A computer readable form of the Sequence Listing is filed with this application by electronic submission and is incorporated into this application by reference in its entirety. The Sequence Listing is contained in the file created on Dec. 6, 2023 having the file name “16-1443-WO-US-DIV2.xml” and is 91,069 bytes in size.
In spite of the availability of prophylactic Hepatitis B virus (HBV) vaccines, HBV infection remains a very significant global health problem in both industrialized and developing nations; it is second only to tobacco as a cause of cancer. There is a clear unmet need for a therapeutic HBV vaccine for patients chronically infected with HBV (CHB). 10-30% of those vaccinated with marketed HBV vaccines do not respond either due to genetic factors, or non-compliance (failure to return for a series of 3 vaccinations). Only 37% of individuals vaccinated once with a licensed HBV vaccine are protected; even after three vaccinations, which are difficult to achieve, many people do not respond effectively. There is no effective vaccine for the 400 million people chronically infected with HBV, including asymptomatic HBV carriers. The drugs currently used to treat CHB patients are problematic. Sustained antiviral responses are rarely achieved and the currently available therapies can lead to viral resistance and produce side effects in many CHB patients.
In one aspect, the invention provides compositions, comprising:
In one embodiment, the CD180 binding protein is an anti-CD180 antibody or antibody fragment, such as an anti-CD180 monoclonal antibody or antibody fragment. In another embodiment, the CD180 binding protein comprises a single chain (sc) recombinant protein, wherein the sc recombinant protein comprises:
wherein the HBcAg and/or the HBeAg is located at the N-terminus or the C-terminus of the sc recombinant protein.
In one embodiment, the VH and VL chain regions are from an anti-human CD180 antibody, such as an anti-human CD180 monoclonal antibody. In another embodiment, the sc recombinant protein does not include any other immunoglobulin domains. In a futher embodiment, the sc recombinant protein further comprises:
For example, the sc recombinant protein may comprise CH2 and CH3 domains from IgG1, such as human IgG1, or functional mutants thereof. In one embodiment, the VL chain region is located N-terminal to the VH chain region. In another embodiment, the VH chain region is located N-terminal to the VL chain region. In a further embodiment, the CD180 binding protein competes for binding to CD180 with monoclonal antibody G28-8.
In another embodiment, the HBcAg and/or the HBeAg is/are capable of multimerizing, such as dimerizing. In one embodiment, the HBcAg and/or the HBeAg comprise a multimerization domain, such as a dimerization domain. In various further embodiments, the HBcAg and/or the HBeAg comprises a polypeptide at least 90% identical over its length to the amino acid sequence of SEQ ID NO:13, 14, 15, 16, or 17. In a further embodiment, the composition comprises a polypeptide at least 90% identical over its length to the amino acid sequence of SEQ ID NO:2, 3, 5, 6, 8, 9, 11, 12, 18, 19, 20, or 21.
In one embodiment, the composition further comprises an adjuvant, including but not limited to toll-like receptor 4 (TLR4) agonist, a toll-like receptor 7 (TLR7) agonist, a toll-like receptor 8 (TLR8) agonist, a toll-like receptor 9 (TLR9) agonist, alum-containing adjuvant, monophosphoryl lipid A, oil-in-water emulsion, and a-tocopherol, squalene and polysorbate 80 in an oil-in-water emulsion.
In further aspects, the invention provides isolated nucleic acids encoding a composition of any embodiment or combination of embodiments of the invention, expression vectors comprising the isolated nucleic acids of the invention operatively linked to a suitable control sequence, and recombinant host cell comprising the expression vectors of the invention.
In another aspect, the invention provides pharmaceutical compositions comprising the composition, isolated nucleic acid, or expression vector of any embodiment, in combination with a pharmaceutically acceptable carrier.
In a further aspect, the invention provides methods for treating or limiting the development of a hepatitis-B virus (HBV)-related disorder, comprising administering to an individual in need thereof an amount effective to treat or limit development of the HBV-related disorder of the composition, isolated nucleic acid, expression vector, or the pharmaceutical composition of any embodiment of the invention.
All references cited are herein incorporated by reference in their entirety. Within this application, unless otherwise stated, the techniques utilized may be found in any of several well-known references such as: Molecular Cloning: A Laboratory Manual (Sambrook, et al., 1989, Cold Spring Harbor Laboratory Press), Gene Expression Technology (Methods in Enzymology, Vol. 185, edited by D. Goeddel, 1991. Academic Press, San Diego, CA), “Guide to Protein Purification” in Methods in Enzymology (M. P. Deutshcer, ed., (1990) Academic Press, Inc.); PCR Protocols: A Guide to Methods and Applications (Innis, et al. 1990. Academic Press, San Diego, CA), Culture of Animal Cells: A Manual of Basic Technique, 2nd Ed. (R. I. Freshney. 1987. Liss, Inc. New York, NY), Gene Transfer and Expression Protocols, pp. 109-128, ed. E. J. Murray, The Humana Press Inc., Clifton, N.J.), and the Ambion 1998 Catalog (Ambion, Austin, TX).
As used herein, the singular forms “a”, “an” and “the” include plural referents unless the context clearly dictates otherwise. “And” as used herein is interchangeably used with “or” unless expressly stated otherwise.
As used herein, the amino acid residues are abbreviated as follows: alanine (Ala; A), asparagine (Asn; N), aspartic acid (Asp; D), arginine (Arg; R), cysteine (Cys; C), glutamic acid (Glu; E), glutamine (Gln; Q), glycine (Gly; G), histidine (His; H), isoleucine (Ile; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; F), proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V).
All embodiments of any aspect of the invention can be used in combination, unless the context clearly dictates otherwise.
