirred for 5 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with EA (10 mL), filtered through a pad of Celite and washed with EA (5 mL). The filtrate was concentrated under reduced pressure to give the crude compound which was purified by prep HPLC (Method C) to afford the title compound (0.042 g). LC-MS (Method C) (ESI+): m/z 551.14 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.44 (s, 1H), 8.64 (s, 1H), 8.45-8.50 (m, 1H), 8.00 (lx s, 1H), 7.53 (d, J=7.98 Hz, 2H), 7.37 (d, J=7.48 Hz, 2H), 5.73 (br s, 2H), 4.28 (d, J=4.99 Hz, 1H), 3.81 (s, 3H), 3.51-3.62 (m, 3H), 1.54-1.63 (in 1H), 1.25 (d, J=6.48 Hz, 3H), 0.98-1.06 (m, 2H), 0.81-0.86 (m, 2H).

Example 150: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(1-methoxypropan-2-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (150)

To a stirred solution of 2-(2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]-pyrimidin-1-yl)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)propan-1-ol (149) (0.050 g, 0.090 mmol) in DMF (1.5 mL) at 0° C. was added NaH (0.005 g, 0.14 mmol), and the mixture was stirred for 30 mil. To the resulting reaction mixture was added MeI (0.011 mL, 0.19 mmol) and the reaction was further stirred at room temperature for 16 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with ice cold water (5 mL) and extracted with EA (4×5 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by preparative HPLC (Method E) to afford the title compound (0.025 g). LC-MS (Method C) (ESI+): m/z 565 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 8.15 (s, 1H), 7.55 (d, J=7.98 Hz, 2H), 7.42 (d, J=7.98 Hz, 2H), 5.78 (s, 2H), 4.45 (d, J=3.49 Hz, 1H), 3.85 (s, 3H), 3.57-3.64 (m, 1H), 3.50 (dd. J=4.24, 10.22 Hz, 1H), 3.11 (s, 3H), 1.66 (dt, J=3.99, 7.73 Hz, 1H), 1.33 (d, J=6.98 Hz, 3H), 1.03-1.08 (m, 211), 0.86 (dd, J=2.99, 7.48 Hz, 2H).

Example 151: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(1-fluoropropan-2-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (151)

To a stirred solution of 2-(2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]-pyrimidin-1-yl)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)propan-1-ol (149) (0.120 g, 0.2181 mmol) in DCE (10 mL) was added DAST (0.140 g, 0.872 mmol) at room temperature. The resulting mixture was stirred for 4 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (10 mL) and extracted with DCM (20 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-10% methanol in DCM to afford the title compound (0.090 g). LC-MS (Method B) (ESI+): m/z 553.20 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 8.22 (s, 1H), 7.50-7.54 (m, 2H), 7.44 (d, J=8.31 Hz, 2H), 5.79 (s, 2H), 4.54-4.72 (m, 3H), 3.85 (s, 3H), 1.62-1.71 (m, 1H), 1.38 (d, J=6.36 Hz, 3H), 1.03-1.09 On, 2H), 0.83-0.89 (m, 2H).

Example 152: Synthesis of 6-(2-Isopropylphenyl)-1-(4-(1-(1-methylazetidin-3-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (152)

Step 1: Synthesis of to n-Butyl 3-(2-(4-((6-(2-isopropylphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)azetidine-1-carboxylate

Under nitrogen atmosphere, a mixture of tert-butyl 3-(2-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)azetidine-1-carboxy late (I-31) (0.26 g, 0.49 mmol), K₃PO₄ (0.39 g, 1.47 mmol), (2-isopropylphenyl)boronic acid, and Pd(PPh₃)₄ (57 mg, 10 mol %) in dioxane (9 mL) and water (0.9 mL), was stirred at 90° C. for 3 hours. The mixture was then cooled to room temperature, diluted with water (10 mL), and extracted with EA (100 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (20 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (EA:n-Hex=1:10 to 1:4) to afford 280 mg of the title compound ¹H-NMR (300 MHz, CDCl₃) δ 9.31 (s, 1H), 8.21 (s, 1H), 7.73 (s, 1H), 7.64-7.71 (m, 3H), 7.52-7.56 (m, 2H), 7.42-7.50 (m, 3H), 5.76 (s, 2H), 5.01 (m, 1H), 4.35-4.40 (m, 2H), 4.05-4.13 (m, 2H), 3.56 (m, 1H), 1.45 (s, 9H), 1.26 (d, J=7.2 Hz, 6H).

Step 2: Synthesis of 1-(4-(1-(Azetidin-3-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(2-isopropylphenyl)-1H-pyrazolo[3,4-d]pyrimidine

To a solution of tert-butyl 3-(2-(44(6-(2-isopropylphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl) phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)azetidine-1-carboxylate (0.25 g, 0.41 mmol) in DCM (15 mL), was added TFA (3 mL). The mixture was stirred at room temperature for 3 hours, and then concentrated in vacuo. The crude product was used for the next step directly. LC-MS (ESI): m/z 518 (M+H)⁺.

Step 3: Synthesis of 6-(2-Isopropylphenyl)-1-(4-(1-(1-methylazetidin-3-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (152)

To a solution of 3-(2-(4-((6-(2-isopropylphenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)azetidin-1-ium 2,2,2-trifluoroacetate (TFA salt) (0.20 g, 0.41 mmol) in DCM (10 mL) at room temperature, was added an aqueous 37% formaldehyde solution (2.04 mL) and NaBH(OAc)₃ (0.17 g, 0.82 mmol) in one portion. After the reaction was stirred at room temperature for 30 min, an additional 70 mg of NaBH(OAc)₃ was added. After an additional 1 hour, the reaction was quenched with water (20 mL) and extracted with DCM (50 ml×3). The combined organic layer was dried over anhydrous Na₂SO₄ (20 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (DCM:MeOH=100:1 to 20:1) to give 38 mg of the title compound. LC-MS (Method A) (ESI): m/z 532 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.31 (s, 1H), 8.21 (s, 1H), 7.82 (s, 1H), 7.72 (d, J=7.5 Hz, 1H), 7.41-7.71 (m, 6H), 7.33 (m, 1H), 5.75 (s, 2H), 4.78-4.82 (m, 1H), 3.60-3.65 (m, 2H), 3.55 (m, 1H), 3.31-3.36 (m, 2H), 2.37 (s, 3H), 1.26-1.28 (d, J=6.9 Hz, 6H).

The Following Example was Prepared from BB-4 According to Example 152

Example	Structure	Analytical data
153		LC-MS (Method A) (ESI+): m/z 561 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.41 (s, 1H), 8.65 (s, 1H), 8.42 (s, 1H), 8.30 (s, 1H), 7.50-7.58 (m, 4H), 5.82 (s, 2H), 5.38 (m, 1H), 4.40-4.52 (m, 4H), 3.92 (s, 3H), 2.98 (s, 3H), 1.78 (m, 1H), 1.12-1.20 (m, 2H), 0.88-0.95 (m, 2H).

Example 154: Synthesis of 1-(4-(1-Cyclopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine (154)

To a stirred solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (134) (0.20 g, 0.40 mmol) and cyclopropyl boronic acid (0.052 g, 0.60 mmol) in DCE (20 mL), was added Cu(OAc)₂ (0.108 g, 0.60 mmol) and 22′-bipyridyl (0.074 g, 0.48 mmol). The reaction mixture was degassed by oxygen for 30 min and then heated at 90° C. under oxygen balloon pressure for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was filtered through Celite bed, washed with DCM, and the filtrate was concentrated under reduced pressure. The crude compound was purified by column chromatography using 0-2% MeOH in DCM to get the impure compound which was further purified by prep. HPLC to afford 0.042 g of the title compound. LC-MS (Method C) (ESI+): m/z 533.05 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 7.92 (s, 1H), 7.85 (d, J=7.8 Hz, 2H), 7.40 (d, J=8.3 Hz, 2H), 5.78 (s, 2H), 3.85 (s, 3H), 3.67-3.74 (m, 1H), 1.62-1.69 (m, 1H), 1.06 (s, 2H), 0.92-1.00 (m, 2H), 0.83-0.91 (m, 4H).

General Procedure for the Preparation of Aminopyrimidines: Synthesis of 6-Cyclopropyl-N, N-dimethyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-amine (155)

Step 1: Synthesis of 6-Cyclopropyl-S-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-ol

To a stirred solution of 6-(4-(benzyloxy)-6-cyclopropylpyrimidin-5-yl)-1-(4-(1-met yl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (102) (0.32 g, 0.55 mmol) in MeOH (5 mL) was added Pd/C (0.10 g) under nitrogen atmosphere, and the reaction mixture was stirred under H₂ atmosphere at room temperature for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was filtered through Celite, and the filtrate was concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 7-10% MeOH in DCM to afford 0.215 g of the title compound. LC-MS (Method B) (ESI+): m/z 493.00 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 12.62 (s, 1H), 9.47 (s, 1H), 8.48 (s, 1H), 8.17 (s, 1H), 7.91 (s, 1H), 7.67 (d, J=7.9 Hz, 2H), 7.40 (d, J=8.4 Hz, 2H), 5.77 (s, 2H), 3.74 (s, 3H), 1.46-1.54 (m, 1H), 0.97-1.02 (m, 2H), 0.74-0.80 (in, 2H).

Step 2: Synthesis of 6-Cyclopropyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-yl trifluoromethanesulfonate

To a stirred solution of 6-cyclopropyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-ol (0.20 g, 0.41 mmol) in DMF (5 mL), was added K₂CO₃ (0.168 g, 1.22 mmol). N-Phenyl-bis(trifluoromethanesulfonimide) (0.217 g, 0.61 mmol) was then added and the reaction mixture was stirred at room temperature for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with H₂O (20 mL) and extracted with EA (2×20 mL). The combined organic layer was washed with cold H₂O (25 mL) and brine (25 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 1-2% MeOH in DCM to afford 0.13 g of the title compound. LC-MS (Method B) (ESI+): m/z 625.00 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.62 (s, 1H), 9.09 (s, 1H), 8.61 (s, 1H), 7.92 (s, 1H), 7.67 (d, J=7.9 Hz, 2H), 7.40 (d, J=7.9 Hz, 2H), 5.81 (s, 2H), 3.74 (s, 3H), 2.26-2.30 (m, 1H), 1.25 (s, 2H), 1.09-1.14 (m, 2H).

Step 3: Synthesis of 6-Cyclopropyl-N,N-dimethyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-amine (Example 155)

To an ice cooled solution of 6-cyclopropyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-yl trifluoromethanesulfonate (1 eq) in dry THF (2 mL), were added DIPEA (2 eq) and Me₂NH (2 eq) sequentially. The resulting mixture was stirred at room temperature for 1 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (10 mL) and extracted with EA (2×15 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated wider reduced pressure. The crude compound was triturated with n-pentane (10 mL), filtered, and the solid thus obtained was further purified prep HPLC to afford mg of the title compound. LC-MS (Method B) (ESI+): m/z 520.15 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.49 (s, 1H), 8.51 (s, 1H), 8.41 (s, 1H), 7.92 (s, 1H), 7.67 (d, J=7.8 Hz, 2H), 7.36 (d, J=8.3 Hz, 211), 5.78 (s, 2H), 3.74 (s, 3H), 2.61 (s, 6H), 1.58-1.66 (m, 1H), 0.93-0 97 (m, 2H), 0.67-0.70 (m, 2H).

The Following Compounds were Prepared from the Appropriate Amines According to the Method Described for Example 155:

Example	Structure	Analytical data
156		LC-MS (Method B) (ESI+): m/z 532.10 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.52 (s, 1H), 8.37 (s, 1H), 7.92 (s, 1H), 7.68 (d, J = 7.8 Hz, 2H), 7.39 (d, J = 8.3 Hz, 2H), 5.80 (s, 2H), 3.74 (s, 3H), 3.44 (d, J = 8.3 Hz, 4H), 1.93-2.03 (m, 2H), 1.43- 1.52 (m, 1H), 0.96 (s, 2H), 0.67-0.74 (m, 2H).
157		LC-MS (Method B) (ESI+): m/z 546.15 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.47 (s, 1H), 8.52 (s, 1H), 8.38 (s, 1H), 7.91 (s, 1H), 7.66 (d, J = 8.3 Hz, 2H), 7.33 (d, J = 8.3 Hz, 2H), 5.79 (s, 2H), 3.74 (s, 3H), 2.89 (s, 4H), 1.58 (s, 4H), 1.36-1.44 (m, 1H), 0.95 (s, 2H), 0.66 (dd, J = 2.9, 7.8 Hz, 2H).
158		LC-MS (Method B) (ESI+): m/z 506.15 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.50 (s, 1H), 8.52 (s, 1H), 8.37 (s, 1H), 7.92 (s, 1H), 7.67 (d, J = 7.8 Hz, 2H), 7.42 (d, J = 7.8 Hz, 2H), 6.98 (d, J = 4.4 Hz, 1H), 5.78 (s, 2H), 3.74 (s, 3H), 2.80 (d, J = 4.4 Hz, 3H), 1.77-1.85 (m, 1H), 0.98 (s, 2H), 0.71 (dd, J = 3.2, 7.1 Hz, 2H).
159		LC-MS (Method A) (ESI+): m/z 494 (M + H)+; 1H-NMR (300 MHz, CDCl3) □ 9.39 (s, 1H), 8.44 (s, 1H), 8.42 (s, 1H), 7.46-7.54 (m, 4H), 6.57 (s, 1H), 5.82 (s, 2H), 2.71 (s, 6H), 2.31 (s, 3H), 2.13 (s, 3H).

Example 160: Synthesis of 6-Cyclopropyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-yl trifluoromethanesulfonate (160)

To a stirred solution of 6-cyclopropyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-yltrifluoromethanesulfonate (0.15 g, 0.24 mmol) in DMA (5 mL), was added Zn(CN)₂ (0.141 g, 1.20 mmol) and Cs₂CO₃ (0.156 g, 0.48 mewl). The mixture was then degassed with argon for 10 min, whereupon, Pd₂(dba)₃ (0.022 g, 0.024 mmol) and dppf (0.013 g, 0.024 mmol) were added. The reaction mixture was heated to 90° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The residue obtained was dissolved in Et₂O (50 mL), filtered through Celle, and washed with Et₂O (20 mL). The organic layer was concentrated wider reduced pressure and the crude compound was purified by SFC to afford 0.037 g of the title compound. LC-MS (Method C) (ESI+): m/z 501.95 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.65 (s, 1H), 9.28 (s, 1H), 8.63 (s, 1H), 7.92 (s, 1H), 7.67 (d, J=7.8 Hz, 2H), 7.46 (d, J=7.8 Hz, 2H), 5.83 (s, 2H), 3.74 (s, 3H), 2.38-2.45 (m, 1H), 1.23 (s, 2H), 1.09-1.16 (m, 2H).

Example 161: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-N,N-dimethyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (161)

Step 1: Synthesis of 4,6-dichloro-1-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine

To a stirred solution of (4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanol 1 (1.0 g, 3.52 mmol), 4,6-dichloro-1H-pyrazolo[3,4-d]pyrimidine (0.665 g, 0.352 mmol) and TPP (1.84 g, 7.04 mmol) in THF (10 mL), was added DTBAD (1.61 g, 7.04 mmol) portion-wise at room temperature. The resulting mixture was stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure to dryness resulting in the crude compound. The crude compound was purified by silica gel chromatography using 0-40% EA in hexane to afford the title compound (0.230 g). LC-MS (Method B) (ESI+): m/z 455.10 (M)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.63 (s, 1H), 8.17 (s, 1H), 7.54 (d, J=7.83 Hz, 2H), 7.40 (d, J=7.83 Hz, 2H), 5.73-5.77 (m, 2H), 4.43 (td, J=6.72, 12.96 Hz, 1H), 1.38 (d, J=6.85 Hz, 6H).

Step 2: Synthesis of 6-chloro-1-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-N,N-dimethyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine

To a stirred solution of 4,6-dichloro-1-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (0.230 g, 0.506 mmol) in THF (12 mL), was added DIPEA (0.263 mL, 1.519 mmol) at room temperature. To the resulting mixture was added dimethylamine (2M solution in THF, 0.506 mL, 1.01 mmol) and the reaction was stirred for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (20 mL) and extracted with EA (3×5 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-50% EA in hexane to afford the title compound (0.200 g). LC-MS (Method B) (ESI+): m/z 464.08 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.31 (s, 1H), 8.17 (s, 1H), 7.53 (d, J=7.83 Hz, 2H), 7.32 (d, J=7.83 Hz, 2H), 5.57 (s, 2H), 4.10 (q, J=5.22 Hz, 1H), 3.42 (br s, 3H), 3.26 (br s, 3H), 1.38 (d, J=6.36 Hz, 6H).

Step 3: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-N,N-dimethyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (161)

To a stirred solution of 6-chloro-1-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl) N,N-dimethyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine 3 (0.090 g, 0.194 mmol) and (4-cyclopropyl-6-methoxypyrimidin-5-yl)boronic acid BB-4 (0.041 g, 0.213 mmol) in dioxane:H₂O (3:1 mL), was added Cs₂CO₃ (0.158 g, 0.485 mmol) at room temperature. The resulting mixture was degassed with argon for 5 min, and then treated with X-Phos (0.018 g, 0.038 mmol) and X-Phos-Pd-G₂ (0.015 g, 0.019 mmol). The mixture was further degassed with argon for 5 min, and then heated at 100° C. for 8 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with water (100 mL) and extracted with EA (2×fix) mL). The combined organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-50% EA in hexane to afford (0.070 g) of the title compound. This material was dissolved in dioxane (7 mL) and stirred with PS-Thiol silica (0.007 g). The resulting slurry was heated to 100° C. for 2 h, then cooled to room temperature, filtered and concentrated under reduced pressure to afford the title compound (0.050 g).

This material was further purified by prep HPLC (Method C) to afford the title compound (0.020 g). LC-MS (Method B) (ESI+): m/z 578.30 (M+H)⁺; ¹H-NMR (400 MHO DMSO-d₆) δ 8.61 (s, 1H), 8.29 (s, 1H), 8.11 (s, 1H), 7.47 (d, J=7.83 Hz, 2H), 7.34 (d, J=7.83 Hz, 2H), 5.59 (s, 2H), 4.38 (td, J=6.24, 12.96 Hz, 1H), 3.83 (s, 3H), 3.19-3.47 (m, 6H), 1.70-1.80 (m, 1H), 1.35 (d, J=6.36 Hz, 6H), 0.96-1.02 (m, 2H), 0.80-0.86 (m, 2H).

Preparation of 1-65: Synthesis of 1-(4-(5-bromo-1-ethyl-4-(trifluoromethyl)-1N-imidazol-2-yl)benzyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine (I-65)

To a stirred solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl) benzyl)-1H-pyrazolo[3,4-d]pyrimidine (54) (1.80 g, 3.461 mmol) in DMF (10 mL) was added NBS (1.23 g, 6.923 mmol) in one lot at room temperature. The resulting mixture was stirred for 2 h and progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with ice cold water (15 mL) and extracted with EA (3×15 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated wider reduced pressure. The crude compound thus obtained was purified by silica gel chromatography using 0-50% EA in hexane as eluent to afford the title compound (1.00 g). LC-MS (Method B) (ESI+): m/z 600.40 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 7.54-7.64 (m, 3H), 7.43 (d, J=7.98 Hz, 1H), 5.80 (s, 2H), 4.00-4.08 (m, 2H), 3.85 (s, 2H), 1.62-1.69 (m, 1H), 1.24 (t, J=7.23 Hz, 3H), 1.17 (t, J=723 Hz, 1H), 1.02-1.08 (m, 2H), 0.83-0.88 (m, 2H).

