Patent Grant
11866481
The instant application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Sep. 20, 2022, is named A089970017US00-SUBSEQ-LJG and is 70,760 bytes in size.
The present invention relates to TGF-β receptor ectodomain fusion molecules and uses thereof. More specifically, the present invention relates to TGF-β superfamily receptor ectodomain fusion molecules and their use in TGF-β ligand neutralization.
TGF-β is part of a superfamily of over 30 ligands that regulate several physiological processes, including cell proliferation, migration and differentiation. Perturbation of their levels and/or signaling gives rise to significant pathological effects. For instance, TGF-β and activin ligands play critical pathogenic roles in many diseases including cancer (Hawinkels & Ten Dijke, 2011; Massague et al, 2000; Rodgarkia-Dara et al, 2006). TGF-β, in particular, is considered as a critical regulator of tumor progression and is overexpressed by most tumor types. It favors tumorigenesis in part by inducing an epithelial-mesenchymal transition (EMT) in the epithelial tumor cells, leading to aggressive metastasis (Thiery et al, 2009). TGF-β also promotes tumorigenesis by acting as a powerful suppressor of the immune response in the tumor microenvironment (Li et al, 2006). In fact, TGF-β is recognized as one of the most potent immunosuppressive factors present in the tumor microenvironment. TGF-β interferes with the differentiation, proliferation and survival of many immune cell types, including dendritic cells, macrophages, NK cells, neutrophils, B-cells and T-cells; thus, it modulates both innate and adaptive immunity (Santarpia et al, 2015; Yang et al, 2010). The importance of TGF-β in the tumor microenvironment is highlighted by evidence showing that, in several tumor types (including melanoma, lung, pancreatic, colorectal, hepatic and breast), elevated levels of TGF-β ligand are correlated with disease progression and recurrence, metastasis, and mortality. Hence, significant effort has been invested in devising anti-tumor therapeutic approaches that involve TGF-β inhibition (Arteaga, 2006; Mourskaia et al, 2007; Wojtowicz-Praga, 2003). These approaches include the use of polypeptide fusions based on the TGF-β receptor ectodomain that binds or “traps” the TGF-β ligand (see WO01/83525; WO2005/028517; WO2008/113185; WO2008/157367; WO2010/003118; WO2010/099219; WO2012/071649; WO2012/142515; WO2013/000234; U.S. Pat. No. 5,693,607; US2005/0203022; US2007/0244042; U.S. Pat. Nos. 8,318,135; 8,658,135; 8,815,247; US2015/0225483; and US2015/0056199).
One approach to developing therapeutic agents that inhibit TGF-β function has been to use antibodies or soluble decoy receptors (also termed receptor ectodomain (ECD)-based ligand traps) to bind and sequester ligand, thereby blocking access of ligand to its cell surface receptors (Zwaagstra et al, 2012). In general, receptor ECD-based traps are a class of therapeutic agents that are able to sequester a wide range of ligands and that can be optimized using protein-engineering approaches (Economides et al, 2003; Holash et al, 2002; Jin et al, 2009).
Previously, a novel protein engineering design strategy was used to generate single-chain, bivalent TGF-3 Type II receptor ectodomain (TβRII-ECD) traps that are able to potently neutralize members of the TGF-β superfamily of ligands due to avidity effects (Zwaagstra et al, 2012) [WO 2008/113185; WO 2010/031168]. In this case, bivalency was achieved via covalent linkage of two TβRII ectodomains using regions of the intrinsically disordered regions (IDR) that flank the structured, ligand-binding domain of TβRII-ECD. An example of these single-chain bivalent traps, T22d35, exhibited TGF-β neutralization potencies ˜100-fold higher than the monovalent non-engineered TβRII ectodomain, though the bivalent trap did not neutralize the TGF-β2 isotype and had a relatively short circulating half-life.
It would be useful to provide TβRII-ECD-based traps having improved properties, such as enhanced potency.
The present invention provides a polypeptide construct with enhanced potencies in inhibiting TGFβ.
A polypeptide construct of the present invention comprises a first region and a second region, wherein the first region comprises a first and/or second TGFβ receptor ectodomain (ECD); and wherein the second region comprises the second constant domain (CH2) and/or third constant domain (CH3) of an antibody heavy chain. In a preferred non-limiting embodiment, the C-terminus of the first region is linked to the N-terminus of the second region. In a preferred non-limiting embodiment, the first region of the polypeptide construct comprises a first TβRII-ECD (ECD1) and/or a second TβRII-ECD (ECD2), wherein ECD1 and ECD2 are linked in tandem.
The polypeptide construct provided, wherein the first region comprises a (TβRII-ECD)-(TβRII-ECD) doublet linked at its C-terminus with an antibody constant domain inhibits TGFβ activity with at least 600-fold more potency than a counterpart construct having a single TβRII-ECD linked at its C-terminus with an antibody constant domain (i.e when a second ECD is absent, also referred to herein as a singlet).
The polypeptide construct provided comprises a second, TGFβ receptor ectodomain ECD that is linked in tandem to the first ECD, wherein the polypeptide construct (i.e. an ECD doublet construct) linked to an antibody constant domain exhibits TGFβ neutralization (inhibits) that is at least 100, 200, 300, 400, 500, 600, 700, 800 or 900-fold greater than a counterpart construct in which the antibody constant domain is absent, (i.e. an ECD doublet construct, also referred to herein as a non-Fc fused doublet).
In connection with the TβRII-ECDs and the potency with which they inhibit TGF-β activity, it has been found that surprisingly enhanced potencies can result from careful selection of their constituents. This occurs when certain TβRII-ECDs are linked in tandem, and the C-terminus thereof is linked to the N-terminus of an antibody constant domain (Fc). When in their fused and dimeric form, comprising two such polypeptides cross-linked via cysteine bridging between the constant domain/s of each polypeptide, the resulting so-called “Fc fusions” having two TβRII-ECDs (an ECD “doublet”) on each of the two “arms” can exhibit an inhibiting activity that is over 600-fold greater for TGF-β1, and over 20-fold greater for TGF-β3, as compared to “Fc fusions” having one ectodomain on each of the two “arms”, as demonstrated by the inhibition of TGF-β1 and -β3-induced IL-11 secretion by human non-small cell lung cancer (NSCLC) A549 cells, among others. The potency enhancement is evident, relative to counterparts that either lack the Fc region or that lack a second ECD (i.e. are an ECD “singlet”). The potency enhancement is at least 100, 200, 300, 400, 500, or 600-fold greater for the Fc-fused doublet over the Fc-fused singlet. The potency enhancement is at least 100, 200, 300, 400, 500, 600, 700, 800, 900-fold and approximately 1000-fold greater for the Fc-fused doublet over the non-Fc doublet. The potency enhancement is evident, relative to counterparts that either lack the Fc region (the Fc-fused doublet T22d35-Fc is 972- and 243-fold better for TGF-β1 and TGF-β3, respectively than the non-Fc doublet), or that lack a second ECD (an ECD “singlet”; the Fc-fused doublet T22d35-Fc is 615- and 24-fold better for TGF-β1 and TGF-β3, respectively than the non-Fc doublet). More specifically, the Fc-doublet (T22d35-Fc) exhibits a potency enhancement that is at least 970-fold greater for TGF-β1 and at least 240-fold greater for TGF-β3 when compared to a non-Fc fused ECD doublet. Moreover, the Fc-doublet (T22d35-Fc) exhibits a potency enhancement that is at least 600-fold greater for TGF-β1 and over 20-fold greater for TGF-β3 when compared to an Fc-singlet (T2m-Fc).
In a general aspect, there is provided a polypeptide construct comprising at least two TβRII-ECDs linked in tandem (i.e. ECD doublet), and an antibody constant domain comprising at least, the second constant domain (CH2) and/or third constant domain (CH3) of an antibody heavy chain, wherein the C-terminus of the ectodomains is linked to the N-terminus of the antibody constant domain. In this form, the construct is a single chain polypeptide. Thus, the antibody constant domain may comprise only the CH2 domain, or it may comprise the CH2 domain and the CH3 domain.
In embodiments the polypeptides are provided as dimeric fusion polypeptides comprising two single chain polypeptides and cross-linking means coupling the chains covalently.
In other embodiments, the two ectodomains are the same, in terms of their binding targets generally and/or their target species.
In a preferred embodiment, the first region comprises two TGF-β receptor ectodomains (TGFβR-ECD or ‘TβR-ECD’). In a preferred embodiment, the TβR-ECD is a TGF-β receptor type II ectodomain (TβRII-ECD). In a preferred embodiment, the TβR-ECD comprises SEQ ID NO:1, and a sequence substantially identical thereto.
The second region may comprise a sequence selected from the group consisting of SEQ ID NO:12, SEQ ID NO:15, SEQ ID NO:18, SEQ ID NO:24, and a sequence substantially identical thereto.
In a preferred embodiment, the second region of a polypeptide construct of the present invention can further comprise a CH1. In embodiments, the constructs are monofunctional.
The polypeptide constructs of the present invention exploit an antibody heavy chain of human origin. In a preferred embodiment, the antibody heavy chain is selected from the group consisting of a human IgG1 (SEQ ID NO:15) and IgG2 (SEQ ID NO:24).