In a first aspect, the present invention provides compositions, comprising:
The compositions of the invention can be used, for example, to induce prophylactic responses in individuals at risk of HBV infection, and therapeutic responses in already infected individuals and in immunodeficient individuals who do not respond well to standard vaccines. The present invention is highly significant because it provides a therapeutic vaccine for one of the major causes of cancer and liver disease in the world: hepatitis B virus (HBV). HBV infection is a serious global public health problem in both industrialized and developing nations. 10-30 million people worldwide become infected with HBV each year, and more than 2 billion people worldwide have been infected with HBV. Significantly, the ability of unvaccinated individuals to mount effective immune responses against HBV is correlated with age. Infants and young children are particularly at risk, as 90% of infants and up to 50% of young children infected with HBV ultimately develop chronic infections. About 400 million are chronically infected with HBV (CHB), and in the USA there are approximately 1.4 million CHB infected people5. In the USA the prevalence of HBV while dropping in children, has changed little in adults11 such that the burden of chronic hepatitis B among adults remains large6; in some groups it is as high as 1%. An estimated 1 million people die each year from hepatitis and its complications, including about 5,000 people in the US. Of the 5000 persons in the United States who die each year from HBV related conditions, 300 die from fulminant hepatitis; 3-4000, from cirrhosis; and 600-1000, from primary hepatocellular carcinoma (HCC). In the US, approximately 400 health care workers are infected each year and are at risk from dying from HBV-related disease16.
The CD180 binding protein may be any molecule that binds directly to CD180 present in the surface of B cells, macrophages, or dendritic cells. In various non-limiting embodiments, the CD180 binding protein may be a peptide mimetic or an antibody.
In a particular embodiment, the CD180 binding protein an antibody or antibody fragment. As used herein, “antibody” includes reference to an immunoglobulin molecule immunologically reactive with human CD180 (preferably selective for CD180), and includes monoclonal antibodies. Various isotypes of antibodies exist, for example IgG1, IgG2, IgG3, IgG4, and other Ig, e.g., IgM, IgA, IgE isotypes. The term also includes genetically engineered forms such as chimeric antibodies (e.g., humanized murine antibodies) and heteroconjugate antibodies (e.g., bispecific antibodies), fully humanized antibodies, and human antibodies. As used throughout the application, the term “antibody” includes fragments with antigen-binding capability (e.g., Fab′, F(ab′)2, Fab, Fv and rIgG. See also, Pierce Catalog and Handbook, 1994-1995 (Pierce Chemical Co., Rockford, IL). See also, e.g., Kuby, J., Immunology, 3rd Ed., W.H. Freeman & Co., New York (1998). The term also refers to recombinant single chain Fv fragments (scFv). The term antibody also includes bivalent or bispecific molecules, diabodies, triabodies, and tetrabodies. Bivalent and bispecific molecules are described in, e.g., Kostelny et al.. (1992) J Immunol 148:1547, Pack and Pluckthun (1992) Biochemistry 31:1579, Hollinger et al., 1993, supra, Gruber et al. (1994) J Immunol :5368, Zhu et al. (1997) Protein Sci 6:781, Hu et al. (1996) Cancer Res. 56:3055, Adams et al. (1993) Cancer Res. 53:4026, and McCartney, et al. (1995) Protein Eng. 8:301. Various antigen binding domain-fusion proteins are also disclosed, e.g., in US patent application Nos. 2003/0118592 and 2003/0133939, and are encompassed within the term “antibody” as used in this application.
An antibody immunologically reactive with human CD180 can be generated by recombinant methods such as selection of libraries of recombinant antibodies in phage or similar vectors, see, e.g., Huse et al., Science 246:1275-1281 (1989); Ward et al., Nature 341:544-546 (1989); and Vaughan et al., Nature Biotech. 14:309-314 (1996), or by immunizing an animal with the antigen or with DNA encoding the antigen.
In one embodiment, the CD180 binding protein comprises a single chain (sc) recombinant protein, wherein the sc recombinant protein comprises:
The VH and VL chain regions may be from an anti-human CD180 antibody, such as an anti-human CD180 monoclonal antibody. Exemplary commercially available CD180 anti-human monoclonal antibodies from which the VH and VL chains may be used include, but are not limited to, those sold by AbD Serotec (“MHR73”), BD Biosciences, Thermo Scientific, Sigma Aldrich, etc.), (“G28-8”), and LifeSpan (“200.1”). In one embodiment, the single chain recombinant protein does not include any other immunoglobulin domains (i.e.: a single chain variable fragment (scFv). In an alternative embodiment, the single chain recombinant protein further comprises: CH2 and CH3 domains from an immunoglobulin (Ig), such as a human Ig, or functional mutants thereof, wherein the CH2 and CH3 domains are located C-terminal to the VH and VL domains. The CH2 and CH3 domains may be from any immunoglobulin as deemed appropriate for an intended use of the composition, including but not limited to IgA1, IgA2, IgG1, IgG2, IgG3, IgG4, IgM, etc. In a particular embodiment, the sc recombinant protein comprises CH2 and CH3 domains from IgG1, such as human IgG1, or functional mutants thereof. In a particular embodiment, such “functional mutants” comprise CH2 and/or CH3 domains that have impaired binding to human or animal Fc receptor FcγRIIb and/or to human or animal complement proteins; the Fc domain of the recombinant molecules is an altered human IgG1 Fc domain with three amino acid changes (P238S, P331S, K322S) that reduce the binding of the molecule to Fc receptors and C1q. Other amino acid substitutions that can reduce binding of human IgG1 to various Fc receptors have been reported (J Biol Chem 276: 6591-6604) The ones that are most interesting includes E233, L234, L235, G236 deletion, P238, D265, N297, A327, and P329. Substitutions at these amino acids reduce binding to all FcγR (J Biol Chem 276: 6591-6604). Substitutions at D270, Q295, or A327 reduce binding to FcγRII and FcγRIIIA (J Biol Chem 276: 6591-6604). Substitutions at S239, E269, E293, Y296, V303, A327, K338, and D376 reduce binding to FcγRIIIA but not FcγRII (J Biol Chem 276: 6591-6604). A combination of two of more of these substitutions can be engineered in the Fc domains of human IgG1 to achieve the desired effects on inhibiting Fc-FcγR interaction between CD180 targeted vaccines and FcgR expressing cells. Similarly, modifying the glycosylation profile of human IgG1, for example, substitution of the N-linked glycosylation site at Asn-297 of human IgG1, eliminates N-linked glycosylation of human IgG1, thereby eliminating its binding to Fc receptors as well as complement fixation functions (John S. Axford (ed.), Glycobiology and Medicine, 27-43; 2005 Springer.
In these various embodiments of the compositions of the invention, the VL chain region may be located N-terminal to the VH chain region, or the VH chain region may be located N-terminal to the VL chain region, as disclosed in the examples that follow.