The Following Example Compounds were Prepared from the Appropriate Building Blocks According to the Method Described for I-65

Example	Structure	Analytical data
162		LC-MS (Method B) (ESI+): m/z 613.30 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 7.46- 7.53 (m, 2H), 7.39-7.45 (m, 2H), 5.80 (s, 2H), 4.51-4.60 (m, 1H), 3.85 (s, 3H), 1.65 (dt, J = 3.91, 8.07 Hz, 1H), 1.49 (d, J = 7.34 Hz, 6H), 1.02-1.09 (m, 2H), 0.85 (dd, J = 3.42, 7.83 Hz, 2H).
163		LC-MS (Method C) (ESI+): m/z 584.90 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.64 (d, J = 7.98 Hz, 2H), 7.44 (d, J = 8.48 Hz, 2H), 5.79 (s, 2H), 3.85 (s, 3H), 3.65 (s, 3H), 1.65 (ddd, J = 4.49, 7.85, 12.09 Hz, 1H), 1.03- 1.09 (m, 2H), 0.86 (dd, J = 2.99, 7.98 Hz, 2H).

Example 164: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-5-methoxy-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (164)

To a stirred solution of 1-(4-(5-bromo-1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine I-65 (0.100 g, 0.167 mmol) in dioxane:MeOH (1.2:0.3 mL) was added NaOtBu (0.032 g, 0.334 mmol). The mixture was then degassed with argon for 10 min. To the reaction mixture was added tert-butyl-Brettphos (0.002 g, 0.003 mmol) and tert-butyl-BrettphosPd-G₃ (0.003 g, 0.003 mmol) at room temperature, and the mixture was further degassed with argon for 5 min. The reaction mixture was then heated at 60° C. for 48 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-2% methanol in DCM followed by re-purification wing preparative HPLC (Method B) to afford the title compound (0.014 g). LC-MS (Method B) (ESI+): m/z 551.25 (M+H); ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.58 (d, J=8.31 Hz, 2H), 7.40 (d, J=8.31 Hz, 2H), 5.78 (s, 2H), 3.97 (5, 3H), 3.90-3.96 (m, 2H), 3.85 (s, 3H), 1.61-1.69 (m, 1H), 1.17 (t, J=7.09 Hz, 3H), 1.03-1.08 (m, 2H), 0.83-0.88 (m, 2H).

The Following Compounds were Prepared from the Appropriate Building Blocks According to the Method Described for Example 164:

Example	Structure	Analytical data
165		LC-MS (Method C) (ESI+): m/z 537.04 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.64 (d, J = 8.48 Hz, 2H), 7.41 (d, J = 7.98 Hz, 2H), 5.77 (s, 2H), 3.94 (s, 3H), 3.85 (s, 3H), 3.52 (s, 3H), 1.65 (dt, J = 4.24, 8.10 Hz, 1H), 1.03-1.09 (m, 2H), 0.86 (dd, J = 3.24, 7.73 Hz, 2H).
166		LC-MS (Method B) (ESI+): m/z 565.40 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.44- 7.48 (m, 2H), 7.38-7.43 (m, 2H), 5.78 (s, 2H), 4.33 (td, J = 6.92, 13.59 Hz, 1H), 3.98 (s, 3H), 3.85 (s, 3H), 1.62-1.70 (m, 1H), 1.40 (d, J = 6.98 Hz, 6H), 1.06 (d, J = 2.49 Hz, 2H), 0.85 (dd, J = 3.24, 7.73 Hz, 2H).

Example 167: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-5-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (167)

To a stirred solution of 1-(4-(5-bromo-1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine I-65 (0.200 g, 0.334 mmol) and trimethylboroxine (0.031 g, 0.502 mmol) in dioxane (6 mL) and water (2 ml), was added and K₂CO₃ (0.090 g, 0.668 mmol) at room temperature and the reaction mixture was degassed with argon gas for 15 min. To the resulting reaction mixture was added Pd(dppf)Cl₂-DCM (0.014 g, 0.016 mmol) at room temperature. The reaction mixture was heated in a sealed tube at 100° C. for 6 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and filtered through Celite and washed EA (5 mL). The filtrate obtained was concentrated under reduced pressure. The resulting crude compound was purified by prep. HPLC (Method B) to give the title compound. To a stirred solution of compound 168 (0.70 g) in dioxane (7 mL), was added SP thiol silica (0.007 g). The resulting reaction mixture was heated to 100° C. for 1 h, then cooled to room temperature, filtered and concentrated under reduced pressure to afford the title compound (0.027 g). LC-MS (Method B) (ESI+): m/z 535.15 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.55 (d, J=7.82 Hz; 2H), 7.41 (d, J=7.82 Hz, 2H), 5.79 (s, 2H), 3.92-4.01 (m, 2H), 3.85 (s, 3H), 2.37 (br s, 3H), 1.66 (d, J=3.42 Hz, 1H), 1.19 (t, J=7.09 Hz, 3H), 1.02-1.08 (m, 2H), 0.85 (d, J=3.91 Hz, 2H).

Preparation of Common Intermediate I-63: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine (I-66)

Step 1: Synthesis of 6-chloro-1-(tetrahydro-2H-pyran-2-yl)-1H-pyrazolo[3,4-d]pyrimidine

To a stirred solution of 6-chloro-1H-pyrazolo[3,4-d]pyrimidine 1 (2.5 g, 16.2 mmol) in DCM (50 mL), was added p-TsOH (0.418 g, 2.43 mmol) at room temperature. The resulting mixture was stirred for 5 min, and then 3,4-dihydro-2H-pyran 2 (2.29 g, 3.24 mmol) was added dropwise at 0° C. After addition, the mixture was stirred for 1 h at the same temperature. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with saturated NaHCO₃ solution (50 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-20% EA in hexane to afford the title compound (3.0 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 9.31-9.29 (m, 1H), 8.50 (s, 1H), 5.94 (dd, J=2.4, 10.3 Hz, 1H), 3.98-3.92 (m, 1H), 3.77-3.69 (m, 1H), 2.48-2.36 (m, 1H), 2.07-1.98 (m, 1H), 1.97-1.89 (m, 1H), 1.84-1.71 On, 1H), 1.62-1.54 (m, 2H).

Step 2: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(tetrahydro-2H-pyran-2-yl)-1H-Pyrazolo[3,4-d]pyrimidine

To a stirred solution of 6-chloro-1-(tetrahydro-2H-pyran-2-yl)-1H-pyrazolo[3,4-d]pyrimidine 3 (2.5 g, 10.5 mmol) and (4-cyclopropyl-6-methoxypyrimidin-5-yl)boronic acid BB-4 (2.03 g, 10.5 mmol) in dioxane:H₂O (3:1, 40 mL), was added K₃PO₄ (2.43 g, 11.4 mmol) at room temperature. The reaction mixture was purged with argon for 30 min, and then treated with XPhos-Pd-G2 (0.818 g, 1.04 mmol) and XPhos (0.991 g, 2.08 mmol) at room temperature. The resulting mixture was heated to 90° C. in a sealed tube for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with water (50 mL) and extracted with EA (50 mL). The organic layer was separated, dried over anhydrous sodium sulfate and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-40% EA in hexane to afford the title compound 4 (3.00 g). To a stirred solution of compound 4 (3.00 g) in dioxane (10 mL), was added SP thiol silica (0.250 g). The resulting reaction mixture was heated to 100° C. for 1 h, and then cooled to room temperature, filtered and concentrated under reduced pressure to afford the title compound (2.92 g). LC-MS (Method C) (ESI+): m/z 353.05 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.49 (s, 1H), 8.72 (s, 1H), 8.51 (s, 1H), 3.97-3.90 On, 1H), 3.84 (s, 3H), 3.76-3.68 On, 1H), 2.05-1.98 (m, 3H), 1.86-1.71 (m, 1H), 1.63-1.52 On, 3H), 1.20-1.15 (m, 1H), 1.11-1.02 (m, 2H), 0.90-0.86 (m, 2H).

Step 3: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine (I-66)

Solid 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(tetrahydro-2H-pyran-2-yl)-1H-pyrazolo[3,4-d]pyrimidine 4 (2.9 g, 8.23 mmol) was dissolved at room temperature in TFA (30 mL), and stirred for 15 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The residue was diluted with DCM (50 mL) and was basified to pH 8 using saturated NaHCO₃ solution (10 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-20% EA in hexane to afford the title compound (1.87 g). LC-MS (Method C) (ESI+): m/z 268.95 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 14.20 (br s, 1H), 9.46 (s, 1H), 8.69 (s, 1H), 8.43 (s, 1H), 3.83 (s, 3H), 1.67-1.59 (m, 1H), 1.05 (td, J=3.7, 7.1 Hz, 21-1), 0.91-0.84 (m, 2H).

Example 168: Synthesis of(S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-(2-fluoroethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-methoxyphenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine (168)

Step 1: Synthesis of 4-acetyl-2-methoxyphenyl trifluoromethane sulfonate

To a stirred solution of 1-(4-hydroxy-3-methoxyphenyl) ethan-1-one 1 (3 g, 18 mmol) in DCM (60 mL) was added 4-dimethylaminopyridine (3.3 g, 27 mmol) at 0° C. To the resulting reaction mixture was added triflic anhydride (6.1 g, 22 mmol) dropwise. Upon complete addition, the mixture was further stirred at 0° C. for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with 1N HCl (50 mL) and extracted with DCM (50 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-20% EA in hexane as eluent to afford the title compound (4.57 g). ¹H-NMR (400 MHz, CDCl₃) δ 7.66 (d, J=1.96 Hz, 1H), 7.57 (dd, J=1.96, 8.31 Hz, 1H), 7.32 (d, J=8.31 Hz, 1H), 3.99 (s, 3H), 2.61-2.64 (m, 3H).

Step 2: Synthesis of 1-(3-methoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)ethan-1-one

To a stirred solution of 4-acetyl-2-methoxyphenyl trifluoromethanesulfonate 2 (4.5 g, 15.1 mmol) and bis(pinacolato)diborane (19.15 g, 75.44 mmol) in dioxane (100 mL), was added potassium acetate (4.44 g, 45.2 mmol). The resulting mixture was degassed with argon for 10 min, and then treated with Pd(dppf)Cl₂ (0.044 g, 1.508 mmol) at room temperature. The reaction mixture was then heated in a sealed tube at 90° C. for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and filtered through a pad of Celite. The filtrate was diluted with water (100 mL) and extracted with EA (2×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-15% EA in hexane as eluent to afford 3 (2.07 g). LC-MS (Method C) (ESI+): m/z 277.26 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 7.73 (d, J=7.34 Hz, 1H), 7.49 (dd, J=1.22, 7.58 Hz, 1H), 7.42-7.45 (m, 1H), 3.89 (s, 3H), 2.61 (s, 3H), 1.37 (s, 12H).

Step 3: Synthesis of 1-(4-(1-(2-fluoroethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-methoxyphenyl)ethan-1-one

To a stirred solution of 2-bromo-1-(2-fluoroethyl)-4-(trifluoromethyl)-1H-imidazole 4 (2.0 g, 7.24 mmol) and 1-(3-methoxy-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)ethan-1-one 3 (1.89 g, 7.24 mmol) in dioxane:H₂O (4:1, 50 mL), was added Cs₂CO₃ (3.53 g, 10.96 mmol). The resulting mixture was purged with argon for 10 tin, and then treated with XPhos-Pd-G2 (0.284 g, 0.362 mop and XPhos (0.345 g, 0.724 mmol) at room temperature. The reaction mixture was then heated to 80° C. in a sealed tube for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with water (50 mL) and extracted with EA (2×25 mL). The combined organic layer was dried over anhydrous sodium sulfate and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-30% EA in hexane as eluent to afford the title compound (2.0 g). LC-MS (Method B) (ESI+): m/z 331.10 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.01 (s, 1H), 7.67-7.72 (m, 1H), 7.62 (s, 1H), 7.53 (d, J=7.83 Hz, 1H), 4.49-4.67 (m, 2H), 4.08-4.20 (m, 2H), 3.89 (s, 3H), 2.63-2.70 (m, 4H).

Step 4: Synthesis of (R)-1-(4-(1-(2-fluoroethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-methoxyphenyl)ethan-1-01)

To a stirred solution of 1-(4-(1-(2-fluoroethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-methoxyphenyl)ethan-1-one 5 (1.5 g, 4.5 mmol) in THF (30 mL) was added (S)-2-Methyl-CBS-oxazoborolidine (0.9 mL, 0.91 mmol) at room temperature. The mixture was then heated at 45° C. for 1 h. To the resulting reaction mixture was added borane-DMS (0.689 mg, 9.08 mmol), and the mixture was heated at 65° C. for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, slowly quenched with methanol (50 mL) and concentrated under reduced pressure. The crude residue obtained was diluted with 1N HCl (20 mL) and extracted with EA (2×25 mL). The combined organic layer was dried over anhydrous sodium sulfate and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-60% EA in hexane as eluent to afford the title compound (1.04 g). LC-MS (Method B) (ESI+): m/z 333.4 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.94 (s, 1H), 7.28 (d, J=7.83 Hz, 1H), 7.15 (s, 1H), 7.04 (d, J=7.34 Hz, 1H), 5.31 (d, J=3.91 Hz, 1H), 4.74-4.83 (m, 1H), 4.67 (t, J=4.40 Hz, 1H), 4.55 (t, J=4.65 Hz, 1H), 4.14 (t, J=4.40 Hz, 1H), 4.07 (t, J=4.65 Hz, 1H), 3.80 (s, 3H), 1.37 (d, J=6.36 Hz, 3H).

Step 5: Synthesis of(S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-(2-fluoroethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-methoxyphenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine (168)

To a stirred solution of (R)-1-(4-(1-(2-fluoroethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-methoxyphenyl)ethan-1-ol 6 (0.400 g, 1.20 mmol), 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine I-66 (0.322 g, 1.20 mmol) and triphenylphosphine (0.470 g, 1.80 mmol) in THF (4 mL), was added DEAD (0.133 g, 1.80 mmol) at room temperature. The resulting mixture was stirred for 30 min, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. The crude residue obtained was diluted with water (30 mL) and extracted with EA (2×25 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-70% EA in hexane as eluent to afford impure compound that was further purified by prep HPLC (Method D) and chiral SFC purification (Method B) to afford the title compound (0.200 g). LC-MS (Method B) (ESI+): m/z 583.25 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) 9.49 (s, 1H), 8.71 (s, 1H), 8.55 (s, 1H), 7.93 (s, 1H), 7.28 (d, J=7.83 Hz, 1H), 6.97 (d, J=7.83 Hz, 1H), 6.30-6.38 (m, 1H), 4.63 (t, J=4.40 Hz, 1H), 4.51 (t, J=4.40 Hz, 1H), 4.11 (d, J=3.91 Hz, 1H), 4.04 (d, J=4.40 Hz, 1H), 3.82 (s, 3H), 3.74 (s, 3H), 2.00 (d, J=6.85 Hz, 3H), 1.55-1.64 (m, 2H), 1.01-1.07 (m, 2H), 0.77-0.88 (m, 2H).

The following compound was prepared from the appropriate building blocks according to the method described for Example 168:

Example	Structure	Analytical data
169		LC-MS (Method B) (ESI+): m/z 553.30 (M + H)+, 1H-NMR (400 MHz, DMSO-d6) δ 9.49 (s, 1H), 8.70 (s, 1H), 8.54 (s, 1H), 8.01 (s, 1H), 7.56-7.59 (m, 2H), 7.48 (d, J = 8.31 Hz, 2H), 6.35 (q, J = 6.85 Hz, 1H), 4.77 (t, J = 4.65 Hz, 1H), 4.65 (t, J = 4.40 Hz, 1H), 4.38 (t, J = 4.65 Hz, 1H), 4.31 (t, J = 4.40 Hz, 1H), 3.83 (s, 3H), 1.99 (d, J = 6.85 Hz, 3H), 1.57-1.65 (m, 1H), 1.04 (d, J = 4.40 Hz, 2H), 0.83 (d, J = 6.36 Hz, 2H).

Example 170: Synthesis of 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (170)

Step 1: Synthesis of 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine

To a stirred solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine 1-66 (1.80 g, 6.71 mmol) in DMF (18 mL), was added NBS (2.38 g, 13.4 mmol) at room temperature. The reaction mixture was then stirred for 2 h After completion, the reaction mixture concentrated under reduced pressure to afford the crude title compound 2. The crude compound was triturated with DCM (20 mL), filtered and dried in vacuo to afford the title compound 2 (2.04 g). LC-MS (Method C) (ESI+): m/z 346.85 (M+H)⁺, ¹H-NMR (400 MHz, DMSO-d₆) δ 14.58 (br s, 1H), 9.39 (s, 1H), 8.71 (s, 1H), 3.84 (s, 3H), 1.71-1.62 (m, 1H), 1.06 (br s, 2H), 0.91-0.83 (m, 2H).

Step 2: Synthesis of Synthesis of 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (170)

To a stirred mixture of (4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanol 3 (1.55 g, 5.74 mmol), 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine 2 (2.00 g, 5.740 mmol) and triphenylphosphine (2.26 g, 8.611 mmol) in THF (20 mL) was added DEAD (1.50 g, 8.611 mmol) at room temperature. The resulting mixture was then stirred for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (50 mL) and extracted with EA (2×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-60% EA in n-hexane as eluent to afford the title compound (2.41 g). LC-MS (Method B) (ESI+): m/z 599.15 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.44 (s, 1H), 8.72 (s, 1H), 8.02 (s, 1H), 7.61 (d, J=7.83 Hz, 2H), 7.45 (d, J=7.83 Hz, 2H), 5.77 (s, 2H), 4.05 (q, J=7.34 Hz, 2H), 3.86 (s, 3H), 1.70 (dd, J=3.67, 8.07 Hz, 1H), 1.30 (t, J=7.34 Hz 3H), 1.04-1.09 (m, 2H), 0.83-0.89 (m, 2H).

The Following Compound was Prepared from the Appropriate Building Blocks According to the Method Described for Example 170:

Example	Structure	Analytical data
171		LC-MS (Method C) (ESI+): m/z 599.08 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.41 (s, 1H), 8.71 (s, 1H), 7.91 (s, 1H), 7.69 (d, J = 7.34 Hz, 2H), 7.49 J = 8.31 Hz, 2H), 6.35 (q, J = 6.85 Hz, 1H), 3.84 (s, 3H), 3.74 (s, 3H), 1.98 (d, J = 6.85 Hz, 3H), 1.61- 1.70 (m, 1H), 1.02-1.07 (m, 2H), 0.80-0.87 (m, 2H).