Thus, in another aspect, there is provided a polypeptide construct according to the present invention wherein the construct is a dimeric polypeptide; wherein the dimeric polypeptide comprises:
There is also provided a nucleic acid molecule encoding any polypeptide construct of the present invention. There is also provided a vector comprising the nucleic acid molecule of the present invention.
There is also provided a composition comprising one or more than one independently selected polypeptide constructs of the present invention and a pharmaceutically-acceptable carrier, diluent, or excipient.
There is also provided a transgenic cellular host comprising a nucleic acid molecule or a vector of the present invention. The transgenic cellular host can further comprise a second nucleic acid molecule or a second vector encoding a second polypeptide construct when that second polypeptide construct is the same or different from the first polypeptide construct. The second nucleic acid molecule or second vector is present necessarily when the two polypeptide constructs are different (heterodimeric), but are not necessary when the constructs are the same (homodimeric).
There is also provided the use of a polypeptide construct according to the present invention for treatment of a medical condition, disease or disorder; wherein the medical condition, disease or disorder comprises, but is not limited to, cancer, ocular diseases, fibrotic diseases, or genetic disorders of connective tissue and immune disorders.
The polypeptide construct of the present invention may comprise a CH2 and CH3 or only a CH2 from an antibody heavy chain that is of human origin. For example, and without wishing to be limiting, the antibody heavy chain may be selected from the group consisting of a human IgG1 and IgG2. In embodiments, the constant domain in the constructs is CH2 per se, or CH3 per se or CH2-CH3. Suitably, the antibody heavy chain component provides for disulfide crosslinking between single chain polypeptide constructs that are the same or different. Also suitably, the antibody heavy chain provides for protein A-based isolation of the dimeric polypeptide that is produced by the host cells.
In embodiments the receptor ectodomain region comprises two independently selected ectodomains that are linked in tandem, i.e., in a linear manner. In some embodiments, the ectodomains are the same in sequence, or least the same with respect to their target ligand.
The present invention also provides a nucleic acid molecule encoding the polypeptide constructs as described herein. A vector comprising the nucleic acid molecule just described is also encompassed by the invention. The invention also includes a transgenic cellular host comprising the nucleic acid molecule or a vector as described herein; the cellular host may further include a second nucleic acid molecule or a second vector encoding a second polypeptide construct different from the first polypeptide construct. Systems used to produce the present polypeptides can be secretion systems, particularly in the case where dimerization through disulfide bridges is required, and the expression polynucleotides thus encode secretion signals that are cleaved by the host upon secretion into the culturing medium.
Compositions comprising one or more than one independently selected polypeptide construct described herein and a pharmaceutically-acceptable carrier, diluent, or excipient are also encompassed by the present invention.
These and other features of the invention will now be described by way of example, with reference to the appended drawings, wherein:
Additional aspects and advantages of the present invention will be apparent in view of the following description. The detailed descriptions and examples, while indicating preferred embodiments of the invention, are given by way of illustration only, as various changes and modifications within the scope of the invention will become apparent to those skilled in the art
There are now provided polypeptide constructs that bind to and neutralize all transforming growth factor beta (TGF-β1, 32 and β3) isoforms. These polypeptides exploit the TGF-β receptor ectodomains to trap or sequester various TGFβ species including TGF-β1 and TGF-β3, and to some extend TGF-β2. The potency with which the present polypeptide constructs neutralize TGF-β1 and -β3 is surprisingly far greater than related constructs, as demonstrated herein. For this reason, the present constructs are expected to be especially useful as pharmaceuticals for the treatment of medical indications such as cancer, fibrotic diseases and certain immune disorders.
The present polypeptide constructs comprise two TβR-ECDs, such as TβRII-ECDs, that are linked in tandem (C-terminus to N-terminus) and further comprise an antibody constant domain that comprises at least the second constant domain (CH2) and/or third constant domain (CH3) of an antibody heavy chain. The antibody constant domain (Fc) is coupled at its N-terminus to the C-terminus of the ectodomain. Having the ectodomain as a doublet, and having that doublet coupled to the N-terminus of the antibody constant domain, provides a “trap” with an enhanced the neutralization potency by a factor of 615 for TGFβ1 and a factor 24 for TGFβ3 compared to the construct having a single ECD coupled to the N-terminus of the antibody constant domain.
As used herein, the term TβRII-ECD refers to the extracellular region of the TGF-β Type II receptor that binds to the TGF-β ligand. In a preferred embodiment of the present constructs, the TGFβRII ectodomain is the ectodomain of the TGFβR species (i.e. TβRII-ECD) comprising the sequence that forms a stable three-dimensional folded structure:
In a related form that comprises flexible natural flanking sequence, the ECD can include the underlined structures, as shown below:
IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSI
This sequence binds to the TGF-β ligand isotypes designated TGF-β1 and TGF-β3. Binding affinity for TGF-β2 is less.
In the present polypeptide constructs, the two TβRII-ECDs may comprise the same sequence. The two ectodomains are linked in tandem, wherein the result is a linear polypeptide in which the C-terminus of one ectodomain is linked to the N-terminus of another ectodomain.
The two ectodomains can be linked by direct fusion such that additional amino acid residues are not introduced. Alternatively, additional amino acid residues can form a linker that couples the two receptor ectodomains in tandem. In the protein construct of the present invention, the first and second regions of the polypeptide construct of the present invention are also linked.
By the term “linked”, it is meant that the two regions are covalently bonded. The chemical bond may be achieved by chemical reaction, or may be the product of recombinant expression of the two regions in a single polypeptide chain. In a specific, non-limiting example, the C-terminus of the first region is linked directly to the N-terminus of the second region, that is, no additional “linker” amino acids are present between the two regions. In the case where no linker is present, that is to say direct fusion of the two regions, there will be a direct link between the C-terminus of the full ectodomain and the N-terminus of the antibody constant regions CH2-CH3. For example, in fusing an Fc variant (SEQ ID NO:12, SEQ ID NO:15, SEQ ID NO:18, SEQ ID NO:24) to the SEQ ID NO:1 via the intrinsically disordered linker with SEQ ID NO:8, which is part of the TβRII-ECD having SEQ ID NO:1 (i.e., no additional “linker” amino acids added), one connects the aspartic acid at the last position of SEQ ID NO:1 to a glutamic acid, a threonine, a valine or a valine found at the first position of SEQ ID NO:12, SEQ ID NO:15, SEQ ID NO:18, or SEQ ID NO:24, respectively.
A common practice when producing fusion constructs is to introduce glycine or glycine-serine linkers (GSL) such as GGGGS (SEQ ID NO: 34) or [G4S]n (where n is 1, 2, 3, 4 or 5 or more, such as 10, 25 or 50)(SEQ ID NO: 34) between the fused components. As taught in the above paragraph, the polypeptide fusions of the present invention can be produced by direct linkage without use of any additional amino-acid sequence except those present in the Fc region and in the receptor ectodomain region. One thus can refrain from utilizing foreign sequences as linkers, providing an advantage due to their potential for undesired immunogenicity and their added molecular weight. Entropic factors are also a potential liability for glycine and glycine-serine linkers, which are highly flexible and may become partially restricted upon target binding, hence causing a loss of entropy unfavourable to binding affinity. Therefore, only the flexible, intrinsically disordered N-terminal regions of the TGFβRII-ECD were employed as natural linkers in embodiments of the present invention. However, the particular amino acid compositions and lengths of these intrinsically disordered linkers (e.g., SEQ ID NO:6, SEQ ID NO:7, SEQ ID NO:8) precluded accurate prediction of whether the resulting direct-fusion constructs will have the required geometry and favourable molecular interactions for correct binding to their intended dimeric ligands. In other embodiments, the fusion polypeptide may include a flexible artificial GSL, as exemplified in the construct in SEQ ID NO:20, where the GS linker with the SEQ ID NO:21 is introduced between the aspartic acid (D) at the last position of TβRII-ECD having SEQ ID NO:1 and the threonine (T) at the first position of the Fc region variant having SEQ ID NO:15.
The first and second regions of the polypeptide construct are, in embodiments, connected by natural intrinsically disordered polypeptide linkers selected from the group consisting of SEQ ID NO:8, 13, 16, 19, 25, and a sequence substantially identical thereto. In other embodiments, the regions of the polypeptide constructs are connected by flexible linkers selected from the group consisting of SEQ ID NO:21 and SEQ ID NO:22, and a sequence substantially identical thereto.
In this embodiment, one region of the present polypeptide constructs comprises a TβRII-ECD doublet comprising first and second receptor ectodomains linked in tandem by the natural intrinsically disordered polypeptide linker with SEQ ID NO: 6, and having amino acid sequence comprising:
IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSI
VTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAV
The present constructs also comprise a region that comprises an antibody constant domain that comprises at least the second constant domain (CH2) and/or third constant domain (CH3) of an antibody heavy chain. The antibody constant domain is coupled at its N-terminus to the C-terminus of the ectodomain doublet, so that the orientation of the construct is a single chain of TβRII-ECD(link)TβRII-ECD(link)CH2-CH3.
The antibody constant domain provides for cross-linking between two of the present polypeptide constructs. This is achieved when the expressed polypeptide constructs are secreted from their expression host. Thus, production of the single chain polypeptide provides the construct in a dimeric form in which the two constructs are cross-linked via disulfide bridges that involve one or more cysteine residues within each of the antibody constant domains present in each of the constructs.
The antibody constant domain present in the construct is desirably sourced from an IgG constant region, and especially from the constant domain of either IgG1 or IgG2.