In one embodiment, the CD180-antibody comprises mAb G28-8, which is commercially available from a number of sources, (BD Biosciences, Thermo Scientific, Sigma Aldrich, etc.), a F(ab′)2 fragment of mAb G28-8, or a single chain recombinant protein having the VL and VH domains of G28-8, and optionally further comprising CH2 and CH3 domains from an immunoglobulin (Ig), such as a human Ig, or functional mutants thereof. The inventors have used a variety of such G28-8 based compositions in the examples herein to demonstrate activity of the compositions of the invention.
In another embodiment, the CD180 binding protein competes for binding to CD180 with monoclonal antibody G28-8. As used herein, competing CD180 binding proteins are those binding proteins that bind to about, substantially or essentially the same, or even the same, epitope as G28-8. Competing binding proteins, such as competing antibodies or derivatives thereof, include binding proteins with overlapping epitope specificities. Competing binding proteins are thus able to effectively compete with G28-8 antibody, such as the G28-8 antibody obtained from Thermo Scientific (the “reference antibody”) for binding to CD180. A binding protein that competes with the reference G28-8 antibody for binding to CD180 will be able to effectively or significantly reduce (i.e.: reduce by at least 10%; preferably by at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, or more) reference G28-8 antibody binding to CD180, as evidenced by a reduction in bound label. In one embodiment, the reference G28-8 antibody is pre-mixed with varying amounts of the test binding proteins (e.g., 1:10, 1:100 or 1:1000) fora period of time prior to applying to a CD180 composition. In other embodiments, the reference G28-8 antibody and varying amounts of test binding proteins can simply be admixed during exposure to the CD180 composition. By using species or isotype secondary antibodies one will be able to detect only the bound reference G28-8 antibody, the binding of which will be reduced by the presence of a test binding protein that “competes” for binding. Detection of such binding events is well understood by those of skill in the art; examples are provided herein. For a further example, see Otipoby K L, Nagai Y, Shu G L, Miyake K, Clark E A. CD180 (RP105/Bgp95) workshop report. In Leukocyte Typing VII. White Cell Differentiation Antigens. Eds. D. Y. Mason et al., Oxford University Press, BC7, pp. 120-123, 2002.
As the identification of competing binding proteins is determined in comparison to the reference G28-8 antibody, it will be understood that actually determining the epitope to which the binding proteins bind is not in any way required in order to identify a competing binding proteins. However, epitope mapping can be performed using standard techniques, if desired.
The compositions of the invention comprise a Hepatitis B virus core antigen (HBcAg) and/or a Hepatitis B virus E antigen (HBeAg)), or antigenic fragments or mutants thereof (collectively referred to as HBcAg and/or HBeAg), attached to the CD180 binding protein. Thus, the compositions may comprise one or more HBeAgs and/or one or more HBeAgs. In all embodiment, one or more copies of HBcAgs and/or HBeAgs may be present at the N-terminus or the C-terminus of the single chain recombinant protein.
In one embodiment, the HBcAg and/or the HBeAg is capable of multimerizing (i.e.: forming dimers, trimers, tetramers, or other multimers). In a particular embodiment, the HBcAg and/or HBeAg are capable of dimerizing. In this embodiment, the HBV antigen forms the dimer in the composition. Recombinant proteins comprising HBeAg or wild-type HBcAg and dimeric anti-CD180 antibody or antibody fragments likely cannot be expressed efficiently. Thus, the inventors have used HBeAG and/or HBcAg that can form dimers, greatly enhancing efficient expression of the recombinant proteins of the invention. Furthermore, this design makes it (a) unnecessary to include a hinge region in the composition (as in a scAb) to create a dimer, and (b) acceptable to have a composition containing VL and VH only without any Fc domains, thereby reducing the risk of Fc-mediated depletion of the CD180-expressing antigen-presenting cells.
In one such embodiment, the HBcAg and/or HBeAg are capable of multimerization without the addition of an exogenous multimerization domain. For example, the HBV e-antigen (HBeAg), while being very closely related to HBcAg retains a propeptide that both blocks its interactions with HBcAg and enables it to form a loop structure and dimers. As a result, unlike HBcAg, HBeAg is capable of multimerizing, does not form capsids and is secreted from cells. In another embodiment, an HBcAg mutant having a single amino acid substitution of tyrosine to alanine at position 132 (HBcAgY132A) prevents the assembly of HBcAgY132A into higher order capsids. Instead, HBcAgY132A is expressed as a dimer. In a further embodiment, the HBcAg and/or the HBeAg comprise a multimerization domain, such as a dimerization domain. In these embodiments, the compositions do not form large, virus-like particles. Non-limiting examples of the numerous dimerization domains known to those of skill in the art and suitable for use in the present invention include, but are not limited to peptide helices containing at least one helix, or a structure formed by a helix, a coil and another helix, etc., coiled coil structures, dimerization domains within, for example, many cell surface signaling receptors, Fc regions or hinge regions of an antibody, leucine zippers, the STAT protein N terminal domain, FK506 binding protein, the LexA protein C-terminal domain, nuclear receptors, the FkpA N-terminal domain, orange carotenoid protein from A. maxima, M1 matrix protein from influenza, neuraminidase from influenza virus, E. coli fuculose aldolase; and the like. (see, e.g., O'Shea, Science. 254: 539 (1991), Barahmand-Pour et al., Curr. Top. Microbiol. Immunol. 211: 121-128 (1996); Klemm et al., Annu. Rev. Immunol. 16: 569-592 (1998); Klemm et al., Annu. Rev. Immunol. 16: 569-592 (1998); Ho et al., Nature. 382: 822-826 (1996); and Pomeranz et al., Biochem. 37: 965 (1998)). Further examples include residues 325 to 410 in the bovine papillomavirus E2 protein, (Dostatni, N., et al., EMBO J 7 (1988) 3807-3816; Haugen, T., et al. EMBO J 7 (1988) 4245-4253; McBride, A., et al., EMBO J 7 (1988) 533-539; McBride, A., et al., Proc Natl Acad Sci USA 86 (1989) 510-514),Type I deiodinase (D1): DFLVIYIEEAHASDGW (SEQ ID NO: 7) or ADFL--YI-EAH-DGW (SEQ ID NO: 63); HIV-1 Capsid Protein: QGPKEPFRDYVDRFYKTLRA (SEQ ID NO: 10); leucine zipper dimerization motif of yeast GCN4: HMKQL D VEEL S NYHL N VARL K VGER (SEQ ID NO: 22); leucine zipper in Escherichia coli transcriptional antiterminator protein; BgIG: GVTQLMREMLQLIKFQFSLNYQEESLSYQRLVT (SEQ ID NO: 23), EVSALEK (SEQ ID NO: 24) and/or KVSALKE (SEQ ID NO: 25).