Example 172: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine-3-carbonitrile (172)

To a stirred solution of 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (170) (0.200 g, 0.334 mmol) in DMA (10 mL), was added zinc cyanide (0.078 g, 0.67 mmol) at room temperature. The resulting mixture was degassed with argon for 30 min, and then treated with 1,1′-bis(diphenylphosphino)ferrocene (0.044 g, 0.080 mmol) and Pd₂(dba)₃ (0.036 g, 0.040 mmol) at room temperature. The reaction mixture was heated in sealed tube at 130° C. for 1 h. The reaction mixture was cooled to room temperature and treated with aqueous ammonia solution (20 mL) for 30 min. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was extracted with DCM (20 mL). The organic layer was separated, washed with water (10 mL) and brine (10 mL). The organic layer was then dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was treated with PS-Thiol metal scavenger resin in in THF, filtered and concentrated in vacuo. The resulting residue was purified by silica gel chromatography using 0-40% EA in hexane as eluent to obtain the impure compound which was further re-purified by preparative HPLC (Method B) to afford the title compound (0.070 g). LC-MS (Method C) (ESI+): m/z 546.10 (M+H)⁺; 1H-NMR (400 MHz, DMSO-d₆) δ 9.80 (s, 1H), 8.74 (s, 1H), 8.03 (d, J=1.47 Hz, 1H), 7.62 (d, J=8.31 Hz, 2H), 7.49 (d, J=8.31 Hz, 2H), 5.92 (s, 2H), 4.05 (q, J=7.34 Hz, 2H), 3.86 (s, 3H), 1.70 (ddd, J=4.65, 7.95, 12.35 Hz, 1H), 1.30 (t, J=7.09 Hz, 3H), 1.06-1.11 (m, 2H), 0.83-0.89 (m, 2H).

Example 173: Synthesis of(S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(5-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-2,3-dihydro-1H-inden-1-yl)-1H-pyrazolo[3,4-d]pyrimidine (173)

Step 1: Synthesis of(S)-1-(5-bromo-2,3-dihydro-1H-inden-1-yl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine

To a stirred solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine 1-66 (0.800 g, 2.98 mmol) in THF (8 mL) at 0° C. was added (R)-5-bromo-2,3-dihydro-1H-inden-1-ol 1 (0.635 g, 2.98 mmol), DEAD (0.777 g, 4.47 mmol) and TPP (1.17 g, 4.47 mmol). The reaction mixture was allowed to warm to room temperature and was then stirred for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (20 mL) and extracted with EA (3×15 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 10-90% EA in hexane to afford the title compound (0.897 g). LC-MS (Method B) (ESI+): m/z 463.00 (M+).

Step 2: Synthesis of(S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2,3-dihydro-1H-inden-1-yl)-1H-pyrazolo[3,4-d]pyrimidine

To a stirred solution of (S)-1-(5-bromo-2,3-dihydro-1H-inden-1-yl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine 2 (0.800 g, 1.72 mmol) in dioxane (30 mL) was added KOAc (0.506 g, 5.16 mmol) and B₂Pin₂ (2.19 g, 8.62 mmol). The resulting mixture was degassed with argon for 10 min, and then treated with PdCl₂(dppf)-DCM (0.140 g, 0.171 mmol) at room temperature. The reaction mixture was then heated at 80° C. for 3 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was filtered through a pad of Celite. The filtrate was diluted with water (50 mL) and EA (50 mL). The organic layer was separated, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-40% EA in hexane to afford the title compound (0.550 g). LC-MS (Method C) (ESI+); m/z 511.25 (M+H); ¹H-NMR (400 MHz, DMSO-d₆) δ 9.48 (s, 1H), 8.71 (s, 1H), 8.43 (s, 1H), 7.65 (s, 1H), 7.42 (d, J=7.48 Hz, 1H), 6.91 (d, J=7.48 Hz, 1H), 6.56 (t, J=7.23 Hz, 1H), 3.87 (s, 3H), 3.21-3.29 (m, 2H), 3.04 (td, J=7.73, 15.46 Hz, 1H), 2.60-2.76 (m, 3H), 1.64-1.72 (m, 1H), 1.16 (s, 6H), 1.07 (s, 6H), 0.89 (t, J=6.73 Hz, 2H).

Step 3: Synthesis of (S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(5-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-2,3-dihydro-1H-inden-1-yl)-1H-pyrazolo[3,4-d]pyrimidine (173)

To a stirred solution of (S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2,3-dihydro-1H-inden-1-yl)-1H-pyrazolo[3,4-d]pyrimidine 3 (0.500 g, 0.979 mmol) in dioxane:H₂O (25:10 mL), was added Na₂CO₃ (0.155 g, 1.47 mmol) and 2-bromo-1-isopropyl-4-(trifluoromethyl)-1H-imidazole 4 (0.252 g, 0.979 mmol) at room temperature. The resulting mixture was degassed with argon for 10 min, and then treated with PdCl₂(dppf)-DCM (0.080 g, 0.097 mmol) at room temperature. The reaction was further degassed with argon for 10 min, and then heated at 80° C. for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with H₂O (50 mL) and EA (50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 10-90% EA in hexane as eluent. Re-purification of impure compound thus obtained by preparative HPLC (Method D) afforded 173. To the stirred solution of 173 (0.090 g) in dioxane (9 mL), was added SP thiol silica (0.009 g). The resulting reaction mixture was heated to 100° C. for 2 h. The reaction mixture was cooled to room temperature, filtered and concentrated under reduced pressure to afford the title compound (0.040 g). LC-MS (Method B) (ESI+): m/z 561.35 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.50 (s, 1H), 8.72 (s, 1H), 8.46 (s, 1H), 8.16 (s, 1H), 7.55 (s, 1H), 7.31 (d, J=7.48 Hz, 1H), 7.07 (d, J=7.98 Hz, 1H), 4.47 (td, J=6.67, 13.09 Hz, 1H), 3.88 (s, 3H), 3.06-3.17 (m, 2H), 2.64-2.82 (m, 3H), 1.68-1.76 (m, 1H), 1.39 (d, J=6.48 Hz, 6H), 1.06-1.10 (m, 2H), 0.91 (td, J=3.74, 7.48 Hz, 2H).

The Following Compounds were Prepared from the Appropriate Building Blocks According to the Method Described for Example 173:

Example	Structure	Analytical data
174		LC-MS (Method B) (ESI+): m/z 561.25 (M + H)+; 1H-NMR (400 MHz, DMSO- d6) δ 9.51 (s, 1H), 8.72 (s, 1H), 8.46 (s, 1H), 8.16 (s, 1H), 7.55 (s, 1H), 7.31 (d, J = 7.98 Hz, 1H), 7.08 (d, J = 7.98 Hz, 1H), 4.47 (td, J = 6.67, 13.09 Hz, 1H), 3.88 (s, 3H), 3.07-3.18 (m, 2H), 2.65- 2.81 (m, 3H), 1.72 (tt, J = 4.11, 8.10 Hz, 1H), 1.37-1.42 (m, 6H), 1.06-1.11 (m, 2H), 0.91 (td, J = 3.74, 7.48 Hz, 2H).

Example 175: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorobenzyl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine (175)

Step 1: Synthesis of 4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorobenzaldehyde

To a stirred solution of 2-bromo-1-ethyl-4-(trifluoromethyl)-1H-imidazole 1 (1.50 g, 6.17 in ol) in dioxane:H₂O (5:1) (18 mL), was added Cs₂CO₃ (4.0 g, 12.3 mmol) and (2-fluoro-4-formylphenyl)-boronic acid 2 (1.24 g, 7.41 mmol). The resulting mixture was degassed with argon for 5 min., and then treated with Pd(PPh₃)₄ (0.709 g, 0.617 mmol) at room temperature. The reaction mixture was heated in a sealed tube at 100° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with water (50 mL) and extracted with EA (2×60 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel using 10-30% EA in hexane to afford the title compound (0.400 g). LC-MS (Method B) (ESI+): m/z 286.9 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 10.09 (s, 1H), 8.19 (s, 1H), 7.92 (d, J=7.83 Hz, 2H), 7.81-7.87 (m, 1H), 3.94 (q, J=7.34 Hz, 2H), 1.29 (t, J=7.34 Hz; 3H).

Step 2: Synthesis of (4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorophenyl)methanol

To a stirred solution of 4 (1-et yl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorobenzaldehyde 3 (0.400 g, 1.398 mmol) in methanol (5 mL) at 0° C., was added sodium borohydride (0.053 g, 1.398 mmol). The reaction mixture was allowed to warm to room temperature, and then stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (10 mL) and concentrated under reduced pressure. The remaining residue was dissolved in water (20 mL) and extracted with EA (2×30 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-50% EA in hexane as eluent to afford the title compound (0.250 g). LC-MS (Method B) (ESI+): m/z 289.0 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 8.09 (s, 1H), 7.51 (t, J=7.83 Hz, 1H), 7.28-7.34 (m, 2H), 5.45 (br s, 1H), 4.60 (br s, 2H), 3.88 (q, J=7.01 Hz, 2H), 1.26 (t, J=7.09 Hz, 3H).

Step 3: Synthesis of 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorobenzyl)-1H-pyrazolo[3,4-d]pyrimidine

To a stirred solution of (4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorophenyl)methanol 4 (0.250 g, 0.868 mmol) in THF (5 mL), was added 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine (Intermediate 2, Example 170) (0.301 g, 0.868 mmol), DEAD (0.226 g, 1.302 mmol) and TPP (0.341 g, 1.302 mmol). The reaction mixture was stirred at room temperature for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (20 mL) and extracted with EA (2×20 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-40% EA in hexane the title compound (0.200 g). LC-MS (Method B) (ESI+): m/z 619.05 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.45 (s, 1H), 8.72 (s, 1H), 8.09 (s, 1H), 7.55 (t, J=7.83 Hz, 1H), 7.38 (d, J=10.76 Hz, 1H), 7.28 (d, J=6.85 Hz; 1H), 5.81 (s, 2H), 3.86 (s, 3H), 3.84-3.85 (m, 2H), 1.72 (td, J=4.03, 7.58 Hz, 1H), 1.25 (t, J=7.34 Hz, 3H), 1.04-1.09 (m, 2H), 0.85 (dd, J=2.93, 7.83 Hz, 2H).

Step 4: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluorobenzyl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine (175)

To a stirred solution of 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)-3-fluoro benzyl)-1H-pyrazolo[3,4-d]pyrimidine 5 (0.180 g, 0.292 mmol) in dioxane:H₂O (4:1) (12.5 mL), was added sodium tert-butoxide (0.042 g, 0.438 mmol) and then methanol (2.5 mL). The resulting mixture was degassed with argon for 15 min, then treated with tert-butyl brettphos-Pd-G3 (0.024 g, 0.029 mmol) and tert-butyl-Brettphos (0.028 g, 0.058 mmol) at room temperature. The reaction mixture was then heated in a sealed tube at 60° C. for 101. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with water (20 mL) and extracted with EA (2×60 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 1-5% methanol in DCM as eluent. The product thus obtained was slurried with PS-Thiol silica in THE at 100° C. for 2 h, then filtered. The filtrate was concentrated in vacuo to afford the title compound (0.025 g). LC-MS (Method C) (ESI+): m/z 569.15 (M+H)⁺; ¹H-NMR (400 MHz, CD₃OD) δ 9.21 (s, 1H), 8.63 (s, 1H), 7.84 (s, 1H), 7.50 (t, J=7.48 Hz, 1H), 7.29-7.36 (m, 2H), 5.63 (s, 2H), 4.13-4.18 (m, 3H), 3.93-3.97 (m, 2H), 3.92 (s, 3H), 1.70 (ddd, J=4.49, 8.10, 12.34 Hz, 1H), 1.32 (t, J=7.23 Hz, 3H), 1.14-1.19 (m, 2H), 0.88-0.94 (m, 2H).

The Following Compounds were Prepared from the Appropriate Building Blocks and Reagents According to the Method Described for Example 175:

Example	Structure	Analytical data
176		LC-MS (Method C) (ESI+): m/z 551.15 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.35 (s, 1H), 8.70 (s, 1H), 8.02 (s, 1H), 7.59 (d, J = 8.0 Hz, 2H), 7.40 (d, J = 8.5 Hz, 2H), 5.60 (s, 2H), 4.08 (s, 3H), 4.10-4.02 (m, 2H), 3.85 (s, 3H), 1.70-1.63 (m, 1H), 1.30 (t, J = 7.2 Hz, 3H), 1.07-1.03 (m, 2H), 0.89-0.83 (m, 2H).
177		LC-MS (Method C) (ESI+): m/z 583.10 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.32 (s, 1H), 8.69 (s, 1H), 8.02 (s, 1H), 7.57 (d, J = 8.31 Hz, 2H), 7.47-7.52 (m, 2H), 6.16- 6.24 (m, 1H), 4.77 (t, J = 4.40 Hz, 1H), 4.66 (t, J = 4.40 Hz, 1H), 4.39 (t, J = 4.16 Hz, 1H), 4.32 (d, J = 3.91 Hz, 1H), 4.12 (s, 3H), 3.83 (s, 3H), 1.93 (d, J = 6.85 Hz, 3H), 1.58-1.65 (m, 1H), 1.00-1.06 (m, 2H), 0.83 (d, J = 7.34 Hz, 2H).
178		LC-MS (Method B) (ESI+): m/z 583.15 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.32 (s, 1H), 8.69 (s, 1H), 8.02 (s, 1H), 7.55- 7.60 (m, 2H), 7.50 (d, J = 8.31 Hz, 2H), 6.20 (q, J = 7.01 Hz, 1H), 4.77 (d, J = 4.40 Hz, 1H), 4.64-4.68 (m, 1H), 4.39 (t, J = 4.65 Hz, 1H), 4.32 (t, J = 4.40 Hz, 1H), 4.12 (s, 3H), 3.84 (s, 3H), 1.93 (d, J = 7.34 Hz, 3H), 1.58- 1.66 (m, 1H), 1.04 (d, J = 3.42 Hz, 2H), 0.83 (d, J = 5.38 Hz, 2H).
179		LC-MS (Method C) (ESI+): m/z 551.14 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.32 (s, 1H), 8.70 (s, 1H), 7.92 (s, 1H), 7.67 (d, J = 7.83 Hz, 2H), 7.49 (d, J = 7.83 Hz, 2H), 6.16-6.23 (m, 1H), 4.12 (s, 3H), 3.84 (s, 3H), 3.75 (s, 3H), 1.93 (d, J = 6.85 Hz, 3H), 1.58-1.66 (m, 1H), 1.02-1.07 (m, 2H), 0.82- 0.86 (m, 2H).
180		LC-MS (Method C) (ESI+): m/z 565.10 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.32 (s, 1H), 8.69 (s, 1H), 8.01 (s, 1H), 7.58 (d, J = 7.98 Hz, 2H), 7.49 (d, J = 8.48 Hz, 2H), 6.20 (q, J = 6.81 Hz, 1H), 4.12 (s, 3H), 4.05 (q, J = 6.98 Hz, 2H), 3.84 (s, 3H), 1.93 (d, J = 6.98 Hz, 3H), 1.58-1.66 (m, 1H), 1.30 (t, J = 7.23 Hz, 3H), 1.04 (d, J = 2.49 Hz, 2H), 0.83 (d, J = 7.48 Hz, 2H).
181		LC-MS (Method B) (ESI+): m/z 579.35 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.33 (s, 1H), 8.69 (s, 1H), 8.16 (s, 1H), 7.47- 7.54 (m, 4H), 6.17-6.24 (m, 1H), 4.42 (td, J = 6.60, 13.21 Hz, 1H), 4.12 (s, 3H), 3.84 (s, 3H), 1.93 (d, J = 7.34 Hz, 3H), 1.59-1.66 (m, 1H), 1.38 (dd, J = 1.71, 6.60 Hz, 6H), 1.04 (d, J = 3.91 Hz, 2H), 0.78-0.87 (m, 2H).
182		LC-MS (Method B) (ESI+): m/z 565.35 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.34 (s, 1H), 8.70 (s, 1H), 8.01 (s, 1H), 7.59 (d, J = 7.82 Hz, 2H), 7.39 (d, J = 7.82 Hz, 2H), 5.59 (s, 2H), 4.46 (q, J = 6.85 Hz, 2H), 4.05 (q, J = 7.34 Hz, 2H), 3.85 (s, 3H), 1.63- 1.70 (m, 1H), 1.42 (t, J = 7.09 Hz, 3H), 1.29 (t, J = 7.34 Hz, 3H), 1.02-1.08 (m, 2H), 0.82- 0.89 (m, 2H).
183		LC-MS (Method B) (ESI+): m/z 579.35 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.34 (s, 1H), 8.67 (s, 1H), 8.02 (s, 1H), 7.58 (d, J = 7.98 Hz, 2H), 7.37 (d, J = 7.98 Hz, 2H), 5.60 (s, 2H), 4.46 (q, J = 6.98 Hz, 2H), 4.34 (q, J = 6.98 Hz, 2H), 4.05 (q, J = 6.98 Hz, 2H), 1.62-1.70 (m, 1H), 1.42 (t, J = 6.98 Hz, 3H), 1.29 (t, J = 7.23 Hz, 3H), 1.13 (t, J = 6.98 Hz, 3H), 1.02-1.08 (m, 2H), 0.85 (dd, J = 2.99, 7.48 Hz, 2H).
184		LC-MS (Method B) (ESI+): m/z 591.35 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.33 (s, 1H), 8.70 (s, 1H), 8.01 (s, 1H), 7.59 (d, J = 7.83 Hz, 2H), 7.39 (d, J = 8.31 Hz, 2H), 5.58 (s, 2H), 5.16 (m, J = 7.21 Hz, 1H), 4.05 (q, J = 7.34 Hz, 2H), 3.85 (s, 3H), 2.42- 2.47 (m, 2H), 2.18 (td, J = 9.78, 19.56 Hz, 2H), 1.82 (q, J = 10.27 Hz, 1H), 1.62-1.72 (m, 2H), 1.29 (t, J = 7.34 Hz, 3H), 1.02-1.07 (m, 2H), 0.82-0.88 (m, 2H).
185		LC-MS (Method B) (ESI+): m/z 565.35 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.34 (s, 1H), 8.70 (s, 1H), 8.24 (s, 1H), 7.75 (d, J = 8.31 Hz, 2H), 7.31 (d, J = 8.31 Hz, 2H), 5.51 (s, 2H), 4.56 (td, J = 6.42, 13.08 Hz, 1H), 4.07 (s, 3H), 3.86 (s, 3H), 1.67 (dd, J = 3.91, 7.83 Hz, 1H), 1.48 (d, J = 6.36 Hz, 6H), 1.03-1.10 (m, 2H), 0.87 (dd, J = 2.93, 7.34 Hz, 2H).

Example 186: Synthesis of 3-(azetidin-1-yl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (186)

To a stirred solution of 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine 170 (0.150 g, 0.250 mmol) and azetidine (0.143 g, 2.51 mmol) in dioxane (6 mL), was added NaOtBu (0.036 g, 0.38 mmol) and the mixture was degassed with argon for 10 min. To the resulting reaction mixture was added Brettphos (0.027 g, 0.050 mmol) and Brettphos-Pd-G₃ (0.023 g, 0.025 mmol) at room temperature. The resulting mixture was degassed with argon for 5 min, and then heated at 100° C. for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture of was diluted with water (100 mL) and extracted with EA (2×100 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-50% EA in n-hexane. The product obtained (0.080 g) was dissolved in dioxane (8 mL) and treated with PS-Thiol silica (0.008 g). The resulting mixture was heated to 100° C. for 2 h, then cooled to room temperature, filtered and concentrated under reduced pressure to remove metal contamination. The solid thus obtained was then purified by preparative HPLC (Method B) to afford the title compound (0.035 g). LC-MS (Method B) (ESI+): m/z 576.30 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.21 (s, 1H), 8.69 (s, 1H), 8.01 (s, 1H), 7.58 (d, J=8.31 Hz, 2H), 7.37 (d, J=7.83 Hz; 2H), 5.52 (s, 2H), 4.17 (t, J=7.34 Hz, 4H), 4.02-4.09 (m, 2H), 3.85 (s, 3H), 2.42-2.47 (m, 2H), 1.62-1.71 (m, 1H), 1.30 (t, J=7.09 Hz, 3H), 1.02-1.07 (m, 2H), 0.86 (dd, J=3.18, 7.58 Hz, 2H).