The constructs provided are monofunctional in the sense that the constant region itself may have no particular activity, other than to act as a structure through which dimers of the polypeptide constructs can form. These minimal constant regions can also be altered to provide some benefit, by incorporating the corresponding hinge regions and optionally changing the cysteine residue composition. Thus, some or all of the cysteine residues involved in bridging the two Fc fragments or naturally used to bridge between the heavy and light chains of a full-length antibody can be replaced or deleted. One advantage of minimizing the number of cysteine residues is to reduce the propensity for disulphide bond scrambling, which could promote aggregation. For example, these cysteine residues and alteration thereof are seen in the natural or non-natural linker sequences located around the junction of the first and second regions of the polypeptide constructs and which are listed below:
SEEYNTSNPDTHTCPPCPAPE (SEQ ID NO:16), SEEYNTSNPDVEPKSSDKTHTCPPCPAPE (SEQ ID NO:19), SEEYNTSNPDGGGSGGGSGGGTHTCPPCPAPE (SEQ ID NO:22) incorporating variations of human IgG1 hinge sequence; and SEEYNTSNPDERKCCVECPPCPAPP (SEQ ID NO:13) and SEEYNTSNPDVECPPCPAPP (SEQ ID NO:25) incorporating variations of human IgG2 hinge sequence; and a sequence substantially identical thereto.
Not all of the naturally-occurring inter-hinge disulfide bonds need to be formed for the Fc homodimerization to occur, while noting that the stability of the Fc homodimer may depend on the number of intermolecular disulphide bridges.
In the present disclosure, an “antibody”, also referred to in the art as “immunoglobulin” (Ig), refers to a protein constructed from paired heavy and light polypeptide chains. The structure of an antibody and of each of the domains is well established and familiar to those of skill in the art, though is summarized herein. When an antibody is correctly folded, each chain folds into a number of distinct globular domains joined by more linear polypeptide sequences; the immunoglobulin light chain folds into a variable (VL) and a constant (CL) domain, while the heavy chain folds into a variable (VH) and three constant (CH1, CH2, CH3) domains. Once paired, interaction of the heavy and light chain variable domains (VH and VL) and first constant domain (CL and CH1) results in the formation of a Fab (Fragment, antigen-binding) containing the binding region (Fv); interaction of two heavy chains results in pairing of CH2 and CH3 domains, leading to the formation of a Fc (Fragment, crystallisable). Characteristics described herein for the CH2 and CH3 domains also apply to the Fc.
In the present invention and its specific embodiments, the polypeptide constructs that exhibit significantly enhanced potency comprise the following:
IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVA
EEYNTSNPDIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSIC
IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVA
EEYNTSNPDIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSIC
IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVA
EEYNTSNPDIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSIC
IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVA
EEYNTSNPDIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSIC
IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVA
EEYNTSNPDIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSIC
In a specific embodiment, the polypeptide construct comprises a polypeptide of the present invention that exhibits significantly enhanced potency, for example a polypeptide the exhibits significant enhanced potency may comprise SEQ ID NO: 10, SEQ ID NO.14, SEQ ID NO:17, SEQ ID NO: 20 or SEQ ID NO:23. In another specific embodiment, the polypeptide construct may be a homodimer comprising two polypeptides that exhibit significant enhanced potency; for example if the polypeptide construct that exhibits significant enhanced potency is SEQ ID NO: 14, the polypeptide construct is a homodimer comprising two polypeptide constructs wherein each polypeptide construct comprising SEQ ID NO.14. Likewise, if the polypeptide that exhibits enhanced potency is SEQ ID NO: 10, 14, 17, 20, or 23, a homodimer of the present invention likewise comprises two polypeptide constructs wherein each polypeptide of the homodimer is SEQ ID NO: 10, 14, 17, 20 or 23 respectively.
As noted, these single chain polypeptide constructs will dimerize when secreted from a production host, yielding a dimeric polypeptide construct comprising two single chain polypeptides linked by way of disulfide bridges that form between the constant domains of the two single chain polypeptides.
By “significantly enhanced potency” we mean that the effect or activity of a present polypeptide construct in this dimeric form is greater than a counterpart construct when measured in an assay relevant for assessing the biological activity of TGF-β. Appropriate means for making this determination are exemplified herein. For example, the N-terminal Fc-fused T22d35 doublets neutralizes TGF-β to a much better extend than the N-terminally Fc-fused T2m singlet as was illustrated by the TGF-β-induced IL-11 release by A549 cells (
It is observed that fusion constructs of this type have advantages relative to several other versions of TβRII receptor-ectodomain based molecules, including non-Fc fused bivalent TGF-p receptor ectodomain constructs (such as the T22d35 doublet) and constructs in which a single receptor ectodomain is fused to the N-terminus of an Fc region. In particular, the presently provided Fc fusion constructs have improved manufacturability due to the presence of the Fc region (for example, purification can be accomplished using protein A chromatography). The Fc region also allows for improved circulating half-lives. Importantly, the present constructs have substantially higher TGF-β neutralization potencies compared to the singlet fusion (T2m-Fc) and non-Fc-fused doublet ectodomain (T22d35). The N-terminally fused TGF-β ECD doublet Fc constructs (T22d35-Fc) provided exhibit advantages with respect to significant improvement in TGF-β ligand neutralizing potency (as shown, for example, in the over 970-fold improvement in TGF-β1 neutralization relative to non-Fc fused doublet, as shown in
In specific embodiments, the second region of the polypeptide construct of the present invention is selected from a group of sequences displaying variation in the N-terminal sequence as exemplified by SEQ ID NO:12, 15, 18, 24. These may differ in length and the number of cysteine residues retained from the hinge region as a means to modulating the degree of Fc-region dimerization and hence impacting on both efficacy and manufacturability. Thus, in embodiments, the polypeptide construct comprises a variation in the constant domain, wherein at least one cysteine residue involved in cross-linking is deleted or substituted. Suitable substitutions include serine or alanine, and preferably by serine.
A substantially identical sequence may comprise one or more conservative amino acid mutations that still provide for proper folding upon secretion into the culturing medium. It is known in the art that one or more conservative amino acid mutations to a reference sequence may yield a mutant peptide with no substantial change in physiological, chemical, physico-chemical or functional properties compared to the reference sequence; in such a case, the reference and mutant sequences would be considered “substantially identical” polypeptides. A conservative amino acid substitution is defined herein as the substitution of an amino acid residue for another amino acid residue with similar chemical properties (e.g. size, charge, or polarity). These conservative amino acid mutations may be made to the framework regions while maintaining the overall structure of the constant domains; thus the function of the Fc is maintained.
In a specific, non-limiting example, the first region of the polypeptide construct of the present invention may comprise a TGF-β receptor type II, such as:
IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSI
In preferred embodiments, the polypeptide constructs comprise a TβRII-ECD “doublet”, in which a TβRII-ECD is linked in tandem with another TβRII-ECD, which ectodomains can be the same or different TGF-β superfamily receptor ectodomains, such as:
IPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSI
where in one non-limiting embodiment the linker corresponds to SEQ ID NO:6; and a sequence substantially identical thereto. “Substantially identical” is as defined above.
The ectodomain doublet can incorporate the same or different ectodomains, both belonging to the TGFβ superfamily receptor family. In embodiments, the ectodomains bind the same target. In other embodiments, the ectodomains are of the same receptor species. In other embodiments, the ectodomains are identical and thus are homomeric.
For example, the polypeptide constructs of the present invention may have a TGF-β neutralization potency selected from the group consisting of at least 900-fold and 200-fold, more potent than the T22d35 doublet alone for TGFβ1 and TGF-β3, respectively. For example, in the IL-11 release assay the T22d35-Fc doublet construct is approximately 972-fold more potent in neutralizing TGF-β1 and approximately 243-fold more potent in neutralizing TGF-β3, when compared with the non-Fc-fused T22d35 doublet alone.
In another example, the potency of the construct is at least 600-fold and at least 20-fold greater for neutralizing TGF-β1 and TGF-β3, respectively, than a construct in which the antibody constant domain is coupled to a single ectodomain rather than to a doublet. The polypeptide constructs of the present invention may have an at least 615-fold and 24-fold better neutralization potency for TGF-β1 and TGF-β3, respectively, when compared to the potency of a construct in which the antibody constant domain is coupled to a single ectodomain rather than to a doublet.
The neutralizing potency can be summarized as follows: the neutralizing potency of the Fc-fused doublet (ECD-ECD-Fc) is greater than the Fc-fused ECD monomer (ECD-Fc); i.e. ECD-ECD-Fc >ECD-Fc, whereas the ECD-Fc is more potent than the non-Fc-fused doublet (ECD-ECD) and the non-Fc fused doublet ECD is more potent than the non-Fc fused singlet ECD; i.e. ECD-ECD-Fc >>ECD-Fc >ECD-ECD >>ECD). In terms of manufacturability, the presence of an Fc protein allows for Protein A purification and prevents having to use cleavable tags. In addition, positioning the singlet or doublet ECD at the N-terminus of the Fc portion prevents aggregation issues due to the inappropriate pairing of the cysteine residues in the hinge region of the Fc portion. Therefore, fusion of the ECD singlet or doublet to the N-terminus of the Fc portion provides an improved manufacturability over C-terminal fusions (N-terminal fusions have a higher percentage of monomeric species, less aggregates, less fragments). In addition an unexpected significant increase is observed in TGF-β neutralization potency for all TGF-β isotypes for the N-terminal Fc fused doublet ECD compared to the N-terminal Fc fused T2m singlet ECD.