In embodiments where the composition comprises HBcAg, the composition may comprise an HBcAg polypeptide at least 90% identical over its length to the amino acid sequence of SEQ ID NO:13, 14, 15, or 16.
In various further embodiments, the composition may comprise an HBcAg polypeptide at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical over its length to the amino acid sequence of SEQ ID NO:13, 14, 15, or 16. In various embodiments, additional HBcAg mutations may include (alone or in combination): F97L (J Virol. 2004 Sep;78(17):9538-43), V124W (J Virol. 2013 Mar;87(6):3208-16), substitution of residues that are phosphorylated in vivo, such as Ser87, Ser155, Ser162 and/or Ser170, to non-phosphorylatable residues (such as alanine or valie) (Biochem J. 2008 Nov 15;416(1):47-54; Biochem J. 2006 Sep 1;398(2):311-7), and/or substitution of one or more Cys residues (i.e.: Cys48, Cys61, Cys107, and/or Cys185) (to, for example, serine, alanine, or valine) which may increase dimerization (J Virol. 1992 Sep;66(9):5393-8).
In embodiments where the composition comprises HBeAg, the composition may comprise an HBeAg polypeptide at least 90% identical over its length to the amino acid sequence of SEQ ID NO:17.
In various further embodiments, the composition may comprise an HBeAg polypeptide at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical over its length to the amino acid sequence of SEQ ID NO: 17.
In all of these embodiments, the composition may further comprise an amino acid linker position between the CD180 binding protein and the HBcAg and/or HBeAg. The linker may be of any suitable length and amino acid composition, depending on the intended use. In one embodiment, the linker is between about 2-40 amino acids in length. In other embodiments, the linker may be between 10-30 or 15-25 amino acids in length. In another embodiment, the linker may be a linker rich in glycine and serine residues. In one specific embodiment, the linker may comprise the amino acid sequence
In various further embodiments, the composition may comprise or consist of a polypeptide at least 90% identical over its length to the amino acid sequence of SEQ ID NO:2, 3, 5, 6, 8, 9, 11, 12, 18, 19, 20, or 21.
GKSPQLLVYN AKTLAEGVPS RFSVSGSGTQ FSLRINSLQP EDFGTYYCQH HFGSPRTFGG
GTKLEIKDL
G GGGSGGGGSG GGGSGGGGST GEVQLQQSGP ELVKPGASMK ISCKASGYSF
TGYTMNWVKQ SHGKTLEWIG LINPYNGVTS YNQKFKDKAT LTVDKSSSTA YMELLSLTSE
DSAIYYCARD YNYDYFDYWG QGTTLTVSSG GGGSGGGGSG GGGSGGGGSM DIDPYKEFGA
SVELLSFLPS DFFPSIRDLL DTASALYREA LESPEHCSPH HTALRQAILC WGELMNLATW
VGSNLEDPAS RELVVSYVNV NMGLKIRQLL WFHISCLTFG RETVLEYLVS FGVWIRTPPA
ARPPNAPILS TLPETTVV(HH HHHH)
GKSPQLLVYN AKTLAEGVPS RFSVSGSGTQ FSLRINSLQP EDFGTYYCQH HFGSPRTFGG
GTKLEIKDL
G GGGSGGGGSG GGGSGGGGST GEVQLQQSGP ELVKPGASMK ISCKASGYSF
TGYTMNWVKQ SHGKTLEWIG LINPYNGVTS YNQKFKDKAT LTVDKSSSTA YMELLSLTSE
DSAIYYCARD YNYDYFDYWG QGTTLTVSSG GGGSGGGGSG GGGSGGGGSM DIDPYKEFGA
SVELLSFLPS DFFPSIRDLL DTASALYREA LESPEHCSPH HTALRQAILC WGELMNLATW
VGSNLEDPAS RELVVSYVNV NMGLKIRQLL WFHISCLTFG RETVLEYLVS FGVWIRTPPA
YRPPNAPILS TLPETTVV
(HH HHHH)
GKSPQLLVYN AKTLAEGVPS RFSVSGSGTQ FSLRINSLQP EDFGTYYCQH HFGSPRTFGG
GTKLEIKDL
G GGGSGGGGSG GGGSGGGGST GEVQLQQSGP ELVKPGASMK ISCKASGYSF
TGYTMNWVKQ SHGKTLEWIG LINPYNGVTS YNQKFKDKAT LTVDKSSSTA YMELLSLTSE
DSAIYYCARD YNYDYFDYWG QGTTLTVSSG GGGSGGGGSG GGGSGGGGSM DIDPYKEFGA
SVELLSFLPS DFFPSIRDLL DTASALYREA LESPEHCSPH HTALRQAILC WGELMNLATW
VGSNLEDPAS RELVVSYVNV NMGLKIRQLL WFHISCLTFG RETVLEYLVS FGVWIRTPPA
ARPPNAPILS TLPETTVVRR RGRSPRRRTP SPRRRRSQSP RRRRSQSR
(HH HHHH)
GKSPQLLVYN AKTLAEGVPS RFSVSGSGTQ FSLRINSLQP EDFGTYYCQH HFGSPRTFGG
GTKLEIKDL
G GGGSGGGGSG GGGSGGGGST GEVQLQQSGP ELVKPGASMK ISCKASGYSF
TGYTMNWVKQ SHGKTLEWIG LINPYNGVTS YNQKFKDKAT LTVDKSSSTA YMELLSLTSE
DSAIYYCARD YNYDYFDYWG QGTTLTVSSG GGGSGGGGSG GGGSGGGGSM DIDPYKEFGA
SVELLSFLPS DFFPSIRDLL DTASALYREA LESPEHCSPH HTALRQAILC WGELMNLATW
VGSNLEDPAS RELVVSYVNV NMGLKIRQLL WFHISCLTFG RETVLEYLVS FGVWIRTPPA
YRPPNAPILS TLPETTVVRR RGRSPRRRTP SPRRRRSQSP RRRRSQSR
(HH HHHH)
SYLAWYQQKQ GKSPQLLVYN AKTLAEGVPS RFSVSGSGTQ FSLRINSLQP
EDFGTYYCQH HFGSPRTFGG GTKLEIKDL
G GGGSGGGGSG GGGSGGGGST
GEVQLQQSGP ELVKPGASMK ISCKASGYSF TGYTMNWVKQ SHGKTLEWIG
LINPYNGVTS YNQKFKDKAT LTVDKSSSTA YMELLSLTSE DSAIYYCARD
YNYDYFDYWG QGTTLTVSSG GGGSGGGGSG GGGSGGGGSS KLCLGWLWGM
DIDPYKEFGA SVELLSFLPS DFFPSIRDLL DTASALYREA LESPEHCSPH
HTALRQAILC WGELMNLATW VGSNLEDPAS RELVVSYVNV NMGLKIRQLL
WFHISCLTFG RETVLEYLVS FGVWIRTPPA YRPPNAPILS TLPETTVV
(HH
DFFPSIRDLL DTASALYREA LESPEHCSPH HTALRQAILC WGELMNLATW
VGSNLEDPAS RELVVSYVNV NHGLKIRQLL WFHISCLTFG RETVLEYLVS
FGVWIRTPPA YRPPNAPILS TLPETTVVGG GGSGGGGSGG GGSGGGGSDI
QMTQSPASLS ASVGETVTIT CRASEKIYSY LAWYQQKQGK SPQLLVYNAK
TLAEGVPSRF SVSGSGTQFS LRINSLQPED FGTYYCQHHF GSPRTFGGGT
KLEIKDL
GGG GSGGGGSGGG GSGGGGSTGE VQLQQSGPEL VKPGASMKIS
CKASGYSFTG YTMNWVKQSH GKTLEWIGLI NPYNGVTSYN QKFKDKATLT