Example 187: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl) benzyl)-3-methyl-1H-pyrazolo[3,4-d]pyrimidine (187)

To a stirred solution of 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine 170 (0.200 g, 0.334 mmol) and trimethylboroxine (0.031 g, 1.00 mmol) in dioxane (10 mL) and water (5 ml) was added and Cs₂CO₃ (0.162 g, 0.5016 mmol) at room temperature. The mixture was degassed with argon for 15 min and then treated with Pd(dppf)Cl₂·DCM (0.054 g, 0.066 mmol) at room temperature. The reaction mixture was then heated in sealed tube at 90° C. for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with EA (20 mL) and water (10 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. To the stirred solution of the crude compound (0.70 g) in dioxane (7 mL) was added SP thiol silica (0.007 g). The resulting reaction mixture was heated to 100° C. for 1 h, cooled to room temperature, filtered and concentrated under reduced pressure. The crude compound was then purified by preparative HPLC (Method D) to afford the title compound (0.050 g). LC-MS (Method C) (ESI+): m/z 535.15 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.47 (s, 1H), 8.71 (s, 1H), 8.02 (s, 1H), 7.59 (d, J=8.48 Hz, 2H), 7.40 (d, J=7.98 Hz, 2H), 5.69 (s, 2H), 4.05 (q, J=6.98 Hz, 2H), 3.85 (s, 3H), 2.63 (s, 3H), 1.60-1.68 (m, 1H), 1.29 (t, J=7.23 Hz, 3H), 1.03-1.07 (m, 2H), 0.85 (dd, J=3.24, 7.23 Hz, 2H).

Example 188: Synthesis of (S)-1-(1-(4-(5-bromo-1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-3-methoxy-1H-pyrazolo[3,4-d]pyrimidine (188)

To a stirred solution of (S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-3-methoxy-1-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine 179 (0.220 g, 0.400 mmol) in DMF (4 mL) was added NBS (0.142 g, 0.800 mmol) at room temperature, and the reaction mixture was stirred for 16 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure, diluted with water (10 mL) and extracted with EA (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using with 0-40% EA in n-hexane as eluent followed by additional chiral purification (Method A) to afford the title compound (0.035 g). LC-MS (Method B) (ESI+): m/z 629.15 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.32 (s, 1H), 8.69 (s, 1H), 7.63 (d, J=8.31 Hz, 2H), 7.51 (d, J=8.31 Hz, 2H), 6.20 (q, J=7.17 Hz, 1H), 4.12 (s, 3H), 3.84 (s, 3H), 3.65 (s, 3H), 1.93 (d, J=7.34 Hz, 3H), 1.58-1.67 (m, 1H), 1.04 (d, J=3.42 Hz, 2H), 0.84 (dd, J=2.20, 7.58 Hz, 2H).

The Following Compounds were Prepared from the Appropriate Building Blocks According to the Method Described for Example 188:

Example	Structure	Analytical data
189		LC-MS (Method B) (ESI+): m/z 631.25 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.36 (s, 1H), 8.70 (s, 1H), 7.59 (d, J = 8.31 Hz, 2H), 7.42 (d, J = 7.83 Hz, 2H), 5.62 (s, 2H), 4.08 (s, 3H), 4.01-4.07 (m, 2H), 3.85 (s, 3H), 1.62-1.71 (m, 1H), 1.25 (t, J = 7.34 Hz, 3H), 1.05 (d, J = 2.93 Hz, 2H), 0.86 (dd, J = 2.93, 7.83 Hz, 2H).

Example 190: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3-(methylthio)-1H-pyrazolo[3,4-d]pyrimidine (190)

To a stirred solution of 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine 170 (0.200 g, 0.334 mmol) in DMF (4 mL), was added sodium methanethiolate (0.047 g, 0.67 mmol) at room temperature. The reaction mixture was further heated in a microwave at 150° C. for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture of was diluted with ice cold water (50 mL) and extracted with EA (2×100 mL). The combined organic layer was washed with ice cold water (2×150 mL), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-40% EA in n-hexane followed by additional purification using preparative HPLC (Method B) to afford the title compound (0.025 g). LC-MS (Method B) (ESI+): m/z 567.30 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.47 (s, 1H), 8.71 (s, 1H), 8.02 (s, 1H), 7.60 (d, J=8.31 Hz, 2H), 7.42 (d, J=8.31 Hz, 2H), 5.73 (s, 2H), 4.05 (q, J=7.34 Hz, 2H), 3.85 (s, 3H), 2.72 (s, 3H), 1.64-1.71 (m, 1H), 1.29 (t, J=7.34 Hz, 3H), 1.02-1.07 (m, 2H), 0.85 (dd, J=3.18, 7.58 Hz, 2H).

Example 191: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3-(methylsulfonyl)-1H-pyrazolo[3,4-d]pyrimidine (191)

To an ice cooled solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoro-methyl)-1H-imidazol-2-yl)benzyl)-3-(methylthio)-1H-pyrazolol[3,4-d]pyrimidine 190 (0.150 g, 0.265 mmol) in DCM (15 mL) was added m-CPBA (0.182 g, 1.06 mmol). The resulting mixture was allowed to attain room temperature and was further stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (100 mL) and extracted with DCM (2×100 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-50% EA in n-hexane followed by repurification by preparative HPLC (Method B) to afford the title compound (0.030 g). LC-MS (Method B) (ESI+): m/z 599.20 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.67 (s, 1H), 8.74 (s, 1H), 8.02 (s, 1H), 7.62 (d, J=8.31 Hz, 2H), 7.50 (d, J=8.31 Hz, 2H), 5.93 (s, 2H), 4.05 (q, J=7.17 Hz, 2H), 3.86 (s, 3H), 3.53 (s, 3H), 1.69-1.76 (m, 1H), 1.30 (t, J=7.09 Hz, 3H), 1.06-1.10 (m, 2H), 0.86 (dd, J=3.42, 7.83 Hz, 2H).

Example 192: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3-((4-methoxybenzyl)thio)-1H-pyrazolo[3,4-d]pyrimidine (192)

To a stirred solution of 3-bromo-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine 170 (0.300 g, 0.501 mmol) and (4-methoxyphenyl)methanethiol (0.115 g, 0.752 mmol) in dioxane (10 mL), was added DIPEA (0.620 mL, 3.51 mmol). The resulting solution was degassed with argon for 10 min, then treated with Xantphos (0.020 g, 0.035 mmol) and Pd₂(dba)₃ (0.032 g, 0.035 mmol) at room temperature. The mixture was further degassed with argon for 5 min, and then heated at 100° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (100 mL) and extracted with EA (2×100 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-30% EA in n-hexane as eluent to afford the title compound (0.300 g). LC-MS (Method B) (ESI+): m/z 673.30 (M+H)⁺, ¹H-NMR (400 MHz, DMSO-d₆) δ 9.28 (d, J=1.96 Hz, 1H), 8.70 (d, J=1.96 Hz, 1H), 8.03 (s, 1H), 7.62 (d, J=6.85 Hz, 2H), 7.41 (d, J=7.34 Hz, 2H), 7.22 (d, J=7.34 Hz, 2H), 6.74 (d, J=6.85 Hz, 2H), 5.74 (s, 2H), 4.40 (s, 2H), 4.03-4.11 (m, 2H), 3.8.5 (s, 3H), 3.65 (s, 3H), 1.59-1.67 (m, 1H), 1.27-1.33 (m, 3H), 1.02-1.07 (m, 2H), 0.83-0.88 (m, 2H).

Example 193: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-((methylsulfonyl)methyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (193)

Step 1: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-((methylthio)methy-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine

To a stirred solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine 134 (0.200 g, 0.406 mmol) and (chloromethyl)(methyl)sulfane (0.078 g, 0.813 mmol) in DMF (2 mL), was added cesium carbonate (0.397 g, 1.219 mmol) at room temperature. The reaction mixture was heated at 100° C. for 2 It Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with ice cold water (100 mL) and extracted with EA (2×100 mL). The combined organic layer was washed with water (3×100 mL), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by preparative HPLC (Method B) to afford the title compound (0.080 g). LC-MS (Method B) (ESI+): m/z 553.20 (M+H)⁺; ¹H-NMR (400) MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 8.06 (s, 1H), 7.67 (d, J=8.31 Hz, 2H), 7.42 (d, J=7.83 Hz, 2H), 5.78 (s, 2H), 5.22 (s, 2H), 3.85 (s, 3H), 2.01 (s, 3H), 1.61-1.69 (m, 1H), 1.03-1.07 (m, 2H), 0.86 (d, J=4.40 Hz, 2H).

Step 2: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-((methylsulfonyl)methyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (193)

To a stirred solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-((methylthio)methyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine 1 (0.070 g, 0.126 mmol) in dioxane:H₂O (3:1 mL), was added Oxone (0.233 g, 0.380 mmol) at room temperature. The mixture was stirred for 1 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with water (50 mL) and extracted with EA (2×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-5% methanol in DCM and was then repurified by preparative HPLC (Method B) purification to afford the title compound (0.018 g). LC-MS (Method B) (ESI+): m/z 585.10 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.99 (s, 1H), 7.69 (d, J=7.98 Hz, 2H), 7.44 (d, J=7.98 Hz, 2H), 5.79 (s, 2H), 5.63 (s, 2H), 3.85 (s, 3H), 3.04 (s, 3H), 1.63-1.70 (m, 1H), 1.03-1.07 (m, 2H), 0.84-0.92 (m, 2H).

Example 194: Synthesis of (2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1N-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-ethyl-1H-imidazol-4-yl)methanol (194)

Step 1: Synthesis of methyl 1-ethyl-1H-imidazole-4-carboxylate

To a stirred solution of methyl 1H-imidazole-4-carboxylate 1 (15.0 g, 119.04 mmol) in DMF (300 mL), was added Cs₂CO₃ (96.7 g, 297.61 mmol) and ethyl iodide (27.8 g, 178.5 (1 mmol) at room temperature. The reaction mixture was heated at 70° C. for 12 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and filtered through a pad of Celite. The filtrate was concentrated under reduced pressure, and the crude compound was purified by silica gel chromatography using 20-90% EA in hexane as eluent to afford the title compound (6.0 g). ¹H-NMR (400 MHz, DMSO-d₆) δ 7.96 (s, 1H), 7.78 (s, 1H), 4.03 (q, J=7.15 Hz, 2H), 3.73 (s, 3H), 1.34 (t, J=7.23 Hz, 3H).

Step 2: Synthesis of methyl 2-bromo-1-ethyl-1H-imidazole-4-carboxylate

To a stirred solution of methyl 1-ethyl-1H-imidazole-4-carboxylate 2 (1.50 g, 9.740 mmol) in DMF (100 mL), was added NBS (1.73 g, 9.740 mmol) at room temperature. The resulting mixture was stirred for 16 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with ice cold water (100 mL) and extracted with EA (2×100 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-5% methanol in DCM as eluent to afford the title compound (1.50 g). LC-MS (Method B) (ESI+): m/z 234.95 (M+H)⁺.

Step 3: Synthesis of methyl 1-ethyl-2-(4-formylphenyl)-1H-imidazole-4-carboxylate

To a stirred solution of methyl 2-bromo-1-ethyl-1H-imidazole-4-carboxylate 3 (1.00 g, 4.291 mmol) in dioxane:H₂O (90:30 mL) was added Cs₂CO₃ (3.42 g, 10.72 mmol) and (4-formylphenyl)boronic acid 4 (0.77 g, 5.149 mmol). The resulting mixture was degassed with argon for 30 man, and then treated with Pd(PPh₃)₄ (0.097 g, 0.085 mmol) at room temperature. The reaction mixture was then heated in a sealed tube at 90° C. for 16 h Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature, diluted with water (50 mL) and extracted with EA (2×50 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 20-80% EA in hexane as eluent to afford the title compound (1.0 g). LC-MS (Method B) (ESI+): m/z 259 (M+H).

Step 4: Synthesis of methyl 1-ethyl-2-(4-(hydroxymethyl)phenyl)-1H-imidazole-4-carboxylate

To a stirred solution of methyl 1-ethyl-2-(4-formylphenyl)-1H-imidazole-4-carboxylate 5 (1.0 g, 3.875 mmol) in methanol (40 mL) at 0° C., was added sodium borohydride (0.073 g, 1.937 mmol). The reaction mixture was allowed to warm to room temperature and stirred for 30 min. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (10 mL) and concentrated under reduced pressure. The remaining residue was dissolved in water (20 mL) and extracted with EA (2×100 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to afford the title compound (0.960 g). LC-MS (Method B) (ESI+): m/z 261 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 7.89 (s, 1H), 7.39-7.44 (m, 2H), 7.31-7.36 (m, 2H), 5.29 (t, J=5.73 Hz, 1H), 4.57 (d, J=5.49 Hz, 2H), 3.82 (q, J=6.98 Hz, 2H), 3.57 (s, 3H), 1.12 (t, J=7.23 Hz, 3H).

Step 5: Synthesis of methyl 2-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-ethyl-1H-imidazole-4-carboxylate

To a stirred solution of methyl 1-ethyl-2-(4-(hydroxymethyl)phenyl)-1H-imidazole-4-carboxylate 6 (0.900 g, 3.461 mmol) in THF (20 mL) at 0° C., was added 6-chloro-1H-pyrazolo[3,4-d]pyrimidine (0.533 g, 3.461 mmol), DEAD (0.887 g, 5.192 mmol) and TPP (1.33 g, 5.192 mmol). The reaction mixture was allowed to warm to room temperature and stirred for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with water (20 mL) and extracted with EA (2×100 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 20-70% EA in hexane as eluent to afford the title compound (1.20 g). LC-MS (Method B) (ESI+): m/z 396.9 (M+H)⁺.

Step 6: Synthesis of methyl 2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-ethyl-1H-imidazole-4-carboxylate

To a stirred solution of methyl 2-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-ethyl-1H-imidazole-4-carboxylate 7 (1.2 g, 3.03 mmol) in dioxane:H₂O (20:4 mL) was added K₃PO₄ (0.320 g, 1.51 mmol) and (4-cyclopropyl-6-methoxypyrimidin-5-yl)boronic acid (BB-4)(1.59 g, 7.58 mmol) at room temperature. The resulting mixture was degassed with argon for 30 min. then treated with X-phos (0.288 g, 0.606 mmol) and X-phos-Pd-G2 (0.118 g, 0.1515 mmol) at room temperature. The mixture was subsequently degassed with argon for 10 min. The reaction mixture was then heated in a sealed tube at 100° C. for 16 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with H₂O (20 mL) and extracted with EA (2×100 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-80% EA in hexane as eluent, followed by concentration in vacuo to afford intermediate 8 (1.50 g). To a stirred solution of 8 (1.50 g) in dioxane (15 mL) was added SP thiol silica (0.150 g). The resulting reaction mixture was heated to 100° C. for 2 h. The reaction mixture was then cooled to room temperature, filtered and concentrated under reduced pressure to afford the title compound (1.20 g). LC-MS (Method B) (ESI+): m/z 511.30 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 7.88 (s, 1H), 7.33-7.39 (m, 4H), 5.78 (s, 2H), 3.85 (s, 3H), 3.78 (q, J=7.01 Hz, 2H), 3.54 (s, 3H), 1.65 (d, J=4.40 Hz, 1H), 1.03-1.12 (m, 5H), 0.85 (dd, J=2.93, 4.40 Hz, 2H).

Step 7: Synthesis of (2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-ethyl-1H-imidazol-4-yl)methanol (194)

To a stirred solution of methyl 2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-ethyl-1H-imidazole-4-carboxylate 8 (0.070 g, 0.1372 mmol) in THF (20 mL) at 0° C., was slowly added a 1.0 M solution of LAH in THF (0.260 mL, 0.260 mmol). The reaction mixture was allowed to warm to room temperature, and then stirred for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with saturated Na₂SO₄ solution (10 mL) and filtered through Celite. The filtrate was concentrated under reduced pressure, and the resulting crude compound was purified by preparative HPLC to afford the title compound (0.025 g). LC-MS (Method B) (ESI+): m/z 483.30 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.69 (s, 1H), 7.36-7.43 (m, 4H), 5.76 (s, 2H), 4.71 (t, J=5.24 Hz, 1H), 4.14 (d, J=4.99 Hz, 2H), 3.87-3.93 (m, 2H), 3.85 (s, 3H), 1.66 (d, J=3.99 Hz, 1H), 1.11 (t, J=6.98 Hz, 3H), 1.04-1.07 (m, 2H), 0.82-0.88 (m, 2H).

The Following Compound was Prepared from the Appropriate Building Blocks According to the Method Described for Example 194:

Example	Structure	Analytical data
195		LC-MS (Method C) (ESI+): m/z 497.20 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.84 (s, 1H), 7.37 (q, J = 7.65 Hz, 4H), 5.76 (s, 2H), 4.66 (t, J = 4.99 Hz, 1H), 4.12 (d, J = 5.49 Hz, 2H), 3.85 (s, 3H), 1.64-1.71 (m, 2H), 1.31 (d, J = 6.98 Hz, 6H), 1.04-1.08 (m, 2H), 0.85 (d, J = 4.49 Hz, 2H).

Example 196: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(difluoromethyl)-1-ethyl-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (196)

Step 1: Synthesis of 2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-ethyl-1H-imidazole-4-carbaldehyde

To an ice cooled solution of (2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-ethyl-1H-imidazol-4-yl)methanol (194) (0.250 g, 0.518 mmol) in DCM (40 mL), was added Dess-Martin periodinane (0.330 g, 0.778 mmol). The reaction mixture was allowed to warm to room temperature, and then stirred for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with saturated NaHCO₃ solution (10 mL) and saturated sodium thiosulfate solution (10 mL), and stirred for 20 min. The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-5% methanol in DCM as eluent to afford the title compound (0.220 g). LC-MS (Method C) (ESI+): m/z 481.30 (M+H)⁺; ¹H-NMR (400 MHz, CDCl₃) δ 9.72 (s, 1H), 9.36 (s, 1H), 8.69 (s, 1H), 8.26 (s, 1H), 7.67 (s, 1H), 7.56 (d, J=7.98 Hz, 2H), 7.37 (d, J=8.48 Hz, 2H), 5.79 (s, 2H), 3.94 (s, 3H), 3.86-3.93 (m, 2H), 1.31 (t, J=7.23 Hz, 3H), 1.23-1.28 (m, 3H), 0.85-0.91 (m, 2H).

Step 2: Synthesis of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(difluoromethyl)-1-ethyl-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (196)

To a stirred solution 2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-ethyl-1H-imidazole-4-carbaldehyde 1 (0.200 g, 0.416 mmol) in DCM (20 mL), was added DAST (0.335 g, 2.08 mmol) at room temperature. The resulting mixture was stirred for 2 h, and progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with saturated NaHCO₃ solution (20 mL) and extracted with DCM (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was first purified by silica gel chromatography using 0-25% EA in hexane as eluent. The impure compound thus obtained was then purified by preparative HPLC (Method B) to afford the title compound (0.035 g). LC-MS (Method B) (ESI+): m/z 503.30 (M+H); ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 7.90 (s, 1H), 7.39 (q, J=7.99 Hz, 4H), 6.47-6.75 (m, 1H), 5.79 (s, 2H), 3.86-3.90 (m, 2H), 3.85 (s, 3H), 1.66 (td, J=3.55, 7.58 Hz, 1H), 1.12 (t, J=7.09 Hz, 3H), 1.03-1.08 (m, 2H), 0.84 (dd, J=2.93, 7.34 Hz, 2H).