Additionally, when the polypeptide constructs of the present invention include a TβRII-ECD that binds TGF-β, the polypeptide construct may neutralize, to varying extents, all three isotypes of TGF-β (that is, TGF-β1, TGF-β2, and TGF-β3).
The polypeptide constructs of the present invention have, as assessed in cell-based assays, TGF-β neutralizing potencies that are significantly higher (20-fold or more) than those of bivalent comparator polypeptides, i.e. non-Fc-fused T22d35 (doublet alone) and T2m-Fc (Fc fused singlet). Within the series of polypeptide constructs of the present invention, those that contain two or more copies of the TβRII-ECD fused to the N-terminus of the Fc constant region have potencies that are higher than those constructs that contain only one copy, as assessed in cell based assays.
The polypeptide construct of the present invention is expressed as a single polypeptide chain.
Once expressed, the polypeptide construct of the present invention forms a dimer wherein the CH2 and CH3 domains of the respective polypeptide constructs interact to form a properly assembled Fc region such as occurs when the expressed products are secreted into the culturing medium.
The polypeptide construct of the present invention may also comprise additional sequences to aid in expression, detection or purification of a recombinant antibody or fragment thereof. Any such sequences or tags known to those of skill in the art may be used. For example, and without wishing to be limiting, the antibody or fragment thereof may comprise a targeting or signal sequence (for example, but not limited to ompA), a detection/purification tag (for example, but not limited to c-Myc, His5, His6, or His8G), or a combination thereof. In another example, the signal peptide may be MDWTWRILFLVAAATGTHA (SEQ ID NO:11). In a further example, the additional sequence may be a biotin recognition site such as that described in [WO/1995/04069] or in [WO/2004/076670]. As is also known to those of skill in the art, linker sequences may be used in conjunction with the additional sequences or tags, or may serve as a detection/purification tag. Suitably, the constant region comprises a protein A binding site (residing typically between about CH2 and CH3) that permits the single chain polypeptide to be extracted/isolated using a protein A affinity approach.
The present invention also encompasses nucleic acid sequences encoding the molecules as just described above. Given the degeneracy of the genetic code, a number of nucleotide sequences would have the effect of encoding the desired polypeptide, as would be readily understood by a skilled artisan. The nucleic acid sequence may be codon-optimized for expression in various micro-organisms. The present invention also encompasses vectors comprising the nucleic acids as just described, wherein the vectors typically comprise a promoter and signal sequence that are operably linked to the construct-encoding polynucleotide for driving expression thereof in the selected cellular production host. The vectors can be the same or different provided both result in secretion of the dimeric polypeptide construct.
Furthermore, the invention encompasses cells, also referred to herein as transgenic cellular host, comprising the nucleic acid and/or vector as described, encoding a first polypeptide construct. The host cells may comprise a second nucleic acid and/or vector encoding a second polypeptide construct different from the first polypeptide construct. The co-expression of the first and second polypeptide constructs may lead to the formation of heterodimers.
The present invention also encompasses a composition comprising one or more than one polypeptide construct as described herein. The composition may comprise a single polypeptide construct as described above, or may be a mixture of polypeptide constructs. The composition may also comprise one or more than one polypeptide construct of the present invention linked to one or more than one cargo molecule. For example, and without wishing to be limiting in any manner, the composition may comprise one or more than one polypeptide construct of the present invention linked to a cytotoxic drug in order to generate an antibody-drug conjugate (ADC) in accordance with the present invention.
The composition may also comprise a pharmaceutically acceptable diluent, excipient, or carrier. The diluent, excipient, or carrier may be any suitable diluent, excipient, or carrier known in the art, and must be compatible with other ingredients in the composition, with the method of delivery of the composition, and is not deleterious to the recipient of the composition. The composition may be in any suitable form; for example, the composition may be provided in suspension form, powder form (for example, but limited to lyophilised or encapsulated), capsule or tablet form. For example, and without wishing to be limiting, when the composition is provided in suspension form, the carrier may comprise water, saline, a suitable buffer, or additives to improve solubility and/or stability; reconstitution to produce the suspension is effected in a buffer at a suitable pH to ensure the viability of the antibody or fragment thereof. Dry powders may also include additives to improve stability and/or carriers to increase bulk/volume; for example, and without wishing to be limiting, the dry powder composition may comprise sucrose or trehalose. In a specific, non-limiting example, the composition may be so formulated as to deliver the antibody or fragment thereof to the gastrointestinal tract of the subject. Thus, the composition may comprise encapsulation, time-release, or other suitable technologies for delivery of the antibody or fragment thereof. It would be within the competency of a person of skill in the art to prepare suitable compositions comprising the present compounds.
The constructs of the present invention may be used to treat diseases or disorders associated with over-expression or over-activation of ligands of the TGF-β superfamily. The disease or disorder can be selected from, but not limited to, cancer, ocular diseases, fibrotic diseases, or genetic disorders of connective tissue.
In the field of cancer therapy, it has recently been demonstrated that TGF-β is a key factor inhibiting the antitumor response elicited by immunotherapies, such as immune checkpoint inhibitors (ICI's) (Hahn & Akporiaye, 2006). Specifically, therapeutic response to ICI antibodies results primarily from the re-activation of tumor-localized T-cells. Resistance to ICI antibodies is attributed to the presence of immunosuppressive mechanisms that result in a dearth of T-cells in the tumor microenvironment. Thus, it is now recognized that in order to elicit responses in resistant patients, ICI antibodies need to be combined with agents that can activate T-cells and induce their recruitment into the tumor, i.e. reversing of the “non-T-cell-inflamed” tumor phenotype. One publication noted that overcoming the non-T-cell-inflamed tumor microenvironment is the most significant next hurdle in immuno-oncology (Gajewski, 2015).
We have shown using a proof-of-principle TGF-β trap, T22d35, that blocking of TGF-β effectively reverses the “non-T cell inflamed” tumor phenotype (Zwaagstra et al, 2012). This positions anti-TGF-β molecules as potential synergistic combinations with ICI's and other immunotherapeutics. In support of this, a 2014 study (Holtzhausen et al., ASCO poster presentation) examined effects of a TGF-β blocker when combined an anti-CTLA-4 antibody in a physiologically-relevant transgenic melanoma model. The study demonstrated that while anti-CTLA-4 antibody monotherapy failed to suppress melanoma progression, the combination of the TGF-β antagonist and anti-CTLA-4 antibody significantly and synergistically suppressed both primary melanoma tumor growth as well as melanoma metastasis. These observations correlated with significant increases in effector T-cells in melanoma tissues.
We show herein that the present polypeptides having the basic structure that is T22d35-Fc significantly reduce tumor growth in a syngeneic mouse MC-38 colon cancer model. This thus positions anti-TGF-β molecules to be used in a potential synergistic combination with other immunotherapeutics.
The present constructs can be useful to treat fibrotic diseases including those that affect any organ of the body, including, but not limited to kidney, lung, liver, heart, skin and eye. These diseases include, but are not limited to, chronic obstructive pulmonary disease (COPD), glomerulonephritis, liver fibrosis, post-infarction cardiac fibrosis, restenosis, systemic sclerosis, ocular surgery-induced fibrosis, and scarring.
Genetic disorders of connective tissue can also be treated, and include, but are not limited to, Marfan syndrome (MFS) and Osteogenesis imperfecta (O).
The present invention will be further illustrated in the following examples. However, it is to be understood that these examples are for illustrative purposes only and should not be used to limit the scope of the present invention in any manner.
Materials & Methods
Production & Purification
Transient CHO Expression
The various TβRII-ECD fusion variants (such as T2m-Fc and T22d35-Fc) are each comprised of a heavy chain Fc region, and include the signal sequence MDWTWRILFLVAAATGTHA (SEQ ID NO:11) at their N-termini. The DNA coding regions for the constructs were prepared synthetically (Biobasic Inc. or Genescript USA Inc.) and were cloned into the HindIII (5′ end) and BamH1 (3′ end) sites of the pTT5 mammalian expression plasmid vector (Durocher et al, 2002). Fusion proteins were produced by transient transfection of Chinese Hamster Ovary (CHO) cells with the heavy chain T2m or T22d35 fused to the IgG heavy chain (T2m-Hc and T22d35-HC, respectively) construct. Briefly, T2m-HC or T22d35-HC plasmid DNAs were transfected into a 2.5 L and 4.6 L culture, respectively, of CHO-3E7 cells in FreeStyle F17 medium (Invitrogen) containing 4 mM glutamine and 0.1% Kolliphor p-188 (Sigma) and maintained at 37° C. Transfection conditions were: DNA (80% plasmid construct, 15% AKT plasmid, 5% GFP plasmid): PEIpro (ratio 1:2.5): PEI(polyethylenimine)pro (Polyplus) (ratio=1:2.5). At 24 hours post-transfection, 10% Tryptone N1 feed (TekniScience Inc.) and 0.5 mM Vaporic acid (VPA, Sigma) were added and the temperature was shifted to 32° C. to promote the production and secretion of the fusion proteins and then maintained for 15 days post transfection after which the cells were harvested. At final harvest the cell viability was 89.6%.