The compositions of any embodiment or combination of embodiments of the invention may be provided as a stand-alone composition, or may be provided as part of a molecular scaffold. In various embodiments, the composition may be attached to molecular scaffold. Any suitable scaffold can be used, including but not limited to a VNAR single domain antibody (shark variable new antigen receptor), a lamprey variable lymphocyte receptor, a Im 7(colicin immunity 7 protein), an anticalin (lipocalin transport proteins), an FN3 (fibronectin 3) monobody, a DARPin (designed ankyrin repeat proteins), an affibody (Z domain of protein A), etc., with CD180-binding polypeptide loops.
In another embodiment, the composition of any embodiment or combination of embodiments of the invention further comprises an adjuvant. While adjuvant is not required to induce rapid activation of HBcAg and/or HBeAg-specific B cells, addition of adjuvant to the compositions can result in additional enhancement of the immune response when the compositions are used in the methods of the invention. Any suitable adjuvant can be used, including but not limited to inorganic compounds (aluminum hydroxide, aluminum phosphate, calcium phosphate hydroxide, beryllium, etc.), mineral oil, detergents, cytokines, toll-like receptor agonists, Freund's complete adjuvant, Freund's incomplete adjuvant, squalene, etc. In a preferred embodiment, the adjuvant comprises or consists of a toll-like receptor 4 (TLR4) agonist, a toll-like receptor 7 (TLR7) agonist, a toll-like receptor 8 (TLR8) agonist, a toll-like receptor 9 (TLR9) agonist, alum-containing adjuvant, monophosphoryl lipid A, oil-in-water emulsion, and α-tocopherol, squalene and polysorbate 80 in an oil-in-water emulsion. The adjuvant may be present in the composition as an unlinked component or a linked component, depending on the adjuvant used.
In another embodiment, the compositions of the invention can be modified to extend half-life, such as by attaching at least one molecule to the composition for extending serum half-life, including but not limited to a polyethlyene glycol (PEG) group, serum albumin, transferrin, transferrin receptor or the transferrin-binding portion thereof, or combinations thereof. As used herein, the word “attached” refers to a covalently or noncovalently conjugated substance. The conjugation may be by genetic engineering or by chemical means.
The compositions of the present invention may be stored in any suitable buffer.
In a second aspect, the present invention provides isolated nucleic acids encoding the composition of any embodiment of the first aspect of the invention. The isolated nucleic acid sequence may comprise RNA or DNA. Such isolated nucleic acid sequences may comprise additional sequences useful for promoting expression and/or purification of the encoded protein, including but not limited to polyA sequences, modified Kozak sequences, and sequences encoding epitope tags, export signals, and secretory signals, nuclear localization signals, and plasma membrane localization signals. In various non-limiting embodiments, the isolated nucleic acids encode the polypeptide of any one of SEQ ID NOS: 2, 3, 5, 6, 8, 9, 11, or 12. In other embodiments, the isolated nucleic acids comprise or consist of the nucleotide sequence of SEQ ID NO:1, 4, 7, or 10.
In a third aspect, the present invention provides nucleic acid vectors comprising the isolated nucleic acid of the second aspect of the invention. “Recombinant expression vector” includes vectors that operatively link a nucleic acid coding region or gene to any promoter capable of effecting expression of the gene product. The promoter sequence used to drive expression of the disclosed nucleic acid sequences in a mammalian system may be constitutive (driven by any of a variety of promoters, including but not limited to, CMV, SV40, RSV, actin, EF) or inducible (driven by any of a number of inducible promoters including, but not limited to, tetracycline, ecdysone, steroid-responsive). The construction of expression vectors for use in transfecting prokaryotic cells is also well known in the art, and thus can be accomplished via standard techniques. (See, for example, Sambrook, Fritsch, and Maniatis, in: Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory Press, 1989; Gene Transfer and Expression Protocols, pp. 109-128, ed. E. J. Murray, The Humana Press Inc., Clifton, N.J.), and the Ambion 1998 Catalog (Ambion, Austin, TX). The expression vector must be replicable in the host organisms either as an episome or by integration into host chromosomal DNA. In a preferred embodiment, the expression vector comprises a plasmid. However, the invention is intended to include other expression vectors that serve equivalent functions, such as viral vectors.
The nucleic acids and vectors of the invention can be used not only for production of large quantities of the compositions of the invention, but also for use as a nucleic acid (such as a DNA) vaccine administered by gene gun or other methods.
In a fourth aspect, the present invention provides recombinant host cells comprising the nucleic acid vector of the third aspect of the invention. The host cells can be either prokaryotic or eukaryotic. The cells can be transiently or stably transfected. Such transfection of expression vectors into prokaryotic and eukaryotic cells (including but not limited to Chinese hamster ovary (CHO) cells) can be accomplished via any technique known in the art, including but not limited to standard bacterial transformations, calcium phosphate co-precipitation, electroporation, or liposome mediated-, DEAE dextran mediated-, polycationic mediated-, or viral mediated transfection. (See, for example, Molecular Cloning: A Laboratory Manual (Sambrook, et al., 1989, Cold Spring Harbor Laboratory Press; Culture of Animal Cells: A Manual of Basic Technique, 2nd Ed. (R. I. Freshney. 1987. Liss, Inc. New York, NY).
The recombinant host cells can be used, for example in methods for producing antibody (when the binding protein is an antibody), comprising:
Suitable conditions for expression of the nucleic-acid encoded antibody composition can be determined by those of skill in the art based on the teachings herein, the specific host cells and vectors used, and the general knowledge of those of skill in the art.
The term “recombinant” when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, e.g., recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all. By the term “recombinant nucleic acid” herein is meant nucleic acid, originally formed in vitro, in general, by the manipulation of nucleic acid, e.g., using polymerases and endonucleases, in a form not normally found in nature. In this manner, operably linkage of different sequences is achieved. Thus an isolated nucleic acid, in a linear form, or an expression vector formed in vitro by ligating DNA molecules that are not normally joined, are both considered recombinant for the purposes disclosed herein. It is understood that once a recombinant nucleic acid is made and reintroduced into a host cell or organism, it will replicate non-recombinantly, i.e., using the in vivo cellular machinery of the host cell rather than in vitro manipulations; however, such nucleic acids, once produced recombinantly, although subsequently replicated non-recombinantly, are still considered recombinant for the purposes disclosed herein.
In a fifth aspect, the present invention provides pharmaceutical compositions, comprising:
The pharmaceutical composition may comprise in addition to the composition of the invention (a) a lyoprotectant; (b) a surfactant; (c) a bulking agent; (d) a tonicity adjusting agent; (e) a stabilizer; (f) a preservative and/or (g) a buffer. In some embodiments, the buffer in the pharmaceutical composition is a Tris buffer, a histidine buffer, a phosphate buffer, a citrate buffer or an acetate buffer. The pharmaceutical composition may also include a lyoprotectant, e.g. sucrose, sorbitol or trehalose. In certain embodiments, the pharmaceutical composition includes a preservative e.g. benzalkonium chloride, benzethonium, chlorohexidine, phenol, m-cresol, benzyl alcohol, methylparaben, propylparaben, chlorobutanol, o-cresol, p-cresol, chlorocresol, phenylmercuric nitrate, thimerosal, benzoic acid, and various mixtures thereof. In other embodiments, the pharmaceutical composition includes a bulking agent, like glycine. In yet other embodiments, the pharmaceutical composition includes a surfactant e.g., polysorbate-20, polysorbate-40, polysorbate-60, polysorbate-65, polysorbate-80 polysorbate-85, poloxamer-188, sorbitan monolaurate, sorbitan monopalmitate, sorbitan monostearate, sorbitan monooleate, sorbitan trilaurate, sorbitan tristearate, sorbitan trioleaste, or a combination thereof. The pharmaceutical composition may also include a tonicity adjusting agent, e.g., a compound that renders the formulation substantially isotonic or isoosmotic with human blood. Exemplary tonicity adjusting agents include sucrose, sorbitol, glycine, methionine, mannitol, dextrose, inositol, sodium chloride, arginine and arginine hydrochloride. In other embodiments, the pharmaceutical composition additionally includes a stabilizer, e.g., a molecule which, when combined with a protein of interest substantially prevents or reduces chemical and/or physical instability of the protein of interest in lyophilized or liquid form. Exemplary stabilizers include sucrose, sorbitol, glycine, inositol, sodium chloride, methionine, arginine, and arginine hydrochloride.
The pharmaceutical compositions of the invention may be made up in any suitable formulation, preferably in formulations suitable for administration by injection. Such pharmaceutical compositions can be used, for example, in methods of use as vaccines, prophylactics, or therapeutics.
The pharmaceutical compositions may contain any other components as deemed appropriate for a given use, such as additional therapeutics or vaccine components. In one embodiment, the pharmaceutical compositions further comprise toll-like receptor 4 (TLR4) agonist, a toll-like receptor 7 (TLR7) agonist, a toll-like receptor 8 (TLR8) agonist, a toll-like receptor 9 (TLR9) agonist, alum-containing adjuvant, monophosphoryl lipid A, oil-in-water emulsion, and α-tocopherol, squalene and polysorbate 80 in an oil-in-water emulsion.
In a sixth aspect, the present invention provides methods for treating or limiting development of an HBV infection or a hepatitis-B virus (HBV)-related disorder, comprising administering to an individual in need thereof an amount effective to treat or limit development of the disorder of the composition, isolated nucleic acid, recombinant expression vector, or pharmaceutical composition, or a pharmaceutical salt thereof, of any embodiment or combination of embodiments of the present invention. In one embodiment, the compositions are used prophylactically as vaccines to limit development of HBV infection disease/severity of infectious disease, such as in individuals that have not been exposed to an infectious agent but are at risk of such exposure. In other embodiments, the methods can be used therapeutically to treat people exposed to or chronically infected with HBV.
The methods of the invention target antigen to CD180, a surface protein expressed on B cells, macrophages, and dendritic cells, that to produce antigen-specific IgG in the absence of T cell costimulation (such as CD40 deficiency) or the complete absence of T cells (such as TCR β/δ deficiency). Thus, the methods can be used in any therapeutic or prophylactic treatment for HBV infection or vaccination. This approach also finds use, for example, for neonates, the elderly, and the immunodeficient, both in specifically targeting cellular populations enriched in underdeveloped or otherwise deficient immune systems and by improving responses to antigens that require linked recognition (carbohydrate epitopes, etc.).
As used herein, “treat” or “treating” means accomplishing one or more of the following in an individual that already has a disorder or has already been exposed to a disorder-causing substance/pathogen: (a) reducing the severity of the disorder; (b) limiting or preventing development of symptoms characteristic of the disorder(s) being treated (ex: immune deficiencies in cancer patients or other patients) undergoing chemotherapy and/or radiation therapy); (c) inhibiting worsening of symptoms characteristic of the disorder(s) being treated; (d) limiting or preventing recurrence of the disorder(s) in patients that have previously had the disorder(s); and (e) limiting or preventing recurrence of symptoms in patients that were previously symptomatic for the disorder(s).
As used herein, “limiting” or “limiting development of” means accomplishing one or more of the following in an individual that does not have the disorder to be limited: (a) preventing the disorder; (b) reducing the severity of the disorder; and (c) limiting or preventing development of symptoms characteristic of the disorder.
As used herein, an “amount effective” refers to an amount of the composition that is effective for treating and/or limiting the relevant disorder.
While the methods of the invention do not require use of an adjuvant, the methods may further comprise administering an adjuvant for possible additional enhancement of the immune response Any suitable adjuvant can be used, including but not limited to toll-like receptor 4 (TLR4) agonist, a toll-like receptor 7 (TLR7) agonist, a toll-like receptor 8 (TLR8) agonist, a toll-like receptor 9 (TLR9) agonist, alum-containing adjuvant, monophosphoryl lipid A, oil-in-water emulsion, and α-tocopherol, squalene and polysorbate 80 in an oil-in-water emulsion.
The individual may be any suitable individual, including but not limited to mammals. Preferably the individual is a human. In one embodiment, the individual has a T-cell deficiency and/or a defect in co-stimulation between B cells and T cells, or is immuno-compromised by chronic infections or from acute or chronic taking of immunosuppressive drugs for treatment of autoimmune diseases, or other inflammatory disease. In another embodiment, the individual is less than one month old or is elderly (i.e.: at least 65 years old).
In various other embodiments, the individual has a hepatitis B-related disease, such as hepatitis, hepatitis-related disease, fulminant hepatitis, cirrhosis, and/or hepatocellular carcinoma, and the methods are used to treat the a hepatitis B-related disease, such as hepatitis, hepatitis-related disease, fulminant hepatitis, cirrhosis, and/or hepatocellular carcinoma.
G28-8 (anti-human CD180) scFv-HBcAg recombinant vaccine molecules. The inventors have demonstrated that for the specific anti-CD180 antibody, G28-8, a single chain antibody (scAb) in the form of VLVH-human IgG1 Fc retains both the efficient binding as well as the biological properties of its parent G28-8 IgG. The G28-8LH single chain Fv (scFv) was used to create G28-8scFv-HBcAg recombinant vaccine constructs. scFv generated from other anti-CD180 antibodies should retain the antibody characteristics in either the VLVH, or the VHVL configuration.
HBV capsid proteins that do not self-assemble can be attached to anti-CD180 scFv and expressed. Normally HBV capsid proteins (HBcAgs) self-assemble around the pre-genomic HBV RNA and the viral reverse transcriptase. The assembly domain of the HBcAg plays a key role in the assembly of the capsid and its stability. The tyrosine residue Y132 is required to stabilize the interactions between HBV core Ag dimers, which in turn is required for icosahedral capsids to form. HBcAg proteins with a single mutation at Y132 to alanine (Y132A) have defective capsid assembly.38,39 The HBcAgY132A mutant is a stable dimer but unlike wildtype HBcAg, does not assemble into capsids even at high salt solution (1 M NaCl). Because HBcAg-Y132A proteins form dimers and crosslinking of CD180 is required for optimal signaling, we proposed that anti-CD180 scFv-HBcAgY132A proteins may form dimers. Because scFv G28-8LH has shown to retain the binding and B cell stimulatory activity, it was used to construct the recombinant vaccine molecule consisting of HBcAgY132A. The dimeric nature of anti-CD180 scFv in such G28-8LH-HBcAgY132A protein was in turn be able to functionally engage CD180 molecules on antigen-presenting to activate them, e.g., activation of B cells. We designed a DNA sequence encoding a protein comprised of the VL and VH domains of G28-8 (anti-CD180), a Glycine-Serine linker, the HBcAgY132A mutant protein, and a His tag at the C-terminal for affinity purification of the recombinant vaccine molecule (
The native leader sequence from the VL domain of G28-8 was included to facilitate secretion of the recombinant vaccine molecules from the host CHO cells (SEQ ID NO: 1, SEQ ID NO:2).
GKSPQLLVYN AKTLAEGVPS RFSVSGSGTQ FSLRINSLQP EDFGTYYCQH HFGSPRTFGG
GTKLEIKDL
G GGGSGGGGSG GGGSGGGGST GEVQLQQSGP ELVKPGASMK ISCKASGYSF
TGYTMNWVKQ
SHGKTLEWIG
LINPYNGVTS
YNQKFKDKAT
LTVDKSSSTA
YMELLSLTSE
DSAIYYCARD
YNYDYFDYWG
QGTTLTVSSG GGGSGGGGSG GGGSGGGGSM DIDPYKEFGA
SVELLSFLPS DFFPSIRDLL DTASALYREA LESPEHCSPH
HTALRQAILC WGELMNLATW
VGSNLEDPAS RELVVSYVNV NMGLKIRQLL WFHISCLTFG
RETVLEYLVS FGVWIRTPPA
ARPPNAPILS TLPETTVV
(HH HHHH)
The predicted mature polypeptide sequence after the cleavage of the leader sequence is given in SEQ ID NO: 3. The HBcAgY132A sequence in this vaccine construct consists of amino acid residues 1 to 149 of HBcAg without the C-terminal arginine-rich resides of 150-183.
Production of recombinant the G28-8LH-HBcAgY132A-His protein. Complementary DNAs (cDNAs) encoding the G28-8LH-HBcAgY132A-His recombinant proteins (
As a second test for binding, a competition assay was performed (
The ability of G28-8LH-HBcAgY132A-His to upregulate CD40 expression was then tested to evaluate its functional activity. Er-blood mononuclear cells enriched for B cells were incubated for 24 hrs at 37° C. with either media (black line) or 10 μg/ml of G28-8 (dotted line) or 10 μg/mIG28-8LH-HBcAgY132A-His. Samples were washed twice with PBSA, stained with mAb specific for CD20 (Pacific Blue Biolegend) and CD40 (FITC BD BioSciences) and evaluated for CD40 and CD20 expression using flow cytometry.
The ability of G28-8LH-HBcAg132A-His to induce humoral and cellular immune responses was examined in a vaccination experiment in rhesus macaques (Macaca mulatta). Groups of rhesus macaques (N=3) were vaccinated subcutaneously with either: 1) 300 μg of G28-8LH-HBcAgY132A-His (αCD180-HBVAg) in 1 ml; 2) 300 μg of G28-8LH-HBcAgY132A-His (HBcAg-CD180) plus 1 mg of long chain poly I:C (InvivoGen, San Diego) in 1 ml; 300 μg of G28-8LH-HBcAgY132A-His (HBcAg-CD180) plus 1 mg CpGB (Coley Pharmaceuticals) in 1 ml; or 4) 16 micrograms of G28-8LH-HBcAgY132A-His encoding plasmid DNA (HBcAg-CD180 DNA) coated onto 1 micron gold beads at a rate of 2.0 ug DNA per mg gold particles. The particles were then injected intracellularly into the epidermis of the skin using a gene gun (GG) as described.41 Animals were vaccinated on days 0, 30 and 81, and on days 0, 7, 14, 30 (time-points after first dose), 44, 62, 76, 90 (time-points after second dose), 111, 118, 125, 139 and 164 (time-points after 3rd dose), serum and heparinized blood samples were obtained. Serum samples were assessed for IgG antibody responses to HBcAg by ELISA as follows: a) coating 96 well plates with 200 ng/well recombinant HBcAg (expressed in yeast); b) adding serial dilutions of serum samples (100 μl diluted in TBS+0.05% tween-20) starting with a 1:1000 dilution, followed by washing and adding HRP-anti-macaque IgG second step (Rockland, 1:5000 dilution). All four groups produced IgG after immunizations (
To determine the frequency of HBcAg-specific, intracellular cytokine-producing CD4 and CD8 T cells after vaccination of macaques, peripheral blood mononuclear cells were isolated from heparinized blood samples obtained from immunized macaques 28 days after the final dose on day 81 as noted in Example 3 and resuspended in growth media at defined concentrations (˜1.2 million cells/condition). Cells were plated together with either: Staphylococcal enterotoxin B (SEB, Toxin Technology, Sarasota) or PMA/lonomycin (positive controls); HBcAg peptide pools (Table 1, experimental); or DMSO (neg control) at the same concentration as in the peptide pools. After an incubation for 1 hr at 37° C. to initiate stimulation, brefeldin A was added to retain cytokines in the cells. Cells were then incubated for an additional 11-14 hrs, after which staining was initiated. First, cells were stained to detect surface markers: CD3, CD4, CD8 and CD107(a marker of cytolytic effector function), then cells were fixed, permeabilized and stained with antibodies that detect intracellular cytokines (IFNγ, TNFα or IL-2). Cells were then analyzed using an LSRII flow cytometer. Analyses were performed using PBMCs obtained 28 days after a second booster vaccination first treated as follows: Cells (1.2×106) were stimulated in 96 well plates with 37 HBcAg peptides (Table 1) divided into 2 pools of n=18 and n=19 peptides at 2 μg/ml together with costimulatory anti-CD28 and anti-CD49d antibodies (5 μg/ml in total volume of 200 μl) for 1 hour at 37 C. Cells in control wells were incubated with medium only (negative control) or with SEB enterotoxin (5 μg/ml, positive control). Brefeldin A (Sigma) was added to wells at a final concentration of 0.05 μg/ml, and then cells were incubated for an additional 5 hours at 37 C, after which plates were wrapped in plastic and aluminum foil and incubated overnight at 4 C. Cells were then centrifuged and washed with PBS and stained with a live/dead cell stain (Invitrogen), incubated for 10 minutes (min) at room temperature (RT), washed and then stained with sets of chromophore-labeled monoclonal antibodies (mAbs) specific for cell surface markers included CD3-APC, CD4-PerCP Cy5.5, CD8-APC-Cy7, CD28-PECF594 and CD107a/b-FITC (all Becton Dickinson, BD) and CCR7-PerCPefluor710 (eBioscience) at 1:50 dilution, 50 μl. After a 30 min incubation in the dark at RT, cells were centrifuged and washed with PBS and then treated with BD Fixation/Permeabilization Solution (1×, Cytofix/Cytoperm™ kit BD # 554714), incubated in the dark for 20 min at RT, and washed twice with 200 μl/well of 1×BD Perm/Wash™ buffer. After removal of this wash buffer, cells were stained with 100 μl of a combination of TNFα-PE Cy7 1:20 (BD), IL-2 PE 1:10 (Biolegend) or IFNγ-V450 1:20 (Biolegend), mixed, and incubated for 60 min at 4 C. Cells were then washed with 1×BD Perm/Wash™ Buffer and fixed with 2% paraformaldehyde in PBS for at least 1 hour at 4 C before analysis using an LSR II flow cytometer.
Whether or not targeted of HBcAg132A-His to CD180 was required to induce a humoral immune response was examined in a vaccination experiment in rhesus macaques (Macaca mulatta). Two groups of rhesus macaques (N=3) were vaccinated subcutaneously with either: 1) 300 μg of G28-8LH-HBcAgY132A-His (aCD180-HBVAg) in 1 ml; or 2) 150 μg of HBcAgY132A-His, which was equivalent to the amount of HBcAgY132A-His used in Group 1 where it was attached to G28-8LH. Animals were vaccinated on days 0 and 30 and on days 0 (prebleed) and 44 (14 days after second dose) serum and heparinized blood samples were obtained. Serum samples were assessed for IgG antibody responses to HBcAgY132A by ELISA as follows: a) coating 96 well plates with 200 ng/well recombinant HBcAgY132A (expressed in CHO cells as in
This invention was made with government support under National Institute of Allergy & Infectious Diseases grant number AI044257. The government has certain rights in the invention.
Number | Date | Country | |
---|---|---|---|
62319160 | Apr 2016 | US |
Number | Date | Country | |
---|---|---|---|
Parent | 17721554 | Apr 2022 | US |
Child | 18533676 | US | |
Parent | 16088386 | Sep 2018 | US |
Child | 17721554 | US |