The Following Compounds were Prepared from the Appropriate Building Blocks According to the Method Described for Example 196:

Example	Structure	Analytical data
197		LC-MS (Method C) (ESI+): m/z 517.15 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.52 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 8.04 (s, 1H), 7.39-7.42 (m, 2H), 7.32-7.36 (m, 2H), 6.44-6.72 (m, 1H), 5.79 (s, 2H), 4.06 (td, J = 6.73, 13.46 Hz, 1H), 3.85 (s, 3H), 1.62-1.70 (m, 1H), 1.33 (d, J = 6.48 Hz, 6H), 1.05 (d, J = 3.49 Hz, 2H), 0.84 (dd, J = 3.24, 7.73 Hz, 2H).

Example 198: Synthesis of (1-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)methanol (198)

Step 1: Synthesis of 1-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-3-(trifluoromethyl)-1H-pyrazole-5-carboxylic acid

To a stirred solution of 6(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(5-(furan-2-yl)-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,44]pyrimidine (Example 30) (1.00 g, 2.25 mmol) in acetone:water (2:1, 30 mL) was added KMnO₄ (0.707 g, 4.48 mmol) at room temperature. The reaction mixture was then heated at 50° C. for 4 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and diluted with H₂O (50 mL). The suspension was filtered, and the filtrate obtained was concentrated under reduced pressure. The aqueous layer was washed with DCM (2×10 mL) and the pH was adjusted to 5 using IN HCl solution. The solid precipitate was filtered, washed with water and dried in an oven at 60° C. for 2 h to afford the title compound (0.350 g). LC-MS (Method B) (ESI+): m/z 537.30 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.53 (s, 1H), 7.38-7.52 (m, 6H), 5.80 (s, 2H), 3.85 (s, 3H), 1.65 (d, J=3.99 Hz, 1H), 1.02-1.07 (m, 2H), 0.83-0.89 (m, 2H).

Step 2: Synthesis of (1-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-2,3-dihydro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)methanol

To an ice cooled solution of 1-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-3-(trifluoromethyl)-1H-pyrazole-5-carboxylic acid 2 (0.300 g, 0.559 mmol) in THF (10 mL), was added DIPEA (0.145 mL, 0.838 mmol) and isobutyl chloroformate (0.080 mL, 0.62 mmol) drop-wise. The resulting mixture was stirred for 30 min. To the resulting reaction mixture was added sodium borohydride (0.021 g, 0.56 mmol) in one portion at the same temperature. Then the reaction mixture was allowed to warm to room temperature and stirred for an additional 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure, then diluted with EA (20 mL) and water (20 mL). The organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography eluting with 0-10% methanol in DCM to afford the title compound (0.050 g). LC-MS (Method B) (ESI+): m/z 525.30 (M+H)⁺; ¹H-NMR (400 MHz DMSO-d₆) δ8.62 (s, 1H), 7.99 (s, 1H), 7.58 (d, J=8.31 Hz, 2H), 7.35 (d, J=8.31 Hz, 2H), 7.15 (s, 1H), 6.88 (s, 1H), 5.58 (t, J=5.38 Hz, 1H), 5.25 (s, 2H), 4.74 (s, 2H), 4.49 (d, J=5.38 Hz, 2H), 3.93 (s, 3H), 2.10-2.18 (m, 1H), 0.94-1.05 (m, 4H).

Step 3: Synthesis of (1-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)methanol (198)

To a stirred solution of (1-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-2,3-dihydro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)methanol 3 (0.040 g, 0.076 mmol) in toluene (4 mL), was added DDQ (0.026 g, 0.114 mmol) and the reaction mixture was heated at 60° C. for 1 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was concentrated under reduced pressure. Purification of the crude compound by silica gel chromatography using 0-90% EA in hexane as eluent afforded impure compound which was further purified by preparative HPLC purification (Method D) to afford the title compound (0.022 g). LC-MS (Method B) (ESI+): m/z 523.25 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.51 (s, 1H), 8.71 (s, 1H), 8.52 (s, 1H), 7.61 (d, J=7.83 Hz, 2H), 7.46 (d, J=8.31 Hz, 2H), 6.88 (s, 1H), 5.80 (s, 2H), 5.57 (t, J=5.38 Hz, 1H), 4.48 (d, J=5.38 Hz, 2H), 3.85 (s, 3H), 1.62-1.69 (m, 1H), 1.02-1.07 (m, 2H), 0.86 (dd, J=3.18, 7.58 Hz, 2H).

Example 199: Synthesis of 2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-1-isopropyl-1H-imidazol-4-amine (199)

To a stirred solution of 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-isopropyl-4-nitro-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine (Example 73) (0.130 g, 0.254 mmol) in EtOH:H₂O (4:2 mL) was added ammonium chloride (0.067 g, 1.27 mmol) and iron powder (0.069 g, 1.27 mmol) at room temperature. The reaction mixture was heated in a sealed tube at 90° C. for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was cooled to room temperature and concentrated under reduced pressure. The crude residue obtained was diluted with water (10 mL) and extracted with DCM (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-5% MeOH in DCM to afford the title compound (0.550 g). LC-MS (Method B) (ESI+): m/z 482.05 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.49 (s, 1H), 8.71 (s, 1H), 8.50 (s, 1H), 7.46 (s, 1H), 7.36 (d, J=8.48 Hz, 2H), 7.25 (d, J=7.98 Hz; 2H), 5.71 (s, 2H), 4.11-4.18 (m, 1H), 4.09 (s, 2H), 3.85 (s, 3H), 1.27 (d, J=6.48 Hz, 6H), 1.03-1.09 (m, 3H), 0.83-0.89 (m, 2H).

Example 200: Synthesis of 1-(4-(5-(azetidin-3-yloxy)-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine (200)

Step 1: Synthesis of tert-butyl 3-((1-(4-bromophenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)oxy)azetidine-1-carboxylate

To a solution of 1-(4-bromophenyl)-3-(trifluoromethyl)-1H-pyrazol-5-ol (I-39, intermediate 3) (550 mg, 1.63 mmol) in THF (10 mL) at 0° C. was added tert-butyl 3-hydroxyazetidine-1-carboxylate (339 mg, 1.96 mmol) and PS-TPP (2.18 g, 4.52 mmol) in one portion. After the reaction was stirred at 0° C. for 10 min, DIAD (495 mg, 2.45 mmol) was added to the reaction dropwise over 2 min. The reaction was stirred at 0° C. for 10 min, then warmed to room temperature and stirred overnight. After the reaction was complete as indicated by TLC analysis, the mixture was quenched with water (20 mL) and extracted with EA (20 mL×3). The organic layer was dried over sodium sulfate (20 g), filtered and concentrated. The resulting residue was purified by silica gel chromatography (eluent: PE/EA=50/1 to 25/1) to yield 420 mg of the title compound LC-MS (Method A) (ESI+): m/z 462, 464 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.60 (s, 4H), 5.74 (s, 1H), 4.94 (m, 1H), 4.31-4.39 (m, 2H), 4.04-4.19 (m, 2H), 1.45 (s, 9H).

Step 2: Synthesis of tert-butyl 3-(3-(trifluoromethyl)-1-(4-vinylphenyl)-1H-pyrazol-5-yl)oxy)azetidine-1-carboxylate

To a solution of tert-butyl 3-((1-(4-bromophenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)oxy)azetidine-1-carboxylate 2 (370 mg, 0.80 mmol) in toluene (6 mL) was added tributyl(vinyl)stannane (382 mg, 1.20 mmol) and Pd(PPh₃)₄ (92 mg, 0.08 mmol). The reaction was then stirred at 90° C. overnight. After the reaction was complete as indicated by LC-MS analysis, the mixture was quenched with water (10 mL) and extracted with EA (15 mL×2). The combined organic was dried over sodium sulfate (30 g), filtered and concentrated. The resulting residue was purified by silica gel chromatography (eluent: PE/EA=30/1 to 20/1) to yield 300 mg of the title compound. LC-MS (Method A) (ESI+): m/z 410 (M+H); ¹H-NMR (300 MHz, CDCl₃) δ 7.65 (d, J=8.7 Hz, 2H), 7.50 (d, J=8.7 Hz, 2H), 6.78 (m, 1H), 5.75-5.79 (m, 2H), 5.32 (d, J=7.2 Hz, 1H), 4.92 (m, 1H), 4.30-4.39 (m, 21-1), 4.05-4.20 (m, 2H), 1.45 (s, 9H).

Step 3: Synthesis of tert-butyl 3-((1-(4-formylphenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)oxy)azetidine-1-carboxylate

The compound was synthesized according to the procedure for the preparation of common intermediate I-33. LC-MS (Method A) (ESI+): m/z 434.19 (M+Na)⁺.

Step 4: Synthesis of tert-butyl 3-((1-(4-(hydroxymethyl)phenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)oxy)azetidine-1-carboxylate

The compound was synthesized according to the procedure for the preparation of common intermediate I-33. LC-MS (Method A) (ESI+): m/z 414 (M+Na)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.68 (d, J=8.1 Hz, 2H), 7.48 (d, J=8.1 Hz, 2H), 5.75 (s, 1H), 4.94 (m, 1H), 4.76 (d, J=5.4 Hz, 2H), 4.30-4.35 (m, 2H), 4.04-4.13 (m, 2H), 1.85 (m, 1H), 1.45 (s, 9H).

Step 5: Synthesis of tert-butyl 34(1-(4-((6-chloro-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)oxy)azetidine-1-carboxylate

The compound was synthesized according to the procedure for the preparation described in Example 148. LC-MS (Method A) (ESI+): m/z 572.00 (M+Na)⁺.

Step 6: Synthesis of 3-(1-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)oxy)azetidine-1-carboxylate

The compound was synthesized according to procedure of General Experimental Procedure 1. LC-MS (Method A) (ESI+): m/z 664 (M+H)⁺.

Step 7: Synthesis of 1-(4-(5-(azetidin-3-yloxy)-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine (200)

To a solution of tert-butyl 3-((1-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl) phenyl)-3-(trifluoromethyl)-1H-pyrazol-5-yl)oxy)azetidine-1-carboxylate 9 (90 mg, 0.14 mmol) in DCM (10 mL) and TFA (1 mL) was stirred at rt for 1 h. After the reaction was complete as indicated by TLC analysis, the mixture was quenched with water (10 mL) and the pH was adjusted to 8 with a sodium carbonate solution. The mixture was extracted with DCM (10 mL×3), and the organic layer was dried over sodium sulfate (30 g), filtered and concentrated. The residue was purified by preparative HPLC (Method A) to afford 24.6 mg of the title compound. LC-MS (Method A) (ESI+): m/z 564 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ9.40 (s, 1H), 8.64 (s, 1H), 8.41 (s, 1H), 7.68 (d, J=8.4 Hz, 2H), 7.51 (d, J=8.4 Hz, 2H), 6.06 (s, 1H), 5.79 (s, 2H), 5.12 (m, 1H), 3.95-4.02 (m, 2H), 3.92 (s, 3H), 3.65-3.71 (m, 2H), 1.65 (m, 1H), 1.09-1.19 (m 2H), 0.85-0.92 (m, 2H).

Example 201: Synthesis of 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine (201)

Step 1: Synthesis of 2-chloro-7-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine

To an ice cooled solution of 2-chloro-7H-pyrrolo[2,3-d]pyrimidine (0.140 g, 0.914 mmol) in DMF (5 mL) was added 60% dispersion of sodium hydride in oil (0.073 g, 1.83 mmol) portion-wise. The resulting mixture was stirred for 30 min and was then treated with 2-(4-bromomethyl)phenyl)-1-methyl-4-(trifluoromethyl)-1H-imidazole 1 (0.292 g, 0.914 mmol). The mixture was further stirred for 2 h at room temperature. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with ice water (10 mL) and extracted with EA (2×25 mL). The combined organic layer was washed with cold water (10 mL) followed by brine (10 mL), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 30-50% EA in n-hexane to afford the title compound (0.260 g). LC-MS (Method B) (ESI+): m/z 391.90 (M+H)⁺.

Step 2: Synthesis of 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine (201)

To a stirred solution of 4-cyclopropyl-6-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrin id ne BB-4 (0.243 g, 0.880 mmol) and 2-chloro-7-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine 2 (0.230 g, 0.587 mmol) in ethanol:H₂O (102 mL) was added Na₂CO₃ (0.186 g, 1.76 mmol) at room temperature. The resulting mixture was degassed with argon for 10 min and then treated with Pd(PPh₃)₄ (0.034 g, 0.029 mmol) at room temperature. The mixture was further degassed with argon for 5 min, and then heated in microwave at 100° C. for 2 h. Progress of the reaction was monitored by TLC. After completion, the reaction mixture was diluted with EA (25 mL) and filtered through a pad of Celite. The organic layer was separated, washed with brine, dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by silica gel chromatography using 0-50% EA in n-hexane followed by repurification by preparative HPLC (Method B) to afford the title compound (0.032 g). LC-MS (Method B) (ESI+): m/z 506.15 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.16 (s, 1H), 8.67 (s, 1H), 7.92 (s, 1H), 7.85 (d, J=3.42 Hz, 1H), 7.66 (d, J=7.83 Hz, 2H), 7.40 (d, J=8.31 Hz, 2H), 6.76 (d, J=3.42 Hz, 1H), 5.57 (s, 2H), 3.83 (s, 3H), 3.73 (s, 3H), 1.60-1.66 (m, 1H), 1.00-1.04 (m, 2H), 0.81 (dd, J=3.18, 7.58 Hz, 2H).

Example 202: General Procedure for the Synthesis of Imidazolopyrimidines. Preparation of 2-(2-Isopropylphenyl)-9-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-purine (202)

Step 1: Synthesis of 4-(4-(Trifluoromethyl)-1H-imidazol-2-yl)benzonitrile

A mixture of 3,3-dibromo-1,1,1-trifluoropropan-2-one 1 (3.06 g, 11.3 mmol) and NaOAc (0.93 g, 11.3 mmol) in water (3 ml) was stirred at 100° C. for 1 hour. The reaction was cooled to room temperature and a mixture of 4-formylbenzonitrile 2 (1.5 g, 11.3 mmol) in methanol (50 ml) and NH₄OH (10 ml) were added to the reaction subsequently. The resulting reaction mixture was stirred at room temperature for 40 man, and then at 100° C. for 2 hours. The mixture was then cooled to room temperature and quenched with water (100 mL), and then extracted with EA (100 mL×2). The combined organic layer was dried with Na₂SO₄ (30 g), filtered and concentrated to dryness to afford the crude product that was purified by column chromatography (eluent: EA/n-Hex=1:10 to 1:5) to afford 1.5 g of the title compound. LC-MS (Method A) (ESI+): m/z 238 (M+H)⁺; ¹H-NMR (300 MHz, DMSO-d₆) δ 13.55 (br s, 1H), 8.14 (d, J=8.1 Hz, 1H), 8.07 (s, 1H), 7.97 (d, J=8.1 Hz, 1H).

Step 2: Synthesis of 4-(1-Methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzonitrile

To a solution of 4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzonitrile 3 (1.37 g, 5.8 mmol) in THF (15 mL) at 0° C., was added NaH (290 mg, 7.25 mmol) portion-wise over 2 min. After addition, the resulting suspension was stirred at 0° C. for 1 hour. MeI (1.03 g, 7.25 mmol) was then added dropwise over 2 min, and the mixture was stirred at 0° C. for an additional 2.5 hours. The reaction was then quenched with a saturated NH₄Cl solution (30 mL) and extracted with EA (50 mL×2). The combined organic layer was dried with Na₂SO₄ (30 g), filtered and concentrated to dryness. The residue was purified by column chromatography (eluent: EA/n-Hex=1:10 to 1:5) to afford 700 mg of the title compound. LC-MS (Method A) (ESI+): m/z 252 (M+H); ¹H-NMR (300 MHz, CDCl₃) δ 7.76-7.83 (m, 4H), 7.38 (s, 1H), 3.83 (s, 3H).

Step 3: Synthesis of (4-(1-Methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanamine

A suspension of 4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzonitrile 4 (2.5 g, 9.9 mmol) and Raney Ni (2 g, wet solid) in EA (100 mL) and NH₃·H₂O (0.5 mL), was hydrogenated using a H₂ balloon (1 atm). After the reaction was stirred at room temperature for 2.5 hours, the suspension was filtered through a pad of Celite. The filter cake was washed with EA (10 mL), and the filtrate was concentrated to dryness to afford 2.5 g of the crude title compound. LC-MS (Method A) (ESI+): m/z 256 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.60 (d, J=8.1 Hz, 1H), 7.46 (d, J=8.1 Hz, 1H), 7.31 (s, 1H), 3.95 (s, 2H), 3.77 (s, 3H).

Step 4: Synthesis of 2-Chloro-N-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-5-nitropyrimidin-4-amine

A mixture of (4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)methanamine 5 (0.87 g, 3.4 mmol), 2,4-dichloro-5-nitropyrimidine 6 (0.66 g, 3.4 mmol) and DIEA (0.88 g, 6.8 mmol) in DMF (12 mL) was stirred at rt for 30 min. The mixture was then quenched with water and extracted with EA (50 mL×3). The combined organic layer was washed with water (30 mL), dried over anhydrous Na₂SO₄ (30 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (eluent: EA n-Hex=1:20 to 1:4) to give 480 mg of the title compound. ¹H-NMR (300 MHz, CDCl₃) δ 9.09 (s, 1H), 8.74 (br s, 1H), 7.66 (d, J=8.1 Hz, 2H), 7.48 (d, J=8.1 Hz, 2H), 7.33 (s, 1H), 4.91 (d, J=6.0 Hz, 2H), 3.79 (s, 3H).

Step 5: Synthesis of 2-(2-Isopropylphenyl)-N-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-5-nitropyrimidin-4-amine

A mixture of 2-chloro-N-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl) benzyl)-5-nitropyrimidin-4-amine 7 (0.30 g, 0.74 mmol), K₃PO₄ (0.47 g, 2.2 mmol), Pd(dppf)Cl₂ (121 mg, 20 mol %) and (2-isopropylphenyl)boronic acid (0.24 g, 1.5 mmol) in DME (18 mL) was stirred at 80° C. for 3 hours. The mixture was then cooled to room temperature and diluted with water (20 mL), and subsequently extracted with EA (50 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (20 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (eluent: EA:n-Hex=1:10 to 1:5) to give 300 mg of the title compound LC-MS (Method A) (ESI): m/z 497 (M+H)⁺.

Step 6: Synthesis of 2-(2-Isopropylphenyl)-N4-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)pyrimidine-4,5-diamine

To a solution of 2-(2-isopropylphenyl)-N-(4-(1-methyl-4-(trifluromethyl)-1H-imidazol-2-yl)benzyl)-5-nitropyrimidin-4-amine 8 (0.28 g, 0.56 mmol) in EtOH (30 mL), was added FeCl₃ (18 mg, 0.11 mmol), N₂H₄ (1.13 g, 17.9 mmol) and charcoal (0.11 g) under N₂ atmosphere. The resulting mixture was stirred at 70° C. for 2 hours, and then the suspension was filtered through a pad of Celite. The filter cake was washed with EA (30 mL). The filtrate was diluted with water (50 mL) and extracted with EA (50 mL×3). The combined organic layer was washed with water (20 mL) and dried over anhydrous Na₂SO₄ (30 g), filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (eluent: EA:n-Hex=1:10 to 2:1) to give 330 mg of the title compound. LC-MS (Method A) (ESI+): m/z 467 (M+H)⁺.