Stable Pool CHO Expression
CHOBRI/rcTA cell pools were generated by transfecting cells with the vector expressing the target gene encoding the various Fc-fused TβRII-ECD proteins. The day after transfection, the cells were centrifuged for 5 min at 250 rpm and seeded at density of 0.5×106 cells/mL in selection medium (PowerCHO2 medium supplemented with 50 μM of methionine sulfoximine). Selection medium was replaced every 2-3 days during 14 to 18 days with inoculation at 0.5×106 cells/mL. Cell number and viability were measured with the Cedex Innovatis' automated cell counter Cedex Analyzer as described above. When cell viability reached greater than 95%, pools were inoculated at 0.2×106 cells/mL in 125 or 250 mL Erlenmeyer flasks. For the fed-batch culture, CHOBRI/rcTA cell pools were inoculated as described above. At day three post-inoculation, when cells density reached 3.5 to 4.5×106 cells/mL, expression of the recombinant protein was induced by adding 2 μg/mL of cumate. MSX concentration was adjusted to 125 μM, and F12.7 feed (Irvine Scientific) was added followed by a temperature shift to 32° C. Every 2-3 days, cultures were fed with 5% (v:v) F12.7 and samples were collected for recombinant protein (pA-HPLC) and glucose (VITROS 350, Orthoclinical Diagnostics, USA) concentration determination. Glucose was added in order to maintain a minimal concentration of 17 mM.
Purification
The harvest supernatant from the CHO cells was filtered (0.2 μm) and loaded onto a Protein A MabSelect Sure column (GE Healthcare). The column was washed with 2 column volumes of PBS and protein was eluted with 3 column volumes of 0.1 M sodium citrate pH 3.6. To maximize the yield, the flow through was reloaded onto the Protein A column and eluted as described above. Eluted fractions were neutralized with 1 M Tris, and those containing the fusion proteins were pooled and subsequently loaded onto a Hi-load Superdex S200 26/60 size exclusion chromatography (SEC) column (GE Healthcare) equilibrated in formulation buffer (DPBS without Ca2+, without Mg2+). Protein was eluted using 1 column volume formulation buffer, collected into successive fractions and detected by UV absorbance at 280 nm. The main peak SEC fractions containing the fusion proteins were then pooled and concentrated. The integrity of the Prot-A and SEC purified fusion proteins in the pooled fractions was further analyzed by UPLC-SEC and SDS-PAGE (4-15% polyacrylamide) under reducing and non-reducing conditions (SYPRO Ruby staining). For UPLC-SEC, 2-10 μg of protein in DPBS (Hyclone, minus Ca2+, minus Mg2+) was injected onto a Waters BEH200 SEC column (1.7 μm, 4.6×150 mm) and resolved under a flow rate of 0.4 mL/min for 8.5 min at room temperature, using the Waters Acquity UPLC H-Class Bio-System. Protein peaks were detected at 280 nm (Acquity PDA detector).
Cell Lines
Human A549 non-small cell lung cancer cells were purchased from ATCC (Cat #CCL-185, Cedarlane, Burlington, ON). Cells were cultured in Dulbecco's Modified Eagles Medium (DMEM) supplemented with 5% Fetal Bovine Serum (FBS). MC-38 mouse colon adenocarcinoma cells were purchased from Kerafast (Cat #ENH204, Boston, MA), and cultured in Dulbecco's modified MEM supplemented with 2 mM L-glutamine and 10% fetal bovine serum. Both cell lines were maintained at 37° C., in a humidified atmosphere supplemented with 5% CO2.
TGF-β Induced A549 Cell IL-11 Release Assay
Human A549 lung cancer cells were seeded in 96-well plates (5×103 cells/well). The following day 10 pM TGF-β in complete media, in the absence or presence of a serial dilution of TGF-β Trap fusion protein, was incubated for 30 min at RT prior to adding to the cells. After 21h of incubation (37° C., 5% CO2, humidified atmosphere) conditioned medium was harvested and added to MSD Streptavidin Gold plates (Meso Scale Diagnostics, Gaithersburg, MD) that were coated with 2 μg/mL biotinylated mouse anti-human IL-11 antibody (MAB618, R&D Systems, Minneapolis, MN). After 18h (4° C.) plates were washed with PBS containing 0.02% Tween 20 and then 2 μg/mL SULFO-tagged goat anti-human IL-11 antibody (AF-218-NA, R&D Systems Minneapolis, MN) was added and plates were incubated for 1 h at RT. After a final wash, plates were read in a MESO QuickPlex SQ120 machine (Meso Scale Diagnostics, Gaithersburg, MD). IL-11 readouts were expressed as percent IL-11 release compared to control cells treated with TGF-β alone. Graphpad Prism (4-PL algorithm ((log (inhibitor) vs. response—variable slope (four parameters)) was used to calculate the IC50 (the automatic outlier option was used when needed).
In Vivo Evaluation in a Syngeneic Mouse Colon Cancer MC-38 Subcutaneous Mouse Model
Female C57BL/6-Elite mice (5-7 weeks old) were purchased from Charles River Laboratories (Wilmington, MA). Thirteen C57BL/6 mice were injected on day 0 with 3×105 MC-38 cells subcutaneously into the right flank. When tumors reached a volume of 50-100 mm3 (day 5) animals were divided in 2 cohorts and treatment was initiated:
Tumors were measured twice a week using digital calipers up to 15 days after commencing treatment. Tumor volumes were calculated from these measurements using a modified ellipsoidal formula (Tπ=rr/6×(Length×Width×Width)) described previously (Tomayko et al., 1986).
Results & Discussion
Fusion Construct Design
In order to generate TGF-β traps of interest, we fused the TβRII-ECD singlet (designated T2m) to another such singlet thereby forming the ectodomain doublet (designated T22d35) that was coupled to the N-termini of the heavy chains of a human (h)IgG2 Fc region and a human IgG1 Fc region.
Expression and Purification
Purification of Transient CHO Material
The respective fusion protein constructs were expressed transiently in CHO-3E7 cells (see Table 1) after which the conditioned medium was harvested and purified using a protein A affinity column, followed by preparative Size Exclusion Chromatography (SEC). SEC elution profiles of the T2m-Fc (
Purification of Stable CHO Pool Material
N- and C-terminally Fc-fused T22d35 variants were stably expressed in CHOBRI/rcTA cells in order to compare their level of expression and some of their biophysical properties. The coding region of each variant was ligated into mammalian cell expression plasmids and, after transfection, an enriched pool of cells was selected that stably expressed each of the variants. The main difference between the variants can be found in the amino acid sequence composing the linker region that separates the T22d35 doublet from the Fc domain (in the case of the N-terminal fusions), while for the C-terminal Fc-fusions, the difference between each of the variants is at the extreme amino-terminus of the protein (Table 2).
Fusion proteins were purified by protein A affinity and using 100 mM citrate (pH3.6) as the elution buffer. Eluted fusion protein samples were neutralized with 1 M HEPES then subjected to a buffer exchange to DPBS using Zeba spin columns (Table 3), while the integrity of several of the purified fusion proteins was assessed by SDS-PAGE (
Functional In Vitro Assessment
The A549 cell IL-11 release assay was used to compare TGF-β neutralization potencies of the T2m-Fc and T22d35-Fc fusion proteins to the non-Fc-fused T22d35 single chain doublet trap, as shown in
Functional In Vivo Assessment
The T22d35-Fc fusion protein (SEQ ID NO:10) was evaluated in vivo using a syngeneic MC-38 mouse colon carcinoma model (
Listing of Sequences
IPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQKSC
MSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFI
LEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYNTSN
structure
PD
domain and its
natural linkers
IPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQKSC
MSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFI
structured
LEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
domain with its
natural N-
terminal linker
QLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKN
DENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMC
structured
SCSSDECNDNIIF
SEEYNTSNPD
domain with its
terminal linker
QLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKN
DENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMC
structured
SCSSDECNDNIIF
domain
IPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQKSC
MSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFI
LEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYNTSN
PDIPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQK
structured
SCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYH
domains and
DFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYN
natural linkers
TSNPD
SEEYNTSNPDIPPHVQKSVNNDMIVTDNNGAVKF
natural linker
IPPHVQKSVNNDMIVTDNNGAVKF
terminal natural
linker
SEEYNTSNPD
terminal natural
linker
IPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQKSC
MSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFI
LEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYNTSN
PD
IPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQKSC
MSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFI
LEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYNTSN
PDIPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQK
SCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYH
DFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYN
TSNPD
region
IPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQKSC
MSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFI
LEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYNTSN
Fc
PDIPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQK
SCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYH
DFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYN
TSNPD
Fc
region
IPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQKSC
MSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFI
LEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYNTSN
PDIPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQK
SCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYH
DFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYN
TSNPD
VEPKSSDKTHTCPPCPAPELLGG
linker with the
region
IPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQKSC
MSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFI
LEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYNTSN
PDIPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQK
SCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYH
DFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYN
Fc
TSNPDGGGSGGGSGGG
artificial GS
linker
SEEYNTSNPD
GGGSGGGSGGG
THTCPPCPAPE
region
IPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQKSC
MSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFI
LEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYNTSN
PDIPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQK
Fc
SCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYH
DFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYN
TSNPD
Fc
SEEYNTSNPD
linker with the
region
IPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCDNQK
SCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYH
DFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SEEYN
TSNPDIPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFSTCD
NQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETYCHDPKL
PYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SE
EYNTSNPD
IPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDVRFS
TCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETYCHD
PKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNII
F
SEEYNTSNPDIPPHVQKSVNNDMIVTDNNGAVKFP
QLCKFCDV
RFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETV
CHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECN
DNIIF
SEEYNTSNPD
IPPHVQKSVNNDMIVIDNNGAVKFP
QLCKFCDVRFSTCD
NQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKL
PYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
SE
EYNTSNPDIPPHVQKSVNNDMIVTDNNGAVKF
PQLCKFCDVRFS
TCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETYCHD
PKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNII
F
SEEYNTSNPD
ERKCCVECPPCPAPP
VECPPCPAPP
THTCPPCPAPE
VEPKSSDKTHTCPPCPAPE
GGGSGGGSGGG
THTCPPCPAPE
PPCPAPE
DKTHTCPPCPAPE
VECPPCPAPP
All patents, patent applications and publications referred to throughout the application are listed below.