Step 7: Synthesis of 2-(2-Isopropylphenyl)-9-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-purine (202)

To a solution of 2-(2-isopropylphenyl)-N4-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl) benzyl)pyrimidine-4,5-diamine 9 (60 mg, 0.13 mmol) in dioxane (4.8 mL), was added methanesulfonic acid (0.30 mg, 2.5%) and trimethoxymethane (1.2 mL) in one portion. After addition, the reaction was stirred at 80° C. for 1 hour. The reaction was then cooled to room temperature, quenched with water (10 mL), and extracted with EA (20 mL×3). The combined organic layer was dried over anhydrous Na₂SO₄ (20 g), filtered and concentrated in vacuo. The residue was purified by preparative HPLC (Method A) to give 28 mg of the title compound. LC-MS (Method A) (ESI+): m/z 477 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 9.18 (s, 1H), 8.69 (s, 1H), 7.64-7.68 (m, 3H), 7.53-7.56 (m, 3H), 7.40-7.48 (m, 2H), 7.27 (m, 1H), 5.66 (s, 2H), 3.74 (s, 3H), 3.37 (m, 1H), 1.16 (d, J=6.9 HA 6H).

The Following Compound was Prepared According to the General Experimental Procedure 202:

Example	Structure	Analytical data
203		LC-MS (Method A) (ESI+): m/z 507 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.23 (s, 1H), 8.75 (s, 1H), 8.63 (s, 1H), 7.64-7.69 (m, 3H), 7.58 (d, J = 8.1 Hz, 2H), 5.67 (s, 2H), 3.90 (s, 3H), 3.75 (s, 3H), 1.65 (m, 1H), 1.13-1.15 (m, 2H), 0.85-0.88 (m, 2H).
204		LC-MS (Method C) (ESI+): m/z 535.15 (M + H)+; 1H-NMR (400 MHz, DMSO-d6) δ 9.32 (s, 1H), 8.86 (s, 1H), 8.68 (s, 1H), 8.17 (s, 1H), 7.48-7.57 (m, 4H), 5.63 (s, 2H), 4.41 (td, J = 6.48, 12.96 Hz, 1H), 3.83 (s, 3H), 1.58-1.65 (m, 1H), 1.37 (d, J = 6.48 Hz, 6H), 1.00-1.05 (m, 2H), 0.77-0.84 (m, 2H).

Example 205: Preparation of 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-ethyl-9-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-purine (205)

Synthesis of 2-chloro-N4-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)pyrimidine-4,5-diamine

The compound was synthesized according to General Experimental Procedure 202. LC-MS (Method A) (ESI+): m/z 411 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.59 (s, 1H), 7.47 (d, J=8.4 Hz, 2H), 7.39-7.42 (m, 3H), 5.61 (br s, 1H), 4.71 (d, J=5.7 Hz, 2H), 4.49-4.58 (m, 1H), 3.22 (br s, 2H), 1.45 (d, J=6.6 Hz, 6H).

Step 1: Synthesis of N-(2-chloro-4-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)amino)pyrimidin-5-yl)propionamide

To a solution of 2-chloro-N⁴-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)pyrimidine-4,5-diamine 1 (250 mg, 0.61 mmol) in anhydrous THF (10 mL) was added propionyl chloride (65 mg, 0.70 mmol) dropwise over 2 min. The resulting mixture was stirred at rt for 1 h. After the reaction was completed as indicated by TLC analysis, the reaction was quenched with an aqueous NaHCO₃ solution (10 mL) and extracted with EA (20 mL×2). The combined organic layer was dried with Na₂SO₄, filtered and concentrated. The residue was purified by silica gel chromatography (PE/EA=3/1 to 1/1) to provide 320 mg of the title compound. LC-MS (Method A) (ESI+): m/z 467 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ8.27 (s, 1H), 7.98 (s, 1H), 7.44 (s, 1H), 7.31-7.38 (m, 4H), 6.13 (m, 1H), 4.65 (d, J=5.7 Hz, 2H), 4.48 (m, 1H), 2.40 (q, J=7.5 Hz, 2H), 1.41-1.46 (d, J=6.6 Hz, 6H), 1.25 (t, J=7.5 Hz, 3H).

Step 2: Synthesis of N-(4′-cyclopropyl-4-((4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)amino)-6′-methoxy-[2,5′-bipyrimidin]-5-yl) propionamide

The compound was synthesized according to General Experimental Procedure 1. LC-MS (Method A) (ESI+): m/z 581 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 8.60 (s, 1H), 8.26 (s, 1H), 7.40-7.42 (m, 6H), 6.10 (m, 1H), 4.75 (d, J=5.4 Hz, 2H), 4.50 (m, 1H), 3.91 (s, 3H), 2.43 (q, J=7.2 Hz, 2H), 2.10-2.13 (m, 1H), 1.41-1.46 (m, 6H), 1.26-1.28 (m, 4H), 0.85-0.89 (m, 2H).

Step 3: Synthesis of 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-ethyl-9-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-purine (205)

A solution of N-(4′-cyclopropyl-4-((4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)amino)-6′-methoxy-[2,5′-bipyrimidin]-5-yl)propionamide 3 (80 mg, 0.14 mmol) in AcOH (5 mL) was stirred at reflux for 7 It After the reaction was complete as indicated by TLC analysis, the reaction was concentrated to dryness. The residue was dissolved in EA (50 mL) was washed with an aqueous NaHCO₃ solution (20 mL). The organic layer was dried, filtered and concentrated to give a crude product. The crude product was purified by preparative HPLC (Method A) to give 57 mg of the title compound LC-MS (Method A) (ESI+): m/z 563 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 9.11 (s, 1H), 8.61 (s, 1H), 7.91 (s, 1H), 7.54 (d, J=8.1 Hz, 2H), 7.44 (d, J=8.1 Hz, 2H), 5.67 (s, 2H), 4.52 (m, 1H), 3.91 (s, 3H), 3.03 (q, J=7.5 Hz, 21H), 1.68 (m, 1H), 1.38-1.44 (m, 9H), 1.10-1.18 (m, 2H), 0.84-0.92 (m, 2H).

The Following Compounds were Prepared According to the General Experimental Procedure 205:

Example	Structure	Analytical data
206		LC-MS (Method A) (ESI+): m/z 521 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.10 (s, 1H), 8.62 (s, 1H), 7.61-7.70 (m, 3H), 7.46 (d, J = 8.1 Hz, 2H), 5.65 (s, 2H), 3.91 (s, 3H), 3.75 (s, 3H), 2.70 (s, 3H), 1.65-1.75 (m, 1H), 1.10-1.19 (m, 2H), 0.85-0.93 (m, 2H).
207		LC-MS (Method A) (ESI+): m/z 579 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.26 (s, 1H), 8.67 (s, 1H), 7.51 (d, J = 7.5 Hz, 2H), 7.40-7.44 (m, 3H), 5.67 (s, 2H), 4.70 (s, 2H), 4.48 (m, 1H), 3.94 (s, 3H), 3.42 (s, 3H), 1.65-1.70 (m, 1H), 1.43 (d, J = 6.6 Hz, 6H), 1.20-1.30 (m, 2H), 0.85-0.89 (m, 2H).
208		LC-MS (Method A) (ESI+): m/z 577 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.11 (s, 1H), 8.61 (s, 1H), 7.90 (s, 1H), 7.54 (d, J = 8.4 Hz, 2H), 7.43 (d, J = 8.4 Hz, 2H), 5.72 (s, 2H), 4.50 (m, 1H), 3.91 (s, 3H), 3.45 (m, 1H), 1.64-1.72 (m, 1H), 1.42 (d, J = 6.6 Hz, 6H), 1.36 (d, J = 6.9 Hz, 6H), 1.12-1.20 (m, 2H), 0.83-0.90 (m, 2H).

Example 209: Synthesis of 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-ethyl-9-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-9H-purine (209)

Step 1: Synthesis of 4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzonitrile

The compound was synthesized according to the procedure for the preparation of common intermediate I-19. LC-MS (Method A) (ESI+): m/z 252 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.79-7.85 (d, J=8.7 Hz, 2H), 7.65 (d, J=8.7 Hz, 2H), 6.53 (s, 1H), 2.45 (s, 3H).

Step 2: Synthesis of (4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)phenyl)methanamine

The compound was synthesized according to the procedure of Example 202. LC-MS (Method A) (ESI+): m/z 256 (M+H); ¹H-NMR (300 MHz, CDCl₃) δ 7.39-7.47 (m, 4H), 6.46 (s, 1H), 3.96 (s, 2H), 2.34 (s, 3H).

Step 3: Synthesis of 2-chloro-N-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-5-nitropyrimidin-4-amine

The compound was synthesized according to the procedure of Example 202. LC-MS (Method A) (ESI+): m/z 413 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.10 (s, 1H), 8.73 (s, 1H), 7.45-7.53 (m, 4H), 6.48 (s, 1H), 4.91 (d, J=6.0 Hz, 2H), 2.37 (s, 3H).

Step 4: Synthesis of 2-chloro-N4-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)pyrimidine-4,5-diamine

The compound was synthesized according to the procedure of Example 202. LC-MS (Method A) (ESI+): m/z 383 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 7.65 (s, 1H), 7.48 (d, J=8.4 Hz, 2H), 7.41 (d, J=8.4 Hz, 2H), 6.47 (s, 1H), 5.43 (br s, 1H), 4.74 (d, J=5.7 Hz, 2H), 3.07 (br s, 2H), 2.36 (s, 3H).

Step 5: Synthesis of N-(2-chloro-4-((4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)amino)pyrimidin-5-yl)propionamide

The compound was synthesized according to the procedure of Example 205. LC-MS (Method A) (ESI+): m/z 439 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 8.23 (s, 1H), 7.58 (d, J=8.4 Hz, 2H), 7.49 (d, J=8.4 Hz, 2H), 6.59 (s, 1H), 4.84 (s, 2H), 2.49 (q, J=7.5 Hz, 2H), 2.34 (s, 3H), 1.20 (t, J=7.5 Hz, 3H).

Step 6: Synthesis of N-(4′-cyclopropyl-6′-methoxy-4-((4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)amino)-[2,5′-bipyrimidin]-5-yl)propionamide

The compound was synthesized according to Example 205. LC-MS (Method A) (ESI+): m/z 553 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 8.53 (s, 1H), 8.18 (s, 1H), 7.53 (d, J=8.4 Hz, 2H), 7.42 (d, J=8.4 Hz, 2H), 6.57 (s, 1H), 4.78 (s, 2H), 3.88 (s, 3H), 2.52 (q, J=7.5 Hz, 2H), 2.32 (s, 3H), 1.72 (m, 1H), 1.24 (t, J=7.5 Hz, 3H), 1.03-1.10 (m, 2H), 0.78-0.92 (m, 2H).

Step 7: Synthesis of 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-ethyl-9-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-9H-purine (209)

The compound was synthesized according to the procedure of Example 205. LC-MS (ESI+): m/z 535 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ9.11 (s, 1H), 8.61 (s, 1H), 7.44-7.52 (m, 4H), 6.57 (s, 1H), 5.67 (s, 2H), 3.91 (s, 3H), 3.04 (q, J=7.2 Hz, 2H), 2.32 (s, 3H), 1.68 (m, 1H), 1.41 (t, J=7.2 Hz, 3H), 1.10-1.16 (m, 2H), 0.84-0.89 (m, 2H).

The Following Examples were Prepared According to the Procedure of Example 209 Using Either Trimethylorthoformate or the Appropriate Acid Chlorides

Example	Structure	Analytical data
210		LC-MS (Method A) (ESI+): m/z 507 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.23 (s, 1H), 8.76 (s, 1H), 8.62 (s, 1H), 7.61 (d, J = 8.1 Hz, 2H), 7.51 (d, J = 8.4 Hz, 2H), 6.57 (s, 1H), 5.68 (s, 2H), 3.90 (s, 3H), 2.32 (s, 3H), 1.62 (m, 1H), 1.10-1.18 (m, 2H), 0.85-0.91 (m, 2H).
211		LC-MS (Method A) (ESI+): m/z 521 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.10 (s, 1H), 8.62 (s, 1H), 7.40-7.55 (m, 4H), 6.58 (s, 1H), 5.67 (s, 2H), 3.91 (s, 3H), 2.71 (s, 3H), 2.33 (s, 3H), 1.69 (m, 1H), 1.10-1.19 (m, 2H), 0.85-0.91 (m, 2H).
212		LC-MS (Method A) (ESI+): m/z 549 (M + H)+; 1H-NMR (300 MHz, CD3OD) δ 9.11 (s, 1H), 8.61 (s, 1H), 7.53 (d, J = 8.1 Hz, 2H), 7.46 (d, J = 8.1 Hz, 2H), 6.58 (s, 1H), 5.72 (s, 2H), 3.91 (s, 3H), 3.42 (m, 1H), 2.32 (s, 3H), 1.66 (m, 1H), 1.36 (d, J = 6.9 Hz, 6H), 1.10-1.18 (m, 2H), 0.84-0.92 (m, 2H).
213		LC-MS (Method A) (ESI+): m/z 547 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.13 (s, 1H), 8.66 (s, 1H), 7.44 (s, 4H), 6.48 (s, 1H), 5.66 (s, 2H), 3.81 (s, 3H), 2.32 ( s, 3H), 1.99 (m, 1H), 1.78 (m, 1H), 1.29-1.33 (m, 2H), 1.1.15-1.26 (m, 4H), 0.82-0.91 (m, 2H).
214		LC-MS (Method A) (ESI+): m/z 561 (M + H)+; 1H-NMR (300 MHz, CDCl3) δ 9.25 (s, 1H), 8.66 (s, 1H), 7.42 (d, J = 8.4 Hz, 2H), 7.33 (d, J = 8.4 Hz, 2H), 6.46 (s, 1H), 5.48 (s, 2H), 3.92 (s, 3H), 3.69 (m, 1H), 2.51-2.62 (m, 2H), 2.35-2.42 (m, 2H), 2.31 (m, 3H), 2.05-2.21 (m, 2H), 1.68 (m, 1H), 1.19-1.26 (m, 2H), 0.81-0.91 (m, 2H).

Example 215: Synthesis of 5-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-3-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3H-[1,2,3]triazolo[4,5-d]pyrimidine (215)

Step 1: Synthesis of 5-chloro-3-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3H-[1,2,3]triazolo[4,5-d]Pyrimidine

To a stirred solution of 2-chloro-N⁴-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl) pyrimidine-4,5-diamine 1 (0.500 g, 1.31 mmol) in DMF (5 mL) was added isoamyl nitrile (0.229 g, 1.96 mmol) at room temperature. The reaction mixture was heated at 50° C. for 2 h. Progress of the reaction was monitored by TLC and LCMS. After completion, the reaction mixture was quenched with saturated Na₂CO₃ solution (20 mL) slowly under stirring and extracted with EA (2×10 mL). The combined organic layer was washed with ice cold water (10 mL), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by trituration with diethyl ether (20 mL), filtered and dried to afford the title compound (0.380 g). LC-MS (Method B) (ESI+): m/z 394.25 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.78 (s, 1H), 7.94 (s, 1H), 7.73 (d, J=8.31 Hz, 2H), 7.51 (d, J=8.31 Hz, 2H), 6.03 (s, 2H), 3.76 (s, 3H).

Step 2: Synthesis of 5-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-3-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3H-[1,2,3]triazolo[4,5-d]pyrimidine (215)

To a stirred solution of 5-chloro-3-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3H-[1,2,3]triazolo[4,5-d]pyrimidine 2 (0.150 g, 0.380 mmol) in dioxane:H₂O (5:1 mL) was added cesium carbonate (0.308 g, 0.950 mmol), 4-cyclopropyl-6-methoxy-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine BB-4 (0.157 g, 0.571 mmol) at room temperature. The resulting mixture was degassed with argon for 10 min, and then treated with Pd(PPh₃)₄ (0.065 g, 0.057 mmol) at room temperature. The mixture was further degassed with argon for 10 min, and then heated at 90° C. for 16 It Progress of the reaction was monitored by TLC. After completion, the reaction mixture was quenched with H₂O (20 mL) and extracted with EA (2×20 mL). The combined organic layer was dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The crude compound was purified by preparative HPLC (Method D) to afford the title compound (0.050 g). LC-MS (Method B) (ESI+): m/z 508.20 (M+H)⁺; ¹H-NMR (400 MHz, DMSO-d₆) δ 9.94 (s, 1H), 8.73 (s, 1H), 7.93 (s, 1H), 7.72 (d, J=8.31 Hz, 2H), 7.54 (d, J=8.31 Hz, 2H), 6.09 (s, 2H), 3.85 (s, 3H), 3.75 (s, 3H), 1.69 (td, J=3.79, 8.07 Hz, 1H), 1.05-1.09 (m, 2H), 0.85 (dd, J=2.93, 7.83 Hz, 2H).

Example 216 and 217: Synthesis of 5-bromo-2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3-fluor-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine (216) and 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3-fluoro-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-5,7-dihydro-6H-pyrrolo[2,3-d]pyrimidin-6-one (217)

Step 1: Synthesis of 2-chloro-7-(3-fluoro-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine

The compound was synthesized according to the general procedure for the synthesis of common intermediate 1-8. LC-MS (Method A) (ESI+): m/z 438 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 8.86 (s, 1H), 7.53 (t, J=7.5 Hz, 1H), 7.44 (s, 1H), 7.19 (s, 1H), 7.12 (d, J=7.8 Hz, 1H), 6.97 (d, J=10.2 Hz, 1H), 6.65 (d, J=3.6 Hz, 1H), 5.49 (s, 2H), 4.23 (m, 1H), 1.41 (d, J=6.6 Hz, 6H).

Step 2: Synthesis of 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3-fluoro-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine

The compound was synthesized according to General Experimental Procedure 1. LC-MS (Method A) (ESI+): m/z 552 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 9.16 (s, 1H), 8.66 (s, 1H), 7.52 (t, J=7.2 Hz, 1H), 7.43 (s, 1H), 7.28 (s, 1H), 7.20 (d, J=8.1 Hz, 1H), 7.10 (d, J=9.6 Hz, 1H), 6.69 (d, J=3.6 Hz, 1H), 5.54 (s, 2H), 4.19 (m, 1H), 3.93 (s, 3H), 1.72 (m, 1H), 1.40 (d, J=6.6 Hz, 6H), 1.19-1.25 (m, 2H), 0.82-0.89 (m, 2H).

Step 2: Synthesis of 5,5-dibromo-2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3-fluoro-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-5,7-dihydro-6H-pyrrolo[2,3-d]pyrimidin-6-one (6) and 5-bromo-2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3-fluoro-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine (216)

A solution of 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3-fluoro-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine (60 mg, 0.11 mmol) in AcOH (1 mL) and t-BuOH (2 ml) was added pyridinium bromide perbromide (104 mg, 0.33 mmol) in one portion. The resulting mixture was stirred at rt for 5 h. After the reaction was complete as indicated by TLC analysis, the reaction was concentrated to dryness. The residue was dissolved in EA (10 mL) and washed with an aqueous NaHCO₃ solution (10 mL). The organic layer was dried, filtered and concentrated. The residue was purified by flash silica chromatography (PE/EA=2/1) to provide 14 mg of (5-bromo-2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3-fluoro-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine) 216 and 47 mg of 5,5-dibromo-2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3-fluoro-4-(1-isopropyl-4-(trifluoro methyl)-1H-imidazol-2-yl)benzyl)-5,7-dihydro-6H-pyrrolo[2,3-d]pyrimidin-6-one 6 containing some impurities.

Analytical data of 5-bromo-2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3-fluoro-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine 216: LC-MS (Method A) (ESI+): m/z 630 (M+H)⁺; ¹H-NMR (300 MHz, CD₃OD) δ 9.03 (s, 1H), 8.62 (s, 1H), 7.96 (s, 1H), 7.87 (s, 1H), 7.48 (t, J=7.5 Hz, 1H), 7.31 (d, J=9.0 Hz, 1H), 5.62 (s, 2H), 4.21 (m, 1H), 3.91 (s, 3H), 1.66 (m, 1H), 1.40 (d, J=6.6 Hz, 6H), 1.19-1.25 (m, 2H), 0.82-0.89 (m, 2H).

Analytical data of 5,5-dibromo-2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3 fluoro-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2 yl)benzyl)-5,7-dihydro-6H-pyrrolo[2,3-d]pyrimidin-6-one 6. LC-MS (Method A)(ESI+): m/z 724,726,728 (M+H)⁺.

Step 4: Synthesis of 2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3-fluoro-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-5,7-dihydro-6H-pyrrolo[2,3-d]pyrimidin-6-one (217)

A solution of 5,5-dibromo-2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(3-fluoro-4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-5,7-dihydro-6H-pyrrolo[2,3-d]pyrimidin-6-one 6 (47 mg, 0.065 mmol) in THF (1.5 mL) and a saturated aqueous NH₄Cl solution (1.5 ml) was added Zn powder (65 mg, 0.26 mmol) in one portion. The resulting mixture was stirred at rt for 1.5 h. After the reaction was complete as indicated by TLC analysis, the reaction was quenched with H₂O (1 mL) and extracted with EA (3 mL×3). The combined organic layer was dried with Na₂SO₄, filtered and concentrated. The residue was purified by preparative HPLC (Method A) to give 7 mg of the title compound. LC-MS (Method A) (ESI+): m/z 568 (M+H)⁺; ¹H-NMR (300 MHz, CDCl₃) δ 8.66 (s, 1H), 8.52 (s, 1H), 7.35-7.52 (m, 4H), 5.02 (s, 2H), 4.23 (m, 1H), 3.93 (s, 3H), 3.68 (s, 2H), 1.75 (m, 1H), 1.40 (d, J=6.6 Hz, 6H), 1.22-1.26 (m, 2H), 0.87-0.95 (m, 2H).

Example 218

Deubiquitination Assay for USP1/UAF1 Activity and Inhibitor Testing

Certain Compounds of the Disclosure were assessed for USP1/UAF1 activity in a Ubiquitin Rhodamine assay modified from those described previously.

Deubiquitinase activity was measured using ubiquitin-rhodamine 110 as a substrate. Cleavage of the amide bond between rhodamine and the c-terminal glycine of ubiquitin yields an increase in fluorescence signal. The assay was conducted in 20 ul total volume of assay buffer (50 mM Tris-HCl, pH 7.8, 0.5 mM EDTA, 0.01% Bovine Serum Albumin, 1 mM DTT, 0.01% Tween-20), and 0.05 nM USP1/UAF1 enzyme. Reaction was initiated by addition of 150 nM Ubiquitin-rhodamine (Boston Biochem) substrate.

Compounds, dissolved in DMSO were tested in dose response format, beginning at 10 uM.

Compounds depicted below were added to enzyme/assay buffer mix and incubated 10 min. Substrate mix was added, and reaction mix was read in kinetic mode for 30 min at Ex480/Em540 and IC50 response curves were plotted.

Data for all assay formats was calculated as percent inhibition compared with control wells. Percent inhibition was calculated using the following equation: % inhibition=100× [1−(X−min)/(max−min)], where X is the raw data readout, min is the average of the no enzyme control wells (n=32), max is the average of the DMSO control well (n=32). IC₅₀ values were calculated using the standard four parameter curve fitting algorithm in either Prism GraphPad (La Jolla, Calif.) software, or Collaborative Drug Discovery (Burlingame, Calif.) CDD Vault. See Chem. Biol. 20(1): 55-62 (Jan. 24, 2013); Bioorg. Med. Chem. Lett. 23(20): 5660-5666 (Oct. 15, 2013).

The following Compounds of the Disclosure inhibit USP1 activity with the IC₅₀ values shown in Table 2, Table 3, and Table 4 below.

TABLE 2
Compound Structure USP1 IC50
                   +
                   ++
                   ++
                   ++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   ++++
                   ++++
                   ++++
                   ++++
                   ++++
                   ++++
                   ++++
                   ++++
USP1 IC50 50: “+” indicates 200 nM or greater; “++” indicates 100 nM to less than 200 nM; “+++” indicates 10 nM to less than 100 nM; “++++” indicates less than 10 nM.

TABLE 3
Compound Structure USP1 IC50
                   ++++
                   ++++
                   ++++
                   ++++
                   ++++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   ++
                   ++
                   ++
                   ++
                   ++
                   +
                   +
                   +
                   +
                   +
                   +
                   +
                   +
                   +
                   +
                   +
                   +
                   +
                   N/A
USP1 IC50:
“+” indicates 200 nM or greater; “++” indicates 100 nM to less than 200 nM; “+++” indicates 10 nM to less than 100 nM; “++++” indicates less than 10 nM.

TABLE 4
Compound Structure USP1 IC50
                   N/A
                   +++
                   +++
                   +++
                   ++++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   +++
                   ++
                   +++
                   +++
                   ++
                   +++
                   +++
                   +++
                   +++
                   +
                   ++
                   ++
                   +++
USP1 IC50 50: “+” indicates 200 nM or greater; “++” indicates 100 nM to less than 200 nM; “+++” indicates 10 nM to less than 100 nM; “++++” indicates less than 10 nM.

Example 219

P53 and BRCA Mutations Correlate with Sensitivity to USP1 Inhibitors

To identify cancers that are sensitive to USP1 inhibitors, p53 mutation status and BRCA mutation status were evaluated in cancer cell lines that were either sensitive or insensitive to USP1 inhibitors.

In these experiments, two different assay formats were used. The first assay format, termed the long-term proliferation assay (LTP), involved plating cancer cell lines in 6-well plates at very low density in a media volume of 3 ml with the goal of not splitting for at least 10 days (typically 5k-20k cells/well). Cells were plated on day −1 and on Day 0, the wells were treated with DMSO or increasing concentrations of USP1 inhibitor. Throughout the assay, cells treated with DMSO were checked for confluency and if the cell confluency reached 80%, the cells were split back to 20-40%. The ratio required to achieve this was then applied to the other wells treated with USP1 inhibitor. Media was changed every 3-4 days containing appropriate concentrations of DMSO or USP1 inhibitor. At the end of the experiment, cell growth was measured using CellTiter-Glo® (Promega) reagent and the results detected using a SynergyHTX plate reader. The second assay format was the colony formation assay (CFA). This assay required first establishing what cell plating density enabled the development of clearly interspersed colonies on a six-well plate when left to grow for around 14 days. Once this density had been identified, cells were plated on day −1 and on day 0 the wells were treated with DMSO or increasing concentrations of USP1 inhibitor. Media was changed on day 8 containing appropriate concentrations of DMSO or USP1 inhibitor. At or around day 14 when clearly interspersed colonies were visible in the DMSO treated wells, the cells were feed and stained using 0.1% crystal violet in 10% ethanol for 20 minutes at room temperature. The plates were imaged then the amount of crystal violet stain in each well was quantified by extracting the crystal violet into 10% acetic acid and the absorbance measured at 565 nm. The results are shown in the table below.

TABLE 5
	Long term	Colony Formation
	proliferation-USP1	Assay-USP1
	inhibitor sensitive?	inhibitor sensitive?	BRCA status
Tissue	(<316 nM)	(<316 nM)	BRCA1	BRCA2	p53	ATM
Breast	Yes	Yes	Mutant	WT	Mutant	WT
Ovary	Yes	Yes	Mutant	WT	Mutant	WT
Ovary	—	Yes	Mutant	WT	Mutant	WT
Ovary	—	Yes	WT	WT	Mutant	WT
Ovary	Yes	Yes	WT	WT	Mutant	WT
Ovary	Yes	—	WT	WT	Mutant	WT
Breast	Yes	—	Mutant	WT	Mutant	WT
Breast	Yes	—	Mutant	Mutant	Mutant	WT
Ovary	—	No	WT	WT	Mutant	WT
Breast		No	WT	WT	Mutant	WT
Ovary	—	No	WT	WT	WT	WT
Ovary	—	No	WT	WT	WT	WT
Ovary	No	—	WT	WT	WT	WT
Breast	No	No	Mutant	—	Mutant	WT
Breast	No	—	Mutant	WT	Mutant	WT
Ovary	No	No	Mutant	WT	Mutant	WT
Ovary	No	—	WT	WT	Mutant	Mutant
Ovary	—	No	WT	WT	WT	WT
Melanoma	—	No	WT	WT	WT	WT
Bone	—	No	WT	WT	Mutant	WT
Bone	—	No	WT	WT	Mutant	WT
Bone	—	No	WT	WT	Mutant	WT
Bone	—	No	WT	WT	WT	WT
Melanoma	—	No	WT	WT	WT	WT
Bone	—	No	WT	Mutant	WT	WT
Lung	—	Yes	WT	Mutant	Mutant	WT
Uterus	—	No	WT	Mutant	Mutant	Mutant
Bladder	—	Yes	WT	WT	WT	WT
Bone	—	No	WT	WT	WT	WT
Bone	—	No	WT	WT	WT	WT
Bone	—	No	WT	WT	Mutant	WT
Bone	—	No	WT	WT	WT	WT
Bone	—	No	WT	WT	WT	WT
Bone	—	No	WT	WT	WT	WT
Nervous System	—	No	WT	WT	WT	WT
Nervous System	—	No	WT	WT	WT	WT
Nervous System	—	No	WT	WT	WT	Mutant
Nervous System	—	No	WT	WT	WT	WT
Nervous System	—	No	WT	WT	WT	WT
Skin	—	No	WT	WT	WT	WT
Soft Tissue	—	No	WT	WT	WT	WT
Uterus	—	No	WT	WT	WT	Mutant
Colon*	—	Yes	WT	Mutant	WT	Mutant
Lung*		Yes	WT	WT	WT	WT
Colon	—	No	WT	WT	WT	Mutant
Nervous System	—	No	WT	WT	WT	Mutant
Breast	—	No	WT	WT	WT	Mutant
Lung*	—	Yes	WT	WT	Mutant	Mutant
Lung	—	No	WT	WT	WT	Mutant
Colon*	—	Yes	WT	WT	Mutant	Mutant
Bladder	—	No	WT	WT	WT	Mutant
Colon	—	No	WT	Mutant	Mutant	WT
Ovary	—	No	WT	WT	Mutant	WT
Pancreas	—	No	WT	Mutant	WT	WT
Colon*	—	Yes	WT	Mutant	WT	WT
Colon	—	No	WT	Mutant	WT	WT
Colon*	—	Yes	WT	Mutant	Mutant	WT
Head & Neck	—	No	WT	WT	Mutant	WT
Pancreas	—	No	WT	Mutant	WT	WT
Cervix	—	No	WT	Mutant	WT	WT
Breast	—	No	WT	Mutant	Mutant	WT
Breast	—	No	Mutant	WT	WT	WT
Uterus	—	No	WT	WT	WT	WT
Breast	—	No	WT	WT	WT	WT
Bone	—	No	WT	WT	WT	WT
Bone	—	No	WT	WT	WT	WT
Ovary	—	No	WT	Mutant	WT	WT
Breast	—	No	WT	WT	Mutant	WT
Ovary	—	No	WT	WT	Mutant	WT
Breast	—	No	WT	WT	Mutant	WT
Breast	—	No	WT	WT	WT	WT
Breast	—	No	WT	Mutant	Mutant	Mutant
Breast	—	No	WT	Mutant	Mutant	WT
Breast	—	No	WT	WT	Mutant	Mutant
Breast	—	No	WT	WT	WT	WT
Head & Neck	—	No	WT	WT	Mutant	WT
Ovary*	—	Yes	WT	WT	Mutant	WT
Skin*	—	Yes	WT	WT	WT	Mutant
Esophagus	—	No	WT	WT	Mutant	WT
Head & Neck	—	No	WT	WT	Mutant	WT
Esophagus	—	No	WT	Mutant	Mutant	WT
Head & Neck	—	No	WT	WT	Mutant	WT
Bladder*	—	Yes	WT	WT	Mutant	WT
*USP1 inhibitor sensitivity reported based on one experiment.

These results indicate that p53 mutant cancers have increased sensitivity to USP1 inhibitors and that BRCA mutant cancers have increased sensitivity to LISP inhibitors. It has previously been reported that p53 status determines PARP inhibitor sensitization (Sa et al. Genome Biology, (2019) 20:253) and that BRCA1/2 status predicts the efficacy of PARP inhibitors in the clinic (Audeh et al Lancet (2010) 376 (9737), 245-51). In addition, these results indicate that ATM mutant cancers may have increased sensitivity to USP1 inhibitors. It has previously been reported that cancer cells with mutations in ATM are sensitive to PARP inhibitors (Wang et al. Translational Oncology (2017) 10, 190-1%). Thus, USP1 inhibitors may be effective in combination with PARP inhibitors.

Example 220

Solubility Determination

Certain Compounds of the Disclosure were assessed for ADME solubility at pH 2.0 and pH 7.4.

Stock solutions were prepared by adding each compound to DMSO at a concentration of 10 mM. Samples were prepared by adding 50 μL of each stock solution to separate vials. The vials were loaded onto a 96-well rack and dried. 500 μL of Phosphate Buffered Saline (PBS) pH 7.4 or PBS pH 2.0 were added into each vial. The vials were then shaken at 25° C. and 1,100 rpm for 24 hours.

After 24 hours, the vials were centrifuged at 3220 G and 25° C. for 30 minutes. The supernatant fluid was analyzed by LC-MS/MS against a standard of known concentration. The solubility of each sample was then calculated using the equation below:

$\left[\mathrm{Sample}\right]=\frac{1}{n}*\sum \left(\mathrm{Calculated}\mathrm{Conc}.\mathrm{sample}\times \mathrm{DF}\mathrm{sample}\right)$

where DF is the dilution factor.

The following Compounds of the Disclosure have the ADME solubility values shown in Table 5 below.

TABLE 6
	Solubility at	Solubility at
Sample	pH 2.0 (uM)	pH 7.4 (uM)
1	+	+
2	++	+
3	++	+
4	++	+
5	++	+
6	++	+
7	+	+
9	++	++
10	+	+
11	++	++
12	++	++
13	+	+
14	++	+
15	++	++
16	++	+
17	+	+
18	+	+
19	++	++
20	+	+
21	+	+
22	++	+
23	+	+
24	+	+
25	+	+
26	++	+
27	+	+
28	+	+
29	+	+
30	+	+
32	++	+
33	++	++
34	+	+
35	+	+
37	+	+
38	+	+
39	++	+
40	++	+
42	++	++
43	+	++
44	+	+
45	+	+
46	+	+
47	++	++
48	++	+
49	+	+
50	+	+
51	++	+
52	+	+
53	+	+
54	+	+
56	++	+
57	++	++
58	+	+
59	+	+
61	+	+
63	++	+
64	+	+
67	++	+
68	+	+
69	++	++
70	+	+
71	+	+
74	++	++
75	+	+
76	+	+
77	+	+
78	+	+
79	+	+
81	+	+
82	+	+
83	++	+
84	+	+
85	+	+
86	++	++
87	++	++
88	++	++
89	++	++
90	++	++
91	++	+
92	++	++
93	++	++
94	++	+
95	++	+
96	+	+
97	++	+
98	++	++
99	++	+
100	++	+
101	++	+
104	++	++
105	++	+
106	+	+
107	++	++
108	++	+
109	+	+
110	++	++
111	++	+
112	++	+
113	++	++
114	++	++
115	+	+
116	++	+
117	++	++
118	+	+
119	+	++
120	+	+
121	+	+
122	+	+
123	+	+
124	+	+
125	+	+
126	+	+
127	+	+
128	++	++
129	++	+
131	++	+
133	++	++
134	+	+
136	++	+
137	++	++
138	++	++
139	++	++
140	+	+
141	++	+
142	++	+
143	+	+
144	+	+
145	++	++
146	++	++
148	+	+
150	++	++
151	++	++
152	++	++
153	++	++
154	+	+
159	++	++
160	+	+
162	+	+
163	+	+
164	++	+
165	+	+
166	+	+
167	++	+
169	++	+
170	+	+
172	+	+
173	+	+
174	+	+
175	+	+
176	++	+
177	+	+
178	+	+
180	+	+
181	++	+
182	+	+
183	+	+
184	+	+
185	+	+
186	++	++
187	+	+
188	+	+
189	+	+
190	+	+
192	+	+
198	+	+
200	++	++
201	++	+
202	++	+
203	++	++
204	++	++
205	++	++
206	++	+
207	++	++
208	+	+
209	++	++
210	++	++
211	++	++
212	+	+
213	+	+
214	+	+
215	++	++
218	+	+
219	+	+
Solubility: “+” indicates less than 10 μM; “++” indicates 10 μM or greater.

Example 221

Liver Microsomal Stability

Certain Compounds of the Disclosure were assessed for ADME metabolic stability in human liver microsomes (HLM) and rat liver microsomes (RLM).

Samples were prepared by adding 222.5 μL of a master solution (100 mM phosphate buffer and 1 mg/mL liver microsomes (HLM or RLM)) and 25 μL of a 10 mM NADPH solution to incubation plates, which were then warmed for 10 min. Each compound was separately dissolved in DMSO to prepare 10 mM stock solutions, which were then diluted to 100 μM with acetonitrile. A reaction was started by adding 2.5 μL of the 100 μM solution of each compound to separate incubation plates such that the final concentration of for each compound in each plate was 1 μM.

25 μL aliquots of each sample were taken at 0.5, 5, 10, 15, 20 and 30 minutes, and the reaction was stopped by adding 5 volumes of cold acetonitrile with IS (100 nM alprazolam, 200 nM caffeine and 100 nM tolbutamide). The samples were then centrifuged at 3,220 G for 30 minutes, and 100 μL of the supernatant fluid was mixed with 100 μL of ultra-pure H₂O.

The samples were then analyzed by LC-MS/MS. Peak areas were determined from extracted ion chromatograms. Slope values (k) were determined by linear regression of the natural logarithm of the remaining percentage of the compound vs. incubation time curve. The in vitro half-life (in vitro t_1/2) was determined from the slope value using the following equation:

in vitro t_1/2=−(0.693/k).

The in vitro half-life (min) was converted into the in vitro intrinsic clearance (in vitro CL_int, in μL/min/mg protein) using the following equation:

$\mathrm{in}\mathrm{vitro}{\mathrm{CL}}_{\mathrm{int}}=\left\{\frac{0.693}{\left(t_{1/2}\right)}\right\}*\left(\frac{\mathrm{volume}\mathrm{of}\mathrm{incubation}\left(\mathrm{\mu L}\right)}{\mathrm{amount}\mathrm{of}\mathrm{proteins}\left(\mathrm{mg}\right)}\right)$

The following Compounds of the Disclosure have the ADME metabolic stability values shown in Table 6 below.