This application is a U.S. National Stage Application under 35 U.S.C. § 371 of International Application No. PCT/IB2018/051320, filed Mar. 1, 2018, which claims priority to U.S. Provisional Application No. 62/465,969, filed Mar. 2, 2017 and U.S. Provisional Application No. 62/468,586, filed Mar. 8, 2017, the entire contents of each of which are hereby incorporated by reference in their entireties.
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/IB2018/051320 | 3/1/2018 | WO |
| Publishing Document | Publishing Date | Country | Kind |
|---|---|---|---|
| WO2018/158727 | 9/7/2018 | WO | A |
| Number | Name | Date | Kind |
|---|---|---|---|
| 5693607 | Segarini et al. | Dec 1997 | A |
| 6277375 | Ward | Aug 2001 | B1 |
| 8318135 | O'Connor-McCourt et al. | Nov 2012 | B2 |
| 8658135 | O'Connor-McCourt et al. | Feb 2014 | B2 |
| 8815247 | Govindappa et al. | Aug 2014 | B2 |
| 9782452 | Scandura et al. | Oct 2017 | B2 |
| 9809637 | Kumar et al. | Nov 2017 | B2 |
| 20020004037 | Koteliansky et al. | Jan 2002 | A1 |
| 20050203022 | Gotwals et al. | Sep 2005 | A1 |
| 20070244042 | Sun et al. | Oct 2007 | A1 |
| 20110293512 | Violette et al. | Dec 2011 | A1 |
| 20130149304 | Lin et al. | Jun 2013 | A1 |
| 20150056199 | Kumar et al. | Feb 2015 | A1 |
| 20150225483 | Lo | Aug 2015 | A1 |
| 20180327477 | Kumar et al. | Nov 2018 | A1 |
| 20200231652 | Zwaagstra et al. | Jul 2020 | A1 |
| 20220169702 | Zwaagstra et al. | Jun 2022 | A1 |
| Number | Date | Country |
|---|---|---|
| 2330939 | Dec 1999 | CA |
| 2791383 | Sep 2011 | CA |
| 2902830 | Oct 2014 | CA |
| 1257545 | Jun 2000 | CN |
| 105658672 | Jun 2016 | CN |
| 3 174 550 | Jun 2017 | EP |
| 3589663 | Jan 2020 | EP |
| 2001-515360 | Sep 2001 | JP |
| 2010-529859 | Sep 2010 | JP |
| 2012-530514 | Dec 2012 | JP |
| 2016-037488 | Mar 2016 | JP |
| 2017-501977 | Jan 2017 | JP |
| 10-2001-0006534 | Jan 2001 | KR |
| 2413769 | Mar 2011 | RU |
| WO 9504069 | Feb 1995 | WO |
| WO 9848024 | Oct 1998 | WO |
| WO 0183525 | Nov 2001 | WO |
| WO 2004076670 | Sep 2004 | WO |
| WO 2005028517 | Mar 2005 | WO |
| WO 2005103263 | Nov 2005 | WO |
| WO 2008113185 | Sep 2008 | WO |
| WO 2008157367 | Dec 2008 | WO |
| WO 2010003118 | Jan 2010 | WO |
| WO 2010031168 | Mar 2010 | WO |
| WO 2010099219 | Sep 2010 | WO |
| WO 2011005481 | Jan 2011 | WO |
| WO 2011109789 | Sep 2011 | WO |
| WO 2012071649 | Jun 2012 | WO |
| WO 2012142515 | Oct 2012 | WO |
| WO 2013000234 | Jan 2013 | WO |
| WO 2014164427 | Oct 2014 | WO |
| WO 2015027082 | Feb 2015 | WO |
| WO 2015077540 | May 2015 | WO |
| WO 2017037634 | Mar 2017 | WO |
| WO 2019191100 | Oct 2019 | WO |
| WO 2019211489 | Nov 2019 | WO |
| WO 2020093024 | May 2020 | WO |
| WO 2020146345 | Jul 2020 | WO |
| WO 2021123902 | Jun 2021 | WO |
| WO 2021248247 | Dec 2021 | WO |
| WO 2022271915 | Dec 2022 | WO |
| Entry |
|---|
| Govinden and Bhoola, 2003, Pharmacology and Therapeutics, vol. 98, pp. 257-265 (Year: 2003). |
| Paul, Fundamental Immunology (textbook), 1993, 3rd Edition, p. 285, Figure 1 (Year: 1993). |
| Lahn et al, Expert Opinion in Investigational Drugs, 2005, vol. 14, pp. 629-643 (Year: 2005). |
| IMGT Scientific chart, (“human IGHG”, downloaded from the web on Aug. 9, 2017) (Year: 2017). |
| Schlingensiepen et al (Recent Results in Cancer Research, 2008, vol. 177, pp. 137-150) (Year: 2008). |
| The abstract of Guba and Desaiah (Annals of oncology, 2016, vol. 27, suppl. 6, abstract No. 1102TiP) (Year: 2016). |
| Zwaagstra supplementa materials and methods, 2012 (Year: 2012). |
| Akhurst et al., “Targeting the TGF signalling pathway in disease,” Macmillan Publishers Limited, Oct. 2012, vol. 11, 23 pages. |
| Arteaga, “Inhibition of TGFβ signaling in cancer therapy,” Current Opinion in Genetics & Development 2006, 16:30-37. |
| Bogdahn et al., “Targeted therapy for high-grade glioma with the TGF-b2 inhibitor trabedersen: results of a randomized and controlled phase IIb study,” Neuro-Oncology 13(1):132-142, 2011. |
| Corcoran et al., “BRAF Gene Amplification Can Promote Acquired Resistance to MEK Inhibitors in Cancer Cells Harboring the BRAF V600E Mutation,” www.sciencesignaling.org, Nov. 23, 2010, vol. 3, Issue 149, 12 pages. |
| De Crescenzo et al, “Real-time Monitoring of the Interactions of Transforming Growth Factor-β (TGF-β) Isoforms with Latency-associated Protein and the Ectodomains of the TGF-β Type II and III Receptors Reveals Different Kinetic Models and Stoichiometries of Binding” The Journal of Biological Chemistry, 2001, vol. 276, No. 32, pp. 29632-29643. |
| Durocher et al., “High-level and high-throughput recombinant protein production by transient transfection of suspension-growing human 293-EBNA1 cells,” Nucleic Acids Research, 2002, vol. 30, No. 2 e9. |
| Economides et al., “Cytokine traps: multi-component, high-affinity blockers of cytokine action,” Nature Medicine, vol. 9, No. 1, Jan. 2003. |
| Engelman et al., “Acquired resistance to tyrosine kinase inhibitors during cancer therapy,” Current Opinion in Genetics & Development 2008, 18:73-79. |
| Eisenberg et al., “Analysis of Membrane and Surface Protein Sequences with the Hydrophobic Moment Plot,” J. Mol. Biol. (1984) 179, 125-142. |
| Flavell et al., “The polarization of immune cells in the tumour environment by TGFβ,” www.nature.com/reviews/immunol, Aug. 2010, vol. 10, 14 pages. |
| Gajewski, “The next hurdle in cancer immunotherapy: Overcoming the non-T cell-inflamed tumor microenvironment,” Semin Oncol. Aug. 2015; 42(4): 663-671. |
| Garberg et al., “In vitro models for the blood-brain barrier,” Toxicology in Vitro 19 (2005) 299-334. |
| Hahn et al., “Targeting transforming growth factor β to enhance cancer immunotherapy,” Current Oncology, vol. 13, No. 4, 3 pages. |
| Haqqani et al., “Multiplexed Evaluation of Serum and CSF Pharmacokinetics of Brain-Targeting Single-Domain Antibodies Using a NanoLC-SRM-ILIS Method,” Mol. Pharmaceutics 2013, 10, 1542-1556. |
| Hawinkels et al., “Exploring anti-TGF-β therapies in cancer and fibrosis,” Growth Factors, Aug. 2011; 29(4): 140-152. |
| Heldin et al., “Mechanism of TGF-β signaling to growth arrest, apoptosis, and epithelial—mesenchymal transition,” Current Opinion in Cell Biology 2009, 21:166-176. |
| Holash et al., “VEGF-Trap: A VEGF blocker with potent antitumor effects,” PNAS Aug. 20, 2002, vol. 99, No. 17, 11393-11398. |
| International Search Report and Written Opinion dated Jun. 4, 2018, for International Application No. PCT/IB2018/051320, 10 pages. |
| Isaka et al, “Gene therapy by transforming growth factor-β receptor-IgG Fc chimera suppressed extracellular matrix accumulation in experimental glomerulonephritis” Kidney International, 1999, vol. 55, pp. 465-475. |
| Jin et al., “Rational Optimization of a Bispecific Ligand Trap Targeting EGF Receptor Family Ligands,” Mol. Med. 15 (1-2) 11-20, Jan.-Feb. 2009, 10 pages. |
| Komesli et al, “Chimeric extracellular domain of type II transforming growth factor (TGF)-β receptor fused to the Fc region of human immunoglobulin as a TGF-β antagonist” European Journal of Biochemistry, 1998, vol. 254, pp. 505-513. |
| Li et al., “Transforming Growth Factor-Regulation of Immune Responses,” Annu. Rev. Immunol. 2006, 24:99-146. |
| Lin et al., “Mechanistic basis and clinical relevance of the role of transforming growth factor-β in cancer,”; accepted May 12, 2015, 12 pages. |
| Massague et al., “TGFb Signaling in Growth Control, Cancer, and Heritable Disorders,”Cell, vol. 103, 295-309, Oct. 13, 2000. |
| Mourskaia et al., “Targeting Aberrant TGF-β Signaling in Pre-Clinical Models of Cancer,” Anti-Cancer Agents in Medicinal Chemistry, 2007, 7, 504-514. |
| Padua et al., “Roles of TGFβ in metastasis,” Cell Research (2009) 19:89-102. |
| Rodgarkia-Dara et al., “The activin axis in liver biology and disease,” Mutation Research 613 (2006) 123-137. |
| Rodon Ahnert et al., “First human dose (FHD) study of the oral transforming growth factor-beta receptor I kinase inhibitor LY2157299 in patients with treatment-refractory malignant glioma,” Journal of Clinical Oncology 29, No. 15_suppl (May 20, 2011) 3011-3011. |
| Santarpia et al., “Programmed cell death protein-1/programmed cell death ligand-1 pathway inhibition and predictive biomarkers: understanding transforming growth factor-beta role,” Transl Lung Cancer Res 2015; 4(6): 728-742. |
| Schlingensiepen et al., “Targeted tumor therapy with the TGF-b2 antisense compound AP 12009,” Cytokine & Growth Factor Reviews 17 (2006) 129-139. |
| Schlingensiepen et al., “Transforming growth factor-beta 2 gene silencing with trabedersen (AP 12009) in pancreatic cancer,” Cancer Sci, Jun. 2011, vol. 102, No. 6, 1193-1200. |
| Thiery et al., “Epithelial-Mesenchymal Transitions in Development and Disease,” Cell 139, Nov. 25, 2009 Elsevier Inc., 20 pages. |
| Wojtowicz-Praga, “Reversel of tumor-induced immunosuppression by TGF-β inhibitors,” Investigational New Drugs 21: 21-32, 2003. |
| Yang et al., “TGF-β and immune cells: an important regulatory axis in the tumor microenvironment and progression,” Trends in Immunology 31 (2010) 220-227. |
| Yang et al., “Enlarging the repertoire of therapeutic monoclonal antibodies platforms: domesticating half molecule exchange to produce stable IgG4 and IgG1 bispecific antibodies,” Current Opinion in Biotechnology 2014, 30:225-229. |
| Zheng et al., “Silencing IDO in dendritic cells: A novel approach to enhance cancer immunotherapy in a murine breast cancer model,” Int. J. Cancer: 132, 967-977 (2013). |
| Zwaagstra et al, “Engineering and Therapeutic Application of Single-Chain Bivalent TGF-β Family Traps” Molecular Cancer Therapeutics, 2012, vol. 11, No. 7, pp. 1477-1487. |
| [No Author Listed] Aflibercept: AVE 0005, AVE 005, AVE0005, VEGF Trap—Regeneron, VEGF Trap (R1R2), VEGF Trap-Eye. Drugs R&D. 2008;9:261-9. |
| Akhurst, Targeting TGF-β Signaling for Therapeutic Gain. Cold Spring Harb Perspect Biol. Oct. 3, 2017;9(10):a022301. doi: 10.1101/cshperspect.a022301. |
| Akilesh et al., Neonatal FcR expression in bone marrow-derived cells functions to protect serum IgG from catabolism. J Immunol. Oct. 1, 2007;179(7):4580-8. |
| Allanore et al., Systemic sclerosis. Nat Rev Dis Primers. Apr. 23, 2015;1:15002. doi: 10.1038/nrdp.2015.2. 21 pages. |
| Baardsnes et al., TbetaR-II discriminates the high- and low-affinity TGF-beta isoforms via two hydrogen-bonded ion pairs. Biochemistry. Mar. 17, 2009;48(10):2146-55. doi: 10.1021/bi8019004. |
| Biswas et al. Anti-transforming growth factor-beta antibody treatment rescues bone loss and prevents breast cancer metastasis to bone. PloS one 2011;6:e27090. |
| Boocock et al., Mutations in SBDS are associated with Shwachman-Diamond syndrome. Nat Genet. Jan. 2003;33(1):97-101. doi: 10.1038/ng1062. Epub Dec. 23, 2002. |
| Bragado et al., TGF-β2 dictates disseminated tumour cell fate in target organs through TGF-β-RIII and p38α/β signalling. Nat Cell Biol. Nov. 2013;15(11):1351-61.doi: 10.1038/ncb2861. Epub Oct. 27, 2013. |
| De Crescenzo et al., Enhancement of the antagonistic potency of transforming growth factor-beta receptor extracellular domains by coiled coil-induced homo- and heterodimerization. J Biol Chem. Jun. 18, 2004;279(25):26013-8. doi: 10.1074/jbc.M400655200. Epub Mar. 24, 2004. |
| Desmouliere et al., Transforming growth factor-beta 1 induces alpha-smooth muscle actin expression in granulation tissue myofibroblasts and in quiescent and growing cultured fibroblasts. J Cell Biol. Jul. 1993;122(1):103-11. doi: 10.1083/jcb.122.1.103. |
| Edwards et al. Inhibition of TGF-beta signaling by 1D11 antibody treatment increases bone mass and quality in vivo. J Bone Miner Res 2010;25:2419-26. |
| Gabrielli et al., Scleroderma. N Engl J Med. May 7, 2009;360(19):1989-2003. doi: 10.1056/NEJMra0806188. |
| Gourh et al., Transforming Growth Factor Beta 3 (TGFB3)—a Novel Systemic Sclerosis Susceptibility Locus Involved in Fibrosis and Th17 Cell Development Identified by Genome-Wide Association Study in African Americans from the Genome Research in African American Scleroderma Patients Consortium. Arthritis & Rheumatology. 2017. 69(suppl 10). |
| Grütter et al., A cytokine-neutralizing antibody as a structural mimetic of 2 receptor interactions. Proc Natl Acad Sci U S A. Dec. 23, 2008;105(51):20251-6. Epub Dec. 10, 2008. doi: 10.1073/pnas.0807200106. |
| Guba et al., A Phase 1b/2 Dose Escalation and Cohort Expansion Study of the Safety, Tolerability and Efficacy of a Transforming Growth Factor-beta (TGF-beta) Receptor I Kinase Inhibitor (galunisertib) in Combination with Anti-PD-1 (nivolumab) in Advanced Refractory Solid Tumors. Annals Oncol. 2016;27(Supplement 6):vi359-vi378. doi: 10.1093/annonc/mdw378.55. 1 page. |
| Herbertz et al., Clinical development of galunisertib (LY2157299 monohydrate), a small molecule inhibitor of transforming growth factor-beta signaling pathway. Drug Des Devel Ther. Aug. 10, 2015;9:4479-99. doi: 10.2147/DDDT.S86621. |
| Hsu et al., Complement activation mediates cetuximab inhibition of non-small cell lung cancer tumor growth in vivo. Mol Cancer. Jun. 7, 2010;9:139. doi: 10.1186/1476-4598-9-139. |
| Huang, Receptor-Fc fusion therapeutics, traps, and MIMETIBODY technology. Curr Opin Biotech 2009;20:692-9. |
| Hunzelmann et al., Scleroderma: from pathophysiology to novel therapeutic approaches. Exp Dermatol. May 2010;19(5):393-400. doi: 10.1111/j.1600-0625.2010.01082.x. |
| Kissin et al., Myofibroblasts and hyalinized collagen as markers of skin disease in systemic sclerosis. Arthritis Rheum. Nov. 2006;54(11):3655-60. doi: 10.1002/art.22186. |
| Komai et al., Reevaluation of Pluripotent Cytokine TGF-β3 in Immunity. Int J Mol Sci. Aug. 1, 2018;19(8):2261. doi: 10.3390/ijms19082261. |
| Lacouture et al., Cutaneous keratoacanthomas/squamous cell carcinomas associated with neutralization of transforming growth factor β by the monoclonal antibody fresolimumab (GC1008). Cancer Immunol Immunother. Apr. 2015;64(4):437-46. Epub Jan. 13, 2015. doi: 10.1007/s00262-015-1653-0. |
| Lafyatis, Transforming growth factor β—at the centre of systemic sclerosis. Nat Rev Rheumatol. Dec. 2014; 10(12):706-19. Epub Aug. 19, 2014. doi: 10.1038/nrrheum.2014.137. |
| Langer et al., Quantitative trait analysis reveals transforming growth factor-beta2 as a positive regulator of early hematopoietic progenitor and stem cell function. J Exp Med. Jan. 5, 2004;199(1):5-14. doi: 10.1084/jem.20030980. |
| Leask, Targeting the TGFbeta, endothelin-1 and CCN2 axis to combat fibrosis in scleroderma. Cell Signal. Aug. 2008;20(8):1409-14. Epub Jan. 19, 2008. doi: 10.1016/j.cellsig.2008.01.006. |
| Martin et al., Selective inhibition of TGFβ1 activation overcomes primary resistance to checkpoint blockade therapy by altering tumor immune landscape. Sci Transl Med. Mar. 25, 2020;12(536):eaay8456. doi: 10.1126/scitranslmed.aay8456. |
| Mayes et al., Prevalence, incidence, survival, and disease characteristics of systemic sclerosis in a large US population. Arthritis Rheum. Aug. 2003;48(8):2246-55. doi: 10.1002/art.11073. |
| Meng et al., TGF-β: the master regulator of fibrosis. Nat Rev Nephrol. Jun. 2016;12(6):325-38. Epub Apr. 25, 2016. doi: 10.1038/nrneph.2016.48. |
| Midgley et al., Transforming growth factor-β1 (TGF-β1)-stimulated fibroblast to myofibroblast differentiation is mediated by hyaluronan (HA)-facilitated epidermal growth factor receptor (EGFR) and CD44 co-localization in lipid rafts. J Biol Chem. May 24, 2013;288(21):14824-38. Epub Apr. 15, 2013. doi: 10.1074/jbc.M113.451336. |
| Montoyo et al., Conditional deletion of the MHC class I-related receptor FcRn reveals the sites of IgG homeostasis in mice. Proc Natl Acad Sci U S A. Feb. 24, 2009;106(8):2788-93. doi:; 10.1073/pnas.0810796106. Epub Feb. 2, 2009. |
| Morris et al., Phase I study of GC1008 (fresolimumab): a human anti-transforming growth factor-beta (TGFβ) monoclonal antibody in patients with advanced malignant melanoma or renal cell carcinoma. PLOS One. Mar. 11, 2014;9(3):e90353. doi: 10.1371/journal.pone.0090353. |
| Muraoka et al., Blockade of TGF-beta inhibits mammary tumor cell viability, migration, and metastases. J Clin Invest. Jun. 2002;109(12):1551-9. |
| Nam et al. An anti-transforming growth factor beta antibody suppresses metastasis via cooperative effects on multiple cell compartments. Cancer Res 2008;68:3835-43. |
| Nam et al. Transforming growth factor beta subverts the immune system into directly promoting tumor growth through interleukin-17. Cancer Res 2008;68:3915-23. |
| Nanthakumar et al., Dissecting fibrosis: therapeutic insights from the small-molecule toolbox. Nat Rev Drug Discov. Oct. 2015;14(10):693-720. Epub Sep. 4, 2015. doi: 10.1038/nrd4592. |
| Pickup et al., The roles of TGF β in the tumour microenvironment. Nat Rev Cancer. Nov. 2013;13(11):788-99. doi: 10.1038/nrc3603. Epub Oct. 17, 2013. |
| Prud'Homme et al., Pathobiology of transforming growth factor beta in cancer, fibrosis and immunologic disease, and therapeutic considerations. Lab Invest. Nov. 2007;87(11):1077-91. Epub Aug. 27, 2007. doi: 10.1038/labinvest.3700669. |
| Qin et al., A novel highly potent trivalent TGF-β receptor trap inhibits early-stage tumorigenesis and tumor cell invasion in murine Pten-deficient prostate glands. Oncotarget. Dec. 27, 2016;7(52):86087-86102. doi: 10.18632/oncotarget.13343. Erratum in: Oncotarget. Aug. 21, 2017;8(34):57905. |
| Rice et al., A longitudinal biomarker for the extent of skin disease in patients with diffuse cutaneous systemic sclerosis. Arthritis Rheumatol. Nov. 2015;67(11):3004-15. doi: 10.1002/art.39287. |
| Rio et al., TGF-β: a master regulator of the bone marrow failure puzzle in Fanconi anemia. Stem Cell Investig. Nov. 7, 2016;3:75. doi: 10.21037/sci.2016.09.17. |
| Roberts et al., Role of transforming growth factor-beta in maintenance of function of cultured neonatal cardiac myocytes. Autocrine action and reversal of damaging effects of interleukin-1. J Clin Invest. Nov. 1992;90(5):2056-62. doi: 10.1172/JCI116087. |
| Rogers et al., Shwachman-Diamond syndrome. UpToDate. 2018. https://www.uptodate.com/contents/shwachman-diamond-syndrome/print . |
| Suragani et al. Ace-1332 (TGFbeta ligand trap) inhibits elevated TGFB1 signaling and reduces fibrosis in a murine model of myelofibrosis. Poster #P288, EHA 2016. 2 pages. |
| Suragani, Murine TGFbeta-antagonist (RAP-1332) Inhibits Fibrosis in a Murine Model of Myelofibrosis. Retrieved from Acceleronpharma.com on May 3, 2021. 18 pages. |
| Suzuki et al., Soluble type II transforming growth factor-beta receptor inhibits established murine malignant mesothelioma tumor growth by augmenting host antitumor immunity. Clin Cancer Res. Sep. 1, 2004;10(17):5907-18. |
| Tatusova et al., BLAST 2 Sequences, a new tool for comparing protein and nucleotide sequences. FEMS Microbiol Lett. May 15, 1999;174(2):247-50. doi: 10.1111/j.1574-6968.1999.tb13575.x. |
| Todd et al., Permanent alveolar collapse is the predominant mechanism in idiopathic pulmonary fibrosis. Expert Rev Respir Med. Aug. 2015;9(4):411-8. doi: 10.1586/17476348.2015.1067609. |
| Ueda et al. Systemic inhibition of transforming growth factor-beta in glioma-bearing mice improves the therapeutic efficacy of glioma-associated antigen peptide vaccines. Clin Cancer Res 2009;15:6551-9. |
| Vannucchi et al., A pathobiologic pathway linking thrombopoietin, GATA-1, and TGF-beta 1 in the development of myelofibrosis. Blood. May 1, 2005;105(9):3493-501. Epub Jan. 21, 2005. doi: 10.1182/blood-2004-04-1320. |
| Varga et al., Systemic sclerosis: a prototypic multisystem fibrotic disorder. J Clin Invest. Mar. 2007;117(3):557-67. doi: 10.1172/JCI31139. |
| Varga et al., Antitransforming growth factor-beta therapy in fibrosis: recent progress and implications for systemic sclerosis. Curr Opin Rheumatol. Nov. 2008;20(6):720-8. doi: 10.1097/BOR.0b013e32830e48e8. |
| Varga et al., Transforming growth factor-beta in systemic sclerosis (scleroderma). Front Biosci (Schol Ed). Jun. 1, 2009;1(1):226-35. doi: 10.2741/s22. |
| Vincenti et al., A Phase 2, Double-Blind, Placebo-Controlled, Randomized Study of Fresolimumab in Patients With Steroid-Resistant Primary Focal Segmental Glomerulosclerosis. Kidney Int Rep. Apr. 7, 2017;2(5):800-810. doi: 10.1016/j.ekir.2017.03.011. |
| Wang et al., Quantitative analysis of growth factor production in the mechanism of fibrosis in agnogenic myeloid metaplasia. Exp Hematol. Dec. 2006;34(12):1617-23. doi: 10.1016/j.exphem.2006.07.004. |
| Wang et al., Exosome-Mediated miR-29 Transfer Reduces Muscle Atrophy and Kidney Fibrosis in Mice. Mol Ther. Mar. 6, 2019;27(3):571-583. Epub Jan. 18, 2019. doi: 10.1016/j.ymthe.2019.01.008. |
| Yang et al., Cetuximab-mediated tumor regression depends on innate and adaptive immune responses. Mol Ther. Jan. 2013;21(1):91-100. doi: 10.1038/mt.2012.184. Epub Sep. 18, 2012. |
| Zhang et al., TGF-β Inhibition Rescues Hematopoietic Stem Cell Defects and Bone Marrow Failure in Fanconi Anemia. Cell Stem Cell. May 5, 2016;18(5):668-81. Epub Mar. 24, 2016. doi: 10.1016/j.stem.2016.03.002. |
| JP 2019-547490, Jan. 11, 2022, Office Action with English Translation. |
| JP 2019-547490, Jul. 26, 2022, Office Action with English Translation. |
| PCT/CA2021/050795, Sep. 7, 2021, International Search Report and Written Opinion. |
| PCT/IB2016/055204, Dec. 20, 2016, International Search Report and Written Opinion. |
| PCT/IB2016/055204, Mar. 15, 2018, International Preliminary Report on Patentability. |
| PCT/IB2018/051320, Sep. 12, 2019, International Preliminary Report on Patentability. |
| PCT/US2022/034671, Nov. 22, 2022, International Search Report and Written Opinion. |
| PCT/US2022/034677, Nov. 1, 2022, International Search Report and Written Opinion. |
| Number | Date | Country | |
|---|---|---|---|
| 20220204587 A1 | Jun 2022 | US |
| Number | Date | Country | |
|---|---|---|---|
| 62468586 | Mar 2017 | US | |
| 62465969 | Mar 2017 | US |