TABLE 7
	t1/2 (min) in	t1/2 (min) in
Sample	HLM	RLM
1	+	+
2	+	+
3	++	++
4	+	+
5	+	+
6	+	+
7	++	+
9	+	+
10	+	+
11	+	+
12	+	++
13	++	++
14	++	++
15	+	+
16	+	+
17	++	++
18	++	++
19	++	++
20	++	++
21	+	+
22	+	+
23	++	+
24	+	+
25	+	+
26	++	+
27	++	++
28	++	++
29	++	++
30	+	+
32	+	+
33	++	++
34	++	++
35	++	++
37	++	++
38	+	+
39	+	+
40	+	+
42	+	+
43	+	+
44	+	+
45	+	+
46	+	+
47	+	+
48	++	++
49	++	++
50	++	++
51	++	++
52	++	+
53	++	++
54	+	+
56	++	++
57	++	++
58	++	++
59	+	+
61	++	+
63	++	+
64	+	+
67	++	++
68	+	+
69	+	+
70	++	+
71	++	++
74	+	+
75	++	++
76	++	++
77	+	+
78	++	++
79	++	++
81	+	+
82	+	+
83	+	+
84	+	+
85	++	++
86	++	++
87	++	++
88	++	+
89	++	++
90	++	++
91	+	+
92	+	++
93	+	+
94	++	+
95	++	+
96	++	++
97	++	++
98	++	+
99	+	+
100	+	+
101	+	+
104	+	+
105	++	++
106	++	++
107	++	++
108	+	+
109	+	+
110	+	++
111	+	++
112	++	++
113	++	+
114	+	+
115	+	+
116	+	+
117	+	+
118	++	+
119	++	++
120	+	+
121	+	+
122	+	+
123	+	+
124	+	+
125	++	++
127	++	++
128	++	+
129	++	++
131	++	++
133	+	+
134	++	++
136	+	+
137	++	++
138	++	++
139	++	++
140	++	++
141	++	++
142	++	+
143	++	++
144	++	+
145	++	+
146	+	+
148	+	+
150	+	+
151	++	++
152	+	+
153	+	+
154	++	++
159	+	+
160	++	++
162	++	++
163	++	++
164	+	+
165	++	++
166	+	+
167	+	+
169	++	++
170	++	+
172	++	+
173	++	++
174	++	++
175	++	++
176	++	++
177	++	++
178	++	++
180	++	++
181	++	++
182	++	++
183	+	+
184	+	+
185	++	++
186	+	+
187	++	+
188	++	++
189	++	++
190	+	+
192	+	+
198	++	++
200	++	++
201	+	+
202	+	+
203	+	+
204	++	+
205	++	++
206	+	++
207	+	++
208	++	++
209	+	++
210	++	++
211	+	++
212	++	++
213	++	++
214	++	++
215	++	+
218	++	+
219	++	++
HLM/RLM Stability t1/2: “+” indicates less than 25 minutes; “++” indicates 25 minutes or greater.

Example 222

USP1 is Required for the Viability of a Subset of Cancer Cell Lines

To perform CRISPR-Cas9 gene depletion screens, approximately 500 cancer cell lines were engineered to express Cas9 and were subsequently infected with lentivirus expressing guide RNAs targeting every gene in the genome. After 14 days, cells were harvested, genomic DNA was extracted, and Illumina Sequencing was used to determine guide representation, and a “dropout” score was used to measure the depletion of guides targeting each gene in each cell line. A lower dropout score indicates a greater sensitivity to loss of the gene. The dropout scores for USP1 in various cell lines are presented in FIG. 1. These data demonstrate that guides targeting USP1 were depleted in a subset of ovarian cancer and breast cancer cell lines, indicating that USP1 is required for viability of these lines (FIG. 1). Breast cancer cell lines are shown in white, and ovarian cancer cell lines are shown in black. Seven out of the nine most sensitive breast lines were triple negative breast cancer (TNBC), but some TNBC lines were insensitive to loss of USP1.

USP1 is a deubiquitinase protein that removes ubiquitin from mono-ubiquitinated PCNA (FIG. 2) and FANCD2. CRISPR-Cas9 genetic depletion or pharmacological inhibition of USP1 results in increased mono-ubiquitination of both PCNA and FANCD2.

Example 223

Rad18 Levels Correlate with Sensitivity to Loss of USP1

To identify features that may predict sensitivity to loss of USP1, gene expression was analyzed across all of the approximately 500 cell lines. Rad18 mRNA levels were found to correlate with sensitivity to loss of USP1. Rad18 is the E3 ubiquitin ligase that ubiquitinates PCNA (FIG. 2). It has previously been reported that knockdown of Rad18 resulted in a loss of mono-ubiquitinated PCNA and that this rescued the replication fork instability induced by USP1 inhibition in homologous-recombination deficient tumors with BRCA1 and BRCA2 mutations. (Lim K. et al., “USP1 is required for replication fork stability in BRCA1-deficient tumors,” AACR 2018 Meeting, Abstract 333/14.) Therefore, it was surprising that the USP1-sensitive cell lines included BRCA1/2 wildtype cell lines as well as BRCA1/2 mutant cell lines (FIG. 1).

RAD18 had not previously been proposed as even a potential biomarker for USP1-inhibitor sensitivity, and, as demonstrated herein, Rad18 can be detected in both USP1-sensitive and USP1-insensitive tumors (see FIGS. 3-6). However, the cell lines that were most sensitive to USP1 inhibitors also tended to have high Rad18 levels. FIG. 3 shows a histogram of Rad18 mRNA expression across approximately 500 cell lines, and the 20 lines with the lowest USP1 dropout score indicated in the dark bars reaching to the top of the graph. Similarly, FIG. 4 shows that USP1 dropout scores correlated with Rad18 mRNA expression levels in both breast (including TNBC) and ovarian cancer lines.

To further analyze the correlation of Rad18 levels and sensitivity to USP1 inhibitors, Rad18 mRNA and protein levels were analyzed in a panel of USP1-sensitive and -insensitive lines. The sensitive cell lines were 59M (a BRCA1/2 wildtype ovarian cancer line) and ES2 (a BRCA1/2 wildtype ovarian cancer line). The insensitive cell lines were OVISE (a BRCA1/2 wildtype ovarian cancer line), Hep3B217 (a BRCA1/2 wildtype liver cancer line), and JHH7 (a BRCA1/2 wildtype liver cancer line). Rad 18 mRNA levels were determined using quantitative reverse transcription PCR (qRT-PCR), and sensitive lines were observed to have higher expression of Rad18 mRNA (FIG. 5). Rad18 protein levels were examined by western blot in the same cell lines, and a sensitive lines were also observed to have higher expression of Rad18 protein levels (FIG. 6).

These data demonstrate that while Rad18 can be detected in both USP1-sensitive and USP1-insensitive tumors, elevated Rad18 mRNA and protein levels are correlated with USP1-sensitivity.

Example 224

Rad18 Deletion Rescues USP1 Deletion

Rad18 was found to play a functional role in sensitivity to USP1 loss. ES2 cells were infected with lentivirus expressing Cas9, then electroporated with ribonucleoproteins containing Cas9 protein and either a negative control guide (OR1A1) or a guide targeting Rad18. The cells were subsequently infected with lentivirus expressing guides against a negative control (OR1A1), a positive lethal control (EEF2), or one of four different USP1-targeting guides. In the negative control cells, treatment with USP1-targeted guides decreases viability. However, genetic depletion of Rad18 reversed the cell viability effects of USP1 loss. (FIG. 7.) These data demonstrate that Rad18 deletion rescues USP1 deletion.

Having now fully described this invention, it will be understood by those of ordinary skill in the art that the same can be performed within a wide and equivalent range of conditions, formulations, and other parameters without affecting the scope of the invention or any embodiment thereof.

Other embodiments of the invention will be apparent to those skilled in the art from consideration of the specification and practice of the invention disclosed herein. It is intended that the specification and examples be considered as exemplary only, with a true scope and spirit of the invention being indicated by the following claims.

All patents and publications cited herein are fully incorporated by reference herein in their entirety.

Claims

1.-29. (canceled)

30. A method of treating cancer in a patient comprising administering to the patient a therapeutically effective amount of a compound having Formula I:

31.-37. (canceled)

38. The method of claim 30, wherein the cancer is selected from the group consisting of lung cancer, non-small cell lung cancer (NSCLC), colon cancer, bladder cancer, osteosarcoma, ovarian cancer, skin cancer, and breast cancer.

39.-41. (canceled)

42. The method of claim 30, wherein the cancer is a triple negative breast cancer.

43.-49. (canceled)

50. The method of claim 30, wherein the cancer comprises cancer cells with a mutation in a gene encoding p53, wherein the mutation in the gene encoding p53 is a loss of function mutation.

51. The method of claim 30, wherein the cancer is a BRCA1 mutant cancer, a BRCA2 mutant cancer, a BRCA1 mutant cancer and a BRCA2 mutant cancer, a PARP inhibitor resistant or refractory cancer, a PARP inhibitor resistant or refractory BRCA1 or BRCA2 mutant cancer, a DNA damage repair pathway deficient cancer, or a homologous-recombination deficient cancer.

52.-111. (canceled)

112. The method of claim 30, wherein the cancer is ovarian cancer.

113. The method of claim 30, wherein the cancer is breast cancer.

114. The method of claim 30, wherein the cancer is a BRCA1 mutant cancer, a BRCA2 mutant cancer, or a BRCA1 mutant cancer and a BRCA2 mutant cancer.

115. The method of claim 30, wherein the cancer is a PARP inhibitor resistant or refractory cancer.

116. The method of claim 30, a PARP inhibitor resistant or refractory BRCA1 or BRCA2 mutant cancer.

117. The method of claim 30, wherein R3 is an optionally substituted phenyl, an optionally substituted pyrid-3-yl, an optionally substituted pyrid-4-yl, an optionally substituted pyrimidin-5-yl, or an optionally substituted pyrazol-5-yl; and when R3 is substituted, the substituents are independently selected from methoxy, deuteromethoxy, ethoxy, isopropoxy, t-butoxy, difluoromethoxy, 2-fluoroethoxy, 2-methoxyethoxy, cyclopropoxy, cyclobutoxy, (tetrahydrofuran-3-yl)oxy, benzyloxy, methyl, ethyl, isopropyl, 2-fluoroisopropyl, t-butyl, cyclopropyl, cyclobutyl, methylcyclopropyl, pyrrolidin-1-yl, azetidin-1-yl, methylamino, dimethylamino, cyano, halo, methylthio, methylsulfonyl, and ethylsulfonyl.

118. The method of claim 30, wherein R3 is selected from the group consisting of:

119. The method of claim 30, wherein R5 is an optionally substituted pyrrolyl, optionally substituted imidazolyl, optionally substituted pyrazolyl, optionally substituted triazolyl, or optionally substituted tetrazolyl; and when R5 is substituted, the substituents are independently selected from halo, methyl, ethyl, isopropyl, cyclopropyl, cyclobutyl, methoxy, ethoxy, triazolyl, cyano, optionally substituted alkyl, amino, alkylamino, dialkylamino, difluoromethyl, trifluoromethyl, methylsulfonyl, oxetan-3-yl, and methylazetidinyl.

120. The method of claim 30, wherein R5 is selected from the group consisting of:

121. The method of claim 30, wherein the compound has a Formula II:

122. The method of claim 117, wherein the compound has a Formula III, Formula IV, Formula V, Formula VI, Formula Via, Formula VII, Formula VIII, Formula IX, Formula X, Formula XI, or Formula XII:

123. A method of treating cancer in a patient comprising administering to the patient a therapeutically effective amount of a compound selected from the group consisting of: 6-(3-methoxypyridin-4-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl) 1H-pyrazolo[3,4-d]pyrimidine;1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(2-(methylsulfonyl)-phenyl)-1H-pyrazolo[3,4-d]pyrimidine;1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(2-methyl-6-(methylsulfonyl)phenyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-(ethylsulfonyl)phenyl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;1-(4-(3-(difluoromethyl)-5-methyl-1H-pyrazol-1-yl)benzyl)-6-(2-isopropylpyridin-3-yl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-methoxy-4-methylpyridin-3-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-methoxy-6-methylpyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-isopropylpyridin-3-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2,6-dimethoxyphenyl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-methoxyphenyl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-isopropylphenyl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-methoxy-6-methylphenyl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;2-methoxy-3-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)isonicotinonitrile;2-(2-isopropylphenyl)-9-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-9H-purine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-isopropylpyridin-3-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(2-methyl-6-(methylthio)phenyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-cyclopropyl-6-methoxyphenyl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-isopropylphenyl)-1-(4-(1-(1-methylazetidin-3-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-isopropylphenyl)-1-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-isopropylphenyl)-4-methyl-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(3-fluoro-2-isopropylphenyl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-isopropylphenyl)-3-methyl-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2-isopropylphenyl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-(tert-butyl)-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-(2-fluoropropan-2-yl)-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-methoxy-6-(1-methylcyclopropyl)pyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl) 1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclobutyl-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;(S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;(R)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-ethoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-isopropoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-cyclopropyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidine-4-carbonitrile;6-cyclopropyl-N,N-dimethyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-amine;6-(4,6-dimethoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-isopropyl-6-methylpyrimidin-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-6-(4-methyl-6-(methylthio)pyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine;2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-8-methyl-9-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-9H-purine;1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-6-(4-methyl-6-(methylsulfonyl)pyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-(2-methoxyethoxy)-6-methylpyrimidin-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(1-isopropyl-4-methyl-1H-pyrazol-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(1-isopropyl-4-methoxy-1H-pyrazol-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-1-isopropyl-1H-pyrazol-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;2-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-7-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-7H-pyrrolo[2,3-d]pyrimidine;5-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-3-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3H-[1,2,3]triazolo[4,5-d]pyrimidine;6-(4,6-diethoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl) 1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(trifluoromethyl)-5,6,7,8-tetrahydroimidazo[1,5-a]pyrazin-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-5-(trifluoromethyl)-1H-1,2,4-triazol-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(1-cyclopropyl-4-methoxy-1H-pyrazol-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-((6-(5-methoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)pyridin-3-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidine;(R)-6-(4-cyclobutyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;(S)-6-(4-cyclobutyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;(R)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;(S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-2-(trifluoromethyl)-1H-imidazol-4-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-(2-fluoropropan-2-yl)-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(5-ethoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-((6-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)pyridin-3-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidine;1-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-5-methyl-1H-pyrazole-3-carbonitrile;6-(4-cyclopropyl-1-ethyl-1H-pyrazol-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-(methoxy-d3)pyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-cyclopropyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidine-4-carbonitrile;6-(4-cyclopropoxy-6-cyclopropylpyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclobutoxy-6-cyclopropylpyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-(difluoromethoxy)pyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxy-2-methylpyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(oxetan-3-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-(tert-butyl)-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-(tert-butoxy)-6-cyclopropylpyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-(2-fluoroethoxy)pyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(methyl-d3)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;1-(4-(1-cyclobutyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4,6-dimethoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;1-(4-(1-cyclopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(2-fluoroethyl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(3-fluoro-4-(1-methyl-4-(trifluoromethyl) 1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(2-fluoro-4-(1-methyl-4-(trifluoromethyl) 1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(2,4-dimethoxy-6-methylpyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(5-methoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-(2-methoxyethoxy)pyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-(2-methoxyethoxy)pyrimidin-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-methoxy-6-(1-methylcyclopropyl)pyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl) 1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(1-isopropyl-4-methyl-1H-pyrazol-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;(S)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;(R)-6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)phenyl)ethyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclobutyl-6-methoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-isopropoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-isopropyl-6-methylpyrimidin-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-ethoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;N,N,6-trimethyl-5-(1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-amine;1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-6-(4-methyl-6-(methylthio)pyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4,6-dimethoxypyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-(2-methoxyethoxy)-6-methylpyrimidin-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-(1-methylazetidin-3-yl)-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-methoxy-6-methylpyrimidin-5-yl)-1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;3-(1-(4-(5-methyl-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)picolinonitrile;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(3-(difluoromethyl)-5-methyl-1H-pyrazol-1-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-cyclopropyl-N-methyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl) 1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-amine;1-(4-(5-methoxy-3-(trifluoromethyl)-1H-pyrazol-1-yl)benzyl)-6-(4-methoxy-6-methylpyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-((tetrahydrofuran-3-yl)oxy)pyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-(benzyloxy)-6-cyclopropylpyrimidin-5-yl)-1-(4-(1-ethyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(3-(difluoromethyl)-1-methyl-1H-1,2,4-triazol-5-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-(benzyloxy)-6-cyclopropylpyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(5-methoxy-1-methyl-1H-1,2,4-triazol-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;2-(2-(4-((6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)phenyl)-4-(trifluoromethyl)-1H-imidazol-1-yl)-N,N-dimethylacetamide;6-cyclopropyl-N,N-dimethyl-5-(1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)pyrimidin-4-amine;6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(5-(difluoromethyl)-1-methyl-1H-1,2,4-triazol-3-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-cyclopropyl-6-(pyrrolidin-1-yl)pyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine;6-(4-(azetidin-1-yl)-6-cyclopropylpyrimidin-5-yl)-1-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine; and5-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-3-(4-(1-methyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-3H-[1,2,3]triazolo[4,5-d]pyrimidine;or a pharmaceutically acceptable salt or solvate thereof.

124. The method of claim 123, wherein the compound is 6-(4-cyclopropyl-6-methoxypyrimidin-5-yl)-1-(4-(1-isopropyl-4-(trifluoromethyl)-1H-imidazol-2-yl)benzyl)-1H-pyrazolo[3,4-d]pyrimidine or a pharmaceutically acceptable salt or solvate thereof.

125. The method of claim 124, wherein the cancer is selected from the group consisting of lung cancer, non-small cell lung cancer (NSCLC), colon cancer, bladder cancer, osteosarcoma, ovarian cancer, skin cancer, and breast cancer.

126. The method of claim 124, wherein the cancer is ovarian cancer.

127. The method of claim 124, wherein the cancer is breast cancer.

128. The method of claim 124, wherein the cancer is a triple negative breast cancer.

129. The method of claim 124, wherein the cancer comprises cancer cells with a mutation in a gene encoding p53.

130. The method of claim 124, wherein the cancer is a BRCA1 mutant cancer, a BRCA2 mutant cancer, a BRCA1 mutant cancer and a BRCA2 mutant cancer, a PARP inhibitor resistant or refractory cancer, a PARP inhibitor resistant or refractory BRCA1 or BRCA2 mutant cancer, a DNA damage repair pathway deficient cancer, or a homologous-recombination deficient cancer.

131. The method of claim 122, wherein the cancer is a BRCA1 mutant cancer, a BRCA2 mutant cancer, or a BRCA1 mutant cancer and a BRCA2 mutant cancer.

132. The method of claim 122, wherein the cancer is a PARP inhibitor resistant or refractory cancer.

133. The method of claim 122, wherein the cancer is a PARP inhibitor resistant or refractory BRCA1 or BRCA2 mutant cancer.

134. The method of claim 30, wherein the compound has a Formula VIa:

135. A method of treating cancer in a patient comprising administering to the patient a therapeutically effective amount of a compound having Formula I:

136. A method of treating cancer in a patient comprising administering to the patient a therapeutically effective amount of a compound having Formula I: