Anthrax and Small Pox replikins and methods of use

Information

  • Patent Application
  • 20020120106
  • Publication Number
    20020120106
  • Date Filed
    October 26, 2001
    24 years ago
  • Date Published
    August 29, 2002
    23 years ago
Abstract
Isolated peptides of the Bacillus anthracis Anthrax Toxin Lethal factor Protein pX01-107, antibodies specific for the peptides and methods of stimulating the immune response of a subject to produce antibodies to the Bacillus anthracis Anthrax Toxin Lethal factor Protein pX01-107 are disclosed. Also disclosed are isolated peptides of the Small Pox Virus Surface Antigen S Precursor Protein, antibodies specific for the peptides and methods of stimulating the immune response of a subject to produce antibodies to the Small Pox Virus Surface Antigen S Precursor Protein.
Description


FIELD OF THE INVENTION

[0002] This invention relates to the identification and use of Replikins, a class of peptides that share structural characteristics. In particular, this invention relates to Replikins which have been identified in Bacillus anthracis and Small Pox Virus (Variola).



BACKGROUND OF THE INVENTION

[0003] Glycoprotein 10B is a membrane glycoprotein isolated from brain glioblastoma multiforme, lymphoma and breast cancer cells (U.S. Pat. No. 6,242,578 B1). A constituent peptide of Aglyco 10B, malignin, is enriched in cell membranes tenfold during anaerobic replication. Hydrolysis and mass spectrometry of malignin yielded a 16-mer peptide including (SEQ ID NO.: 1) kagvaflhkk. This peptide, which is absent from the normal human genome, was assumed to be acquired.



SUMMARY OF THE INVENTION

[0004] In one aspect of the invention there are provided isolated Bacillus anthracis (Anthrax) peptides containing a replikin sequence. The Anthrax peptides comprise from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten amino acid residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues. In another embodiment of this aspect of the invention there are provided Small Pox Virus peptides containing a replikin sequence which comprises from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten amino acid residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues.


[0005] In another aspect of the invention there is provided a process for stimulating the immune system of a subject to produce antibodies that bind specifically to Anthrax polypeptides containing a replikin sequence, said process comprising administering to the subject an effective amount of a dosage of a composition comprising at least one Anthrax replikin peptide. In a preferred embodiment the composition comprises at least one peptide selected from SEQ ID NO. 91, SEQ ID NO. 92, SEQ ID NO. 93, SEQ ID NO. 94, SEQ ID NO. 95, SEQ ID NO. 96, SEQ ID NO. 79, SEQ ID NO. 98 or a combination thereof.


[0006] In another embodiment of this aspect of the invention there is provided a process for stimulating the immune system of a subject to produce antibodies that bind specifically to Small Pox Virus polypeptides containing a replikin sequence, said process comprising administering to the subject an effective amount of a dosage of a composition comprising at least one Small Pox Virus replikin peptide. In a preferred embodiment the composition comprises a peptide selected from SEQ ID NO. 99, SEQ ID NO. 100, SEQ ID NO. 101, SEQ ID NO. 102, SEQ ID NO. 103, or a combination thereof.


[0007] In another aspect of the invention there are provided antisense nucleic acid molecules complementary to the coding strand of the gene or to the mRNA encoding the Bacillus anthracis Anthrax Lethal Factor Protein pX01-107 peptide, wherein said antisense nucleic acid molecule is complementary to a nucleotide sequence encoding the peptide of SEQ ID NO. 91, SEQ ID NO. 92, SEQ ID NO. 93, SEQ ID NO. 94, SEQ ID NO. 95, SEQ ID NO. 96, SEQ ID NO. 97, SEQ ID NO. 98.


[0008] There are also provided antisense nucleic acid molecule complementary to the coding strand of the gene or to the mRNA encoding the Small Pox Virus Surface Antigen S Precursor Protein, wherein said antisense nucleic acid molecule is complementary to a nucleotide sequence encoding the peptide of SEQ ID NO. 99, SEQ ID NO. 100, SEQ ID NO. 101, SEQ ID NO. 102, or SEQ ID NO. 103.


[0009] As used herein, the term “peptide” refers to a compound of two or more amino acids in which the carboxyl group of one is united with an amino group of another, forming a peptide bond. The term peptide is also used to denote the amino acid sequence encoding such a compound. Thus, a peptide sequence may be a subsequence of a larger polypeptide sequence. As used herein, a Replikin peptide is peptide consisting essentially of 7 to about 50 amino acid including (1) at least one lysine residue located six to ten amino acid residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues. Similarly, a replikin sequence is the amino acid sequence encoding such a peptide.







BRIEF DESCRIPTION OF THE DRAWINGS

[0010]
FIG. 1 is a bar graph depicting the frequency of occurrence of replikins in various protein groups.


[0011]
FIG. 2 is a graph depicting the percentage of malignin per milligram total membrane protein during anaerobic replication of glioblastoma cells.


[0012]
FIG. 3 is a bar graph showing amount of antimalignin antibody produced in response to exposure to the recognin 16-mer.


[0013]
FIG. 4A is a photograph of a blood smear taken with ordinary and fluorescent light. FIG. 4B is a photograph of a blood smear taken with and fluorescent light illustrating the presence of two leukemic cells. FIG. 4C is a photograph of a dense layer of glioma cells in the presence of antimalignin antibody. FIG. 4D and FIG. 4E are photographs of the layer of cells in FIG. 4C taken at 30 and 45 minutes following addition of antimalignin antibody.


[0014]
FIG. 4F is a bar graph showing the inhibition of growth of small cell lung carcinoma cells in vitro by antimalignin antibody.


[0015]
FIG. 5 is a plot of the amount of antimalignin antibody present in the serum of patients with benign or malignant breast disease pre-and post surgery.


[0016]
FIG. 6 is a box diagram depicting an embodiment of the invention wherein a computer is used to carry out the 3-point-recognition method of identifying replikin and recognin sequences.







DETAILED DESCRIPTION OF THE INVENTION

[0017] In one aspect of the invention there is provided a method for identifying nucleotide or amino acid sequences that include a recognin or replikin sequence. The method is referred to herein as a 3-point-recognition method. By use of the “3-point recognition” method, described herein below, a new class of peptides was revealed in algae, yeast, fungi, amoebae, bacteria, plant and virus proteins having replication, transformation, or redox functions. This class of peptides is referred to herein as replikins.


[0018] One example of a replikin that was identified by the 3-point-recognition method, is the amino acid sequence, (SEQ ID NO.: 2) hsikrclgiifdk, which occurs in Saccharomyces cerevisiae “replication binding protein”. Five replikins were found in amino acids 1-163 of the “replicating protein” of tomato leaf curl Gemini vinis. Amino acids 1-160 of this tomato virus protein bind DNA. Another replikin, (SEQ ID NO.: 3) hkqkivapvk, is highly conserved in 236 isolates of foot and mouth disease virus.


[0019] Although replikins were found to be present in only 1.5% of published sequences identified by the PubMed data bank as “virus peptides” as a whole, and in only 8.5% of sequences identified as “brain peptides” plus “neuropeptides”, surprisingly, replikins were found in 100% of “tumor viruses”, in 85% of “transforming proteins,” and 97% of “cancer proteins” (as categorized in the PubMed data bank). The recognin, (SEQ ID NO.: 4) ykagvaflhkkndide, was not found in published sequences of the human genome.


[0020] The 16-mer recognin peptide, (SEQ ID NO.: 4) ykagvaflhkkndide, when synthesized and injected as vaccine into a mammal, has been shown to produce antimalignin antibody, which is cytotoxic to malignant replicating cells of several types at picogram per cell amounts. Replikins identified in organisms such as diatom plankton, H. pylori, tomato leaf curl virus, foot and mouth disease virus, hepatitis B and C viruses, and HIV, also are thus targets for diagnosis and treatment or as vaccines for the control of replication of their respective virus source.


[0021] Table 1 illustrates the sequence of the malignin peptide, the 16-mer recognin sequence, (SEQ ID NO.: 4) ykagvaflhkkndide.
1TABLE 116-mer peptide sequence ykagvaflhkkndide obtained from malignin by hydrolysis and mass spectrometryMethod By Which Fragment ObtainedAuto-Auto-hydrolysis ofhydrolysismaligninSeqof maligninimmobilizedIDFragmentMH+free inon bromoace-MicrowavedMicrowavedNO.Identified(mass)Sequencesolutiontyl cellulose5 seconds30 seconds191-3381.21( )yka(g)+201-5537.30( )ykagv(a)+212-6445.28(y)kagva(f)+222-7592.35(Y)kagvaf(l)+23 4-11899.55(a)gvaflhkk(n)+245-7336.19(g)vaf(l)+256-7237.12(v)af(l)+26 6-10615.36(v)aflhk(k)+27 6-10615.36(v)aflhk(k)+28 6-12857.50(v)aflhkkn(d)+29 6-12857.50(v)afhkkn(d)+307-8279.17(a)fl(h)+3110-16861.43(h)kkndide( )+3211-14489.27(k)kndi(d)+3312-15476.2-(k)ndid(e)+


[0022] The malignin peptide was isolated from membranes of glioblastoma multiforme (glioma) cells grown in tissue culture (U.S. Pat. No. 6,242,578 B1). The sequence of a 16-mer peptide of malignin was determined by hydrolysis and mass spectrometry: (SEQ ID NO.: 4) ykagvaflhkkndide (Table 1). A search of published human genome sequences for sequence encoding the 16-mer amino acid sequence was negative. Since this 16-mer peptide was absent from normal human genome data a search was made of sequences of other organisms for possible origins and homologues. No identical sequences were found. But, using the sequence of the 16-mer peptide as a template, and constructing a “3-point-recognition” method to visually scan protein sequences of several different organisms, a new class of peptides, the replikins, was revealed in organisms as diverse as algae, yeast and viruses. Surprisingly, these peptides were found to be concentrated in larger ‘replicating ’ and ‘transforming’ proteins (so designated by their investigators, based on activities, see Table 2).


[0023] Table 2 illustates several replikin sequences that were identified by the 3-point-recognition method of the invention.
2TABLE 2Examples of replikins in various organisms - prototype: Glioma replikin* kagvaflhkk(SEQ ID No.: 1)Algae:SEQ ID 34Caldophera proliferakaskftkhNO. 35IsolepisproliferakaqaetgeikghYeast:36Schizoscceharomyces pombeksfkypkkhk37Oryza sativakkaygnelhk2Sacch. cerevisiae replication binding proteinhsikrelgiifdkFungi:38Isocitrate lyase ICI 1, Penicillium marneffeikvdivthqk39DNA-dependent RNA polymerase 11, Diseula dcstructivakleedaayhrkk40Ophiostoma novo-u1m 1, RNA in Dutch elm disease funguskvilplrgnikgiffkhAmoeba:41Entamoeba invadens, histone H2BklilkgdlnkhBacteria:42Pribosomal protein replication factor, Helicobacter pyloriksvhaflkReplication-associated protein Staph aureus10Mycoplasma pulmonic, chromosome replicationkkektthnk43Macrophage infectivity potentiator, L. legionellakvhffqlkk90Bacillus anthraciskihlisvkk91Bacillus anthracishvkkekeknk92Bacillus anthraciskhivkievk93Bacillus anthraciskkkkikdiygkdallh94Bacillus anthraciskwekikqh95Bacillus anthraciskldqipppiepkkddiih96Bacillus anthracishnryasnivesayllilnewkn-niqsdlikk97Bacillus anthracishavddyagylldknqsdlvt-nskk98Bacillus anthracishaerlkvqknapkPlants:44Arabidopsis thaliana, proliferakdhdfdgdk45Arabidopsis thaliana, cytoplasinic ribosomalkmkglkqkkah46Arabidopsis thaliana, DNA binding proteinkelssttqekshViruses:9Replication associated protein A [Maize streak virus]kekkpskdeimrdiish11Bovine herpes virus 4, DNA replication proteinhkinitngqk12Meleagrid herpesvirus 1, replication binding proteinhkdlyrllmk47Feline immunodeficiencyhlkdyklvk3Foot and Mouth Disease (O)hkqkivapvk5HIV Type 1kcfncgkegh7HIV Type 2kcwncgkegh99Small Pox Virus (Variola)khynnitwyk100Small Pox Virus (Variola)kysqtgkeliih101Small Pox Virus (Variola)hyddvrikndivvsrck102Small Pox Virus (Variola)hrfklildski103Small Pox Virus (Variola)kerghnyyfekTumor48Rous sarcoma virus tryrosine-protein kinasekklrhekViruses:49v-yes, avian sarcomakklrhdk50c-yes, colon cancer, malignant melanomakklrhdk51v-srcC., avian sarcomakklrhek52c-src, colon, mammary, panrcreatic cancerkklrhek53Neuroblastoma RAS viral (v-ras) oncogenekqahelak54VPl (major capsid protein) [Polyamavirus sp.]kthrfskh55Sindbisknlhekik56El [Human papilloamavirus type 71]khrpllqlk57v-erbB from AEV and c-erbkspnhvk58v-fms (feline sarcoma)knihlekk59c-fms (acute and chronic myelomonocytic tumors)knihlekk60large t-antigen I [Polyomavinis sp.1kphlaqslek61middle t-antigen [Polyomavirus sp,1-kqhrelkdk62small t-antigen [Polyomavirus spJ,kqhrelkdk63v-abl, murine acute leukemiakvpvlisptlkh64Human T-cell lymphotropic virus typo 2kslllevdkdish65c-kit, GI tumors, small cell lung carcinomakagitimvkreyh18Hepatitis ChyppkpgcivpakTrans-66Transforming protein mybksgkhlgkforming67Transforming protein myc, Burkitt lymphomakrreqlkhkProteins:68Ras-related GTP-binding proteinksfevikvih69Transforming protein ras (teratocarcinoma)kkkhtvkk70TRAF-associated NF•kB activator TANKkaqkdhlsk71RFP transforming proteinhlkrvkdlkk72Transforming protein D (S.C.)kygspkhrlik73Papilloma virus type 11, transforming proteinklkhilgkarfik74Protein tryosine kinase (EC 2.7.1.112slkkgdhvkhykirk75Transforming protein (axl(−))keklrdvmvdrhk76Transforming protein (N-myc)klqarqqqllkkieh77Fibroblast growth factor 4 (Kaposi sarcoma)kkgnrvsptmkvthCancer78Matrix metaloproteinase 7 (uterine)keiplhfrkCell79Transcription factor 7-likekkkphikkProteins:80Breast cancer antigen NY-BR-87ktrhdplak81BRCA-1-Associated Ring Domain Protein (breast)khhpkdnlik82‘Autoantigen from a breast tumor’khkrkkfrqk83Glioma replikin (this study)kagvaflhkk84Ovarian cancer antigenkhkrkkfrqk85EE L leukemiakkkskkhkdk86Proto-oncogene tyrosine-protein kinase C-ABLEhksekpalprk87Adenomatosis polyposis colikkkkpsrlkgdnek88Gastric cancer transforming proteinktkkgnrvsptmkvth89Transforming protein (K-RAS 2B), lungkhkekmskdgkkkkkksk


[0024] Identifacation of an amino acid sequence as a replikin or as containing a replikin, i.e., a homologue of the malignin 16-mer peptide, requires that the three following “3-point recognition” requirements be met. The peptide sequence must have (1) at least one lysine residue located six to ten residues from another lysine residue; (2) at least one histidine residue; and (3) a composition of at least 6% lysine within an amino acid sequence of 7 to about 50 residues.


[0025] Databases were searched using the National Library of Medicine keyword “Pub Med” descriptor for protein sequences containing replikin sequences. Sequences of all individual proteins within each group of PubMed-classified proteins were visually scanned for peptides meeting the three above-listed requirements. An infrequent occurrence of homologues was observed in “virus peptides” as a whole (1.5%), and in other peptides not designated as associated with malignant transformation or replication such as “brain peptides” and “neuropeptides” (together 8.5%). Surprisingly, homologues were identified in 100% of “tumor viruses”, in 85% of “transforming proteins”, and in 97% of “cancer cell proteins” (FIG. 1). The peptides identified by this search were named replikins, and a ten amino acid portion of the 16-mer peptide, (SEQ ID NO.: 1) “kagvaflhkk”, was named the glioma replikin.


[0026] To permit classification of subtypes of replikins, additional or “auxiliary specifications” to the basic “3-point-recognition” requirements may be added: (a) on a structural basis, such as the common occurrence of adjacent di- and polylysines in cancer cell proteins (e.g., Transforming protein P2B(K-RAS 2B), lung, Table 2, SEQ ID NO.: 89), and other adjacent di-amino acids in TOLL-like receptors, or b) on a functional basis, such as exhibiting ATPase, tyrosine kinase or redox activity as seen in Table 2.


[0027] Whether replikin structures are conserved or are subject to extensive natural mutation was examined by scanning the protein sequences of various isolates of foot and mouth disease virus (FMDV), where mutations in proteins of these viruses have been well documented worldwide for decades. Protein sequences of FMDV isolates were visually examined for the presence of both the entire replikin and each of the component replikin amino acid residues observed in a particular replikin. For example, in the protein VP1 of FMDV type O, the replikin (SEQ ID NO.: 3) “hkqkivapvk” was found to be conserved in 78% of the 236 isolates reported in PubMed, and each amino acid was found to be conserved in individual isolates as follows: his, 95.6% ; lys, 91.8%; gln 92.3%; lys, 84.1%; ile, 90.7%; val, 91.8%; ala, 97.3%; pro, 96.2%; ala, 75.4%; and lys, 88.4%. The high rate of conservation suggests structural and functional stability of the replikin structure. Similarly, sequence conservation was observed in different isolates of HIV for its replikins, such as (SEQ ID NO.: 5) “kcfncgkegh” or (SEQ ID NO.: 6) “kvylawvpahk” in HIV Type 1 and (SEQ ID NO.: 7) “kcwncgkegh” in HIV Type 2 (Table 2). Other examples of conservation are seen in the constant presence of malignin in successive generations, over 10 years of tissue culture of glioma cells, and by the constancy of affinity of the glioma replikin for antimalignin antibody isolated by immunoadsorption from 8,090 human sera from the U.S., U.K., Europe and Asia (e.g., FIG. 5 and U.S. Pat. No. 6,242,578 B 1).


[0028] As seen in FIG. 2, during anaerobic respiration when the rate of cell replication is increased, malignin is enriched. That is, malignin is found to increase not simply in proportion to the increase in cell number and total membrane proteins, but is enriched as much as tenfold in concentration, starting with 3% at rest and reaching 30% of total membrane protein. This clear demonstration of a marked increase in replikin concentration with glioma cell replication points to and is consistent with the presence of replikins here sought by the 3-point recognition method and found in the proteins of various organisms which were found by mutation studies and other previous studies to be critical to replication. For example, replikins were identified in such proteins as “Saccharomyces cerevisiae replication binding protein” (SEQ ID NO.: 2) (hsikrelgiifdk); the “replication associated protein A of maize streak virus” (SEQ ID NO.: 8) (kyivcareahk and (SEQ ID NO.: 9) kekkpskdeimrdiish); the “replication-associated protein of Staphylococcus aureus” (SEQ ID NO.: 10) (kkektthnk); the “DNA replication protein of bovine herpes virus 4” (SEQ ID NO.: 11) (hkinitngqk); and the “Mealigrid herpes virus 1 replication binding protein” (SEQ ID NO.: 12) (hkdlyrllmk). Previous studies of tomato leaf curl gemini virus show that the regulation of virus accumulation appears to involve binding of amino acids 1-160 of the “replicating protein” of that virus to leaf DNA and to other replication protein molecules during virus replication. Analysis of this sequence showed that amino acids 1-163 of this “replicating protein” contain five replikins, namely: (SEQ ID NO.: 13) kfrinaknyfltyph, (SEQ ID NO.: 14) knletpvnklfiricrefh, (SEQ ID NO.: 15) hpniqaaksstdvk, (SEQ ID NO.: 16) ksstdvkaymdkdgdvldh, and (SEQ ID NO.: 17) kasalnilrekapkdfvlqfh.


[0029] Table 2 shows that replikin-containing proteins also are associated frequently with redox functions, and protein synthesis or elongation, as well as with cell replication. The association with metal-based redox functions, the enrichment of the replikin-containing glioma malignin concentration during anaerobic replication, and the cytotoxicity of antimalignin at low concentrations (picograms/cell) (FIG. 4c-f), all suggest that the replikins are related to central respiratory functions, which are perhaps less often subjected to the mutations characteristic of proteins of more superficial location or less central survival function.


[0030] Of particular interest were eight different replikins identified in Bacillus anthracis, the organism responsible for anthrax infections; and five different replikins identified in small pox virus. The eight Bacillus anthracis peptides are present in the Anthrax Toxin Lethal Factor Protein pX01-107 and have the amino acid sequence of SEQ ID NO. 91, SEQ ID NO. 92, SEQ ID NO. 93, SEQ ID NO. 94, SEQ ID NO. 95, SEQ ID NO. 96, SEQ ID NO. 97 and SEQ ID NO. 98, respectively. The five small pox virus peptides are present in the Small Pox Virus Surface Antigen S Precursor Protein, which purportedly enhances Small Pox Virus replication. The five peptides have the amino acid sequence of SEQ ID NO. 99, SEQ ID NO. 100, SEQ ID NO. 101, SEQ ID NO. 102 and SEQ ID NO. 103, respectively.


[0031] Data on anti-replikin antibodies support replikin class unity. An anti-replikin antibody response has been quantified by immunoadsorption of serum antimalignin antibody to immobilized malignin (see Methods in U.S. Pat. No. 5,866,690). The abundant production of antimalignin antibody by administration to rabbits of the synthetic version of the 16-mer peptide whose sequence was derived from malignin, absent carbohydrate or other groups, has established rigorously that this peptide alone is an epitope, that is, it is a sufficient basis for this immune response (FIG. 3). The 16-mer peptide produced both IgM and IgG forms of the antibody. Antimalignin antibody was found to be increased in concentration in serum in 37% of 79 cases in the U.S. and Asia of hepatitis B and C, early, in the first five years of infection, long before the usual observance of liver cancer, which develops about fifteen to twenty-five years after infection. Relevant to both infectious hepatitis and HIV infections, transformed cells may be one form of safe haven for the virus: prolonging cell life and avoiding virus eviction, so that the virus remains inaccessible to anti-viral treatment.


[0032] A synthetic replikin vaccine such as the glioma replikin (SEQ ID NO.: 1) “kagvaflhkk” or the hepatitis C replikin (SEQ ID NO.: 18) “hyppkpgcivpak”, or HIV replikins such as (SEQ ID NO.: 5) “kcfncgkegh” or (SEQ ID NO.: 6) “kvylawvpahk” may be used to augment antibody concentration in order to lyse the respective virus infected cells and release virus extracellularly where chemical treatment can then be effective. Recognin and/or replikin peptides may be administered to a subject to induce the immune system of the subject to produce anti-replikin and/or anti-recognin antibodies. Generally, a 0.5 to about 2 mg dosage, preferably a 1 mg dosage of each peptide is administered to the subject to induce an immune response. Subsequent dosages may be administered if desired.


[0033] In another embodiment of the invention, isolated recognin or replikin peptides may be used to generate antibodies. Various procedures known in the art may be used for the production of antibodies to replikin sequences or recognin sequences. Such antibodies include but are not limited polyclonal, monoclonal, chimeric, humanized, single chain, Fab fragments and fragments produced by an Fab expression library. Antibodies that are linked to a cytotoxic agent may also be generated.


[0034] For the production of antibodies various host animals may be immunized by injection with a replikin or recognin peptide, including but not limited to rabbits, mice, rats, and larger mammals. Various adjuvants may be used to enhance the immunological response, depending on the host species, including but not limited to Freund's (complete and incomplete), mineral gels, such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, key limpet hemocyanin, dintrophenol, and potentially useful human adjuvants such as BCG and Corynebacterium parvum.


[0035] Monoclonal antibodies to replikins or recognins may be prepared by using any technique that provides for the production of antibody molecules by continuous cell lines in culture. These include but are not limited to the hybridoma technique originally described by Kohler and Milstein, (Nature, 1975, 256:495-497), the human B-cell hybridoma technique (Kosbor et al., 1983, Immunology Today, 4:72), and the EBV hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, Inc., pp. 77-96). In addition, techniques developed for the production of chimeric antibodies (Morrison et al., 1984, Proc. Nat. Acad. Sci USA, 81:6851-6855) may be used. Alternatively, techniques described for the production of single chain antibodies (U.S. Pat. No. 4,946,778) can be adapted to produce replikin- or recognin-specific single chain antibodies.


[0036] Particularly useful antibodies of the invention are those that specifically bind to replikin sequences contained in peptides and/or polypeptides of Bacillus anthracis. For example, antibodies to any of peptides SEQ ID NO. 91, SEQ ID NO. 92, SEQ ID NO. 93, SEQ ID NO. 94, SEQ ID NO. 95, SEQ ID NO. 96, SEQ ID NO. 97, SEQ ID NO. 98 and combinations of such antibodies are useful in the treatment and/or prevention of anthrax.


[0037] Similarly, antibodies to peptides SEQ ID NO. 99, SEQ ID NO. 100, SEQ ID NO. 101, SEQ ID NO. 102, SEQ ID NO. 103 and combinations of such antibodies are useful in the treatment and/or prevention of small pox.


[0038] Antibody fragments which contain binding sites for a replikin or recognin may be generated by known techniques. For example, such fragments include but are not limited to F(ab′)2 fragments which can be produced by pepsin digestion of the antibody molecules and the Fab fragments that can be generated by reducing the disulfide bridges of the F(ab′)2 fragments. Alternatively, Fab expression libraries can be generated (Huse et al., 1989, Science, 246:1275-1281) to allow rapid and easy identification of monoclonal Fab fragments with the desired specificity.


[0039] The fact that antimalignin antibody is increased in concentration in human malignancy regardless of cancer cell type (FIG. 5), and that this antibody binds to malignant cells regardless of cell type now may be explained by the presence of the replikin structures present in most malignancies (FIG. 1 and Table 2). Population studies have shown that antimalignin antibody increases in concentration in healthy adults with age, and more so in high-risk families, as the frequency of cancer increases. An additional two-fold or greater antibody increase which occurs in early malignancy has been independently confirmed with a sensitivity of 97% in breast cancers 1-10 mm in size. Shown to localize preferentially in malignant cells in vivo, histochemically the antibody does not bind to normal cells but selectively binds to (FIG. 4a,b) and is highly cytotoxic to transformed cells in vitro (FIG. 4c-f). Since in these examples the same antibody is bound by several cell types, that is, brain glioma, hematopoietic cells (leukemia), and small cell carcinoma of lung, malignant replikin class unity is again supported.


[0040] Antimalignin does not increase with benign proliferation, but specifically increases only with malignant transformation and replication in breast in vivo and returns from elevated to normal values upon elimination of malignant cells (FIG. 5). Antimalignin antibody concentration has been shown to relate quantitatively to the survival of cancer patients, that is, the more antibody, the longer the survival. Taken together, these results suggest that antireplikin antibodies may be a part of a mechanism of control of cell transformation and replication. Augmentation of this immune response may be useful in the control of replication, either actively with synthetic replikins as vaccines, or passively by the administration of anti-replikin antibodies, or by the introduction of non-immune based organic agents, such as for example, carbohydrates, lipids and the like, which are similarly designed to target the replikin specifically. For organisms such as diatom plankton, foot and mouth disease virus, tomato leaf curl gemini virus, hepatitis B and C, and HIV, and malignant cells, identified constituent replikins are useful as vaccines, and also may be usefully targeted for diagnostic purposes.


[0041] The replikin sequence structure is associated with the function of replication. Thus, whether the replikins of this invention are used for targeting sequences that contain replikins for the purpose of diagnostic identification, promoting replication, or inhibiting or attacking replication, for example, the structure-function relationship of the replikin is fundamental. Thus, while the structure of the replikin may be a part of a larger protein sequence, which may have been previously identified, it is necessary to utilize only the specific replikin structure when seeking to induce antibodies that will recognize and attach to the replikin fragment and thereby cause destruction of the cell. Even though the larger protein sequence may be known in the art as having a “replication associated function,” vaccines using the larger protein often have failed or proven ineffective, even though they contain one or more replikin sequences.


[0042] Although the present inventors do not wish to be held to a single theory, the studies herein suggest that the prior art vaccines are ineffective because they are based on the use of the larger protein sequence. The larger protein sequence invariably has one or more epitopes (independent antigenic sequences that can induce specific antibody formation); replikin structures usually comprise one of these potential epitopes. The presence of other epitopes within the larger protein may interfere with adequate formation of antibodies to the replikin, See, e.g., Webster, R. G., J. Immunol., 97(2):177-183 (


[0043] and Webster et al., J. Infect. Dis., 134:48-58, 1976; Klenerman et al, Nature 394:421-422 (1998) for a discussion of the well-known phenomenon “original antigenic sin”). The formation of an antibody to a non-replikin epitope may allow binding to the cell, but not necessarily lead to cell destruction.


[0044] It is well known in the art that in the course of antibody production against a “foreign” protein, the protein is first hydrolyzed into smaller fragments. Usually fragments containing from about six to ten amino acids are selected for antibody formation. Thus, if hydrolysis of a protein does not result in replikin-containing fragments, anti-replikin antibodies will not be produced. In this regard, it is interesting that replikins contain lysine residues located six to ten amino acids apart, since lysine residues are known to bind to membranes.


[0045] Furthermore, replikin sequences contain at least one histidine residue. Histidine is frequently involved in binding to redox centers. Thus, an antibody that specifically recognizes a replikin sequence has a better chance of inactivating or destroying the cell in which the replikin is located, as seen with anti-malignin antibody, which is perhaps the most cytotoxic antibody yet described, being active at picograms per cell.


[0046] One of the reasons that vaccines directed towards a particular protein antigen of a disease causing agent have not been fully effective in providing protection against the disease (such as foot and mouth vaccine which has been developed against the VP1 protein or large segments of the VP1 protein) is that antibody to the replikins have not been produced. That is, either epitopes other than replikins present in the larger protein fragments may interfere according to the phenomenon of “original antigenic sin”, and/or because the hydrolysis of larger protein sequences into smaller sequences for processing to produce antibodies results in loss of integrity of any replikin structure that is present, e.g., the replikin is cut in two and/or the histidine residue is lost in the hydrolytic processing. The present studies suggest that for an effective vaccine to be produced, the replikin sequences, and no other epitope, should be used as the vaccine. For example, a vaccine of the invention can be generated using any one of the replikin peptides identified by the three point recognition system. Particularly preferred peptides for an anthrax vaccine include peptides SEQ ID NO. 91, SEQ ID NO. 92, SEQ ID NO. 93, SEQ ID NO. 94, SEQ ID NO. 95, SEQ ID NO. 96, SEQ ID NO. 97, SEQ ID NO. 98, and combinations thereof . Preferred peptides for use as a small pox vaccine are peptides SEQ ID NO. 99, SEQ ID NO. 100, SEQ ID NO. 101, SEQ ID NO. 102, SEQ ID NO. 103 and combinations thereof. These peptides, alone or in various combinations are administered to a subject, preferably by i.v. or intramuscular injection, in order to stimulate the immune system of the subject to produce antibodies to the peptide. Generally the dosage of peptides is in the range of from about 0.1 μg to about 10 mg, preferably about 10 μg to about 1 mg, and most preferably about 50 μg to about 500 μg. The skilled practitioner can readily determine the dosage and number of dosages needed to produce an effective immune response.


[0047] Replikin or recognin DNA or RNA may have a number of uses for the diagnosis of diseases resulting from infection with a virus, bacterium or other replikin or recognin encoding agent. For example, replikin or recognin nucleotide sequences may be used in hybridization assays of biopsied tissue to diagnose the presence of a particular organism, e.g., Southern or Northern analysis, including in situ hybridization assays.


[0048] Also within the scope of the invention are oligoribonucleotide sequences, that include antisense RNA and DNA molecules and ribozymes that function to inhibit the translation of replikin- or recognin-containing mRNA. Both antisense RNA and DNA molecules and ribozymes may be prepared by any method known in the art. The antisense molecules can be incorporated into a wide variety of vectors for delivery to a subject. The skilled practitioner can readily determine the best route of delivery, although generally i.v. or i.m. delivery is routine. The dosage amount is also readily ascertainable.


[0049] Particularly preferred antisense nucleic acid molecules are those that are complementary to a mRNA encoding a Bacillus anthracis polypeptide comprising a replikin sequence comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues. More preferred are antisense nucleic acid molecules that are complementary to the coding strand of the gene or to the mRNA encoding the Bacillus anthracis Anthrax Lethal Factor Protein pX01-107 peptide, wherein the antisense nucleic acid molecule is complementary to a nucleotide sequence encoding the peptide of SEQ ID NO. 91, SEQ ID NO. 92, SEQ ID NO. 93, SEQ I) NO. 94, SEQ ID NO. 95, SEQ ID NO. 96, SEQ ID NO. SEQ ID NO. 97, or SEQ ID NO. 98.


[0050] Another preferred set of antisense nucleic acid molecules includes those that are complementary to a mRNA encoding a Small Pox Virus polypeptide comprising a replikin sequence comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues. More preferred are antisense nucleic acid molecules that are complementary to the coding strand of the gene or to the mRNA encoding the Small Pox Virus Surface Antigen S Precursor Protein, wherein the antisense nucleic acid molecule is complementary to a nucleotide sequence encoding the peptide of SEQ ID NO. 99, SEQ ID NO. 100, SEQ ID NO. 101, SEQ ID NO. 102, or SEQ ID NO. 103.


[0051] In another embodiment of the invention, immune serum containing antibodies to one or more replikin obtained from an individual exposed to one or more replikins may be used to induce passive immunity in another individual or animal. Immune serum may be administered via i.v. to a subject in need of treatment. Passive immunity also can be achieved by injecting a recipient with preformed antibodies to one or more replikins. Passive immunization may be used to provide immediate protection to individuals who have been exposed to an infectious organism. Administration of immune serum or preformed antibodies is routine and the skilled practitioner can readily ascertain the amount of serum or antibodies needed to achieve the desired effect.


[0052] Visual scanning of over three thousand sequences was performed in developing the present 3-point-recognition methods. However, data banks comprising nucleotide and/or amino acid sequences can also be scanned by computer for the presence of sequences meeting the 3 point recognition requirements.


[0053] The three point recognition method may also be modified to identify other useful compounds of covalently linked organic molecules, including other covalently linked amino acids, nucleotides, carbohydrates, lipids or combinations thereof. In this embodiment of the invention a sequence is screened for subsequences containing three or more desired structural characteristics. In the case of screening compounds composed of covalently linked amino acids, lipids or carbohydrates the subsequence of 7 to about 50 covalently linked units should contain (1) at least one first amino acid, carbohydrate or lipid residue located six to ten residues from a second of the first amino acid, carbohydrate or lipid residue; (2) at least one second amino acid, lipid or carbohydrate residue; and (3) at least 6% of the first amino acid, carbohydrate or lipid residue. In the case of screening nucleotide sequences, the subsequence of about 21 to about 150 nucleotides should contain (1) at least one first amino acid residue located within eighteen to thirty nucleotides from a second codon encoding the first amino acid residue; (2) at least one second amino acid residue; and (3) encodes at least 6% of said first amino acid residue.


[0054] According to another embodiment of the invention, the methods described herein may be performed by a computer. FIG. 6 is a block diagram of a computer available for use with the foregoing embodiments of the present invention. The computer may include a processor, an input/output device and a memory storing executable program instructions representing the 3-point-recognition methods of the foregoing embodiments. The memory may include a static memory, volatile memory and/or a nonvolatile memory. The static memory conventionally may be a read only memory (“ROM”) provided on a magnetic, or an electrical or optical storage medium. The volatile memory conventionally may be a random access memory (“RAM”) and may be integrated as a cache within the processor or provided externally from the processor as a separate integrated circuit. The non-volatile memory may be an electrical, magnetic or optical storage medium.



EXAMPLE 1

[0055] Process For Extraction, Isolation and Identifacation of Replikins and the use of Replikins to Targets Label or Destroy Replikin-containing Organisms


[0056] a) Algae


[0057] The following algae were collected from Bermuda water sites and either extracted on the same day or frozen at −20 degrees C and extracted the next day. The algae were homogenized in a cold room (at 0 to 5 degrees C) in 1 gram aliquots in neutral buffer, for example 100 cc. of 0.005M phosphate buffer solution, pH7 (“phosphate buffer”) for 15 minutes in a Waring blender, centrifuged at 3000 rpm, and the supernatant concentrated by perevaporation and dialyzed against phosphate buffer in the cold to produce a volume of approximately 15 ml. The volume of this extract solution was noted and an aliquot taken for protein analysis, and the remainder was fractionated to obtain the protein fraction having a pK range between 1 and 4. The preferred method of fractionation is chromatography as follows:


[0058] The extract solution is fractionated in the cold room (4 degrees C) on a DEAE cellulose (Cellex-D) column 2.5×1.0 cm, which has been equilibrated with 0.005M phosphate buffer. Stepwise eluting solvent changes are made with the following solutions:


[0059] Solution 1—4.04 g. NaH2PO4 and 0.5 g NaH2PO4 are dissolved in 15 liters of distilled water (0.005 molar, pH7);


[0060] Solution 2—8.57 g. NaH2PO4 is dissolved in 2,480 ml. of distilled water;


[0061] Solution 3—17.1 g. of NaH2PO4 is dissolved in 2480 ml of distilled water (0.05 molar, pH 4.7);


[0062] Solution 4—59.65 g. of NaH2PO4 is dissolved in 2470 ml distilled water (0.175 molar);


[0063] Solution 5—101.6 g. of NaH2PO4 is dissolved in 2455 ml distilled water (pH 4.3);


[0064] Solution 6—340.2 g. of NaH2PO4 is dissolved in 2465 of distilled water (1.0 molar, pX-i 4.1);


[0065] Solution 7—283.63 g. of 80% phosphoric acid (H3P04) is made up in 2460 ml of distilled water (1.0 molar, pH 1.0).


[0066] The extract solution, in 6 to 10 ml volume, is passed onto the column and overlayed with Solution 1, and a reservoir of 300 ml of Solution 1 is attached and allowed to drip by gravity onto the column. Three ml aliquots of eluant are collected and analyzed for protein content at OD 280 until all of the protein to be removed with Solution 1 has been removed from the column. Solution 2 is then applied to the column, followed in succession by Solutions 3, 4, 5, 6 aid 7 until all of the protein which can, be removed with each Solution is removed from the column. The eluates from Solution 7 are combined, dialyzed against phosphate buffer, the protein content determined of both dialysand and dialyzate, and both analyzed by gel electrophoresis. One or two bands of peptide or protein of molecular weight between 3,000 and 25,000 Daltons are obtained in Solution 7. For example the algae Caulerpa mexicana, Laurencia obtura, Cladophexa prolifera, Sargassum natans, Caulerpa verticillata, Halimeda tuna, and Penicillos capitatus, after extraction and treatment as above, all demonstrated in Solution 7 eluates sharp peptide bands in this molecular weight region with no contaminants. These Solution 7 proteins or their eluted bands are hydrolyzed, and the amino acid composition determined. The peptides so obtained, which have a lysine composition of 6% or greater are Replikin precursors. These Replikin peptide precursors are then determined for amino acid sequence by hydrolysis and mass spectrometry as detailed in U.S. Pat. No. 6,242,578 B1. Those which fulfill the criteria defined by the “3-point-recognition” method are identified as Replikins. This procedure can also be applied to obtain yeast, bacterial and any plant Replikins.


[0067] b) Virus


[0068] Using the same extraction and column chromatography separation methods as above in a) for algae, Replikens in virus-infected cells are isolated and identified.


[0069] c) Tumor cells in vivo and in vitro Tissue Culture


[0070] Using the same extraction and column chromatography separation methods as above in a) for algae, Replikins in tumor cells are isolated and identified. For example, Replikin precursors of Astrocytin isolated from malignant brain tumors, Malignin (Aglyco 10B) isolated from glioblastoma tumor cells in tissue culture, MCF7 mammary carcinoma cells in tissue culture, and P3J Lymphoma cells in tissue culture each treated as above in a) yielded Replikin precursors with lysine content of 9.1%, 6.7%, 6.7%, and 6.5% respectively. Hydrolysis and mass spectrometry of Aglyco 10B as described in Example 10 U.S. Pat. No. 6,242,578 B1 produced the amino acid sequence, ykagvaflhkkndiide the 16-mer Replikin.



EXAMPLE 2

[0071] As an example of diagnostic use of Replikins: Aglyco 10B or the 16-mer Repliken may be used as antigen to capture and quantify the amount of its corresponding antibody present in serum for diagnostic purposes are as shown in FIGS. 2,3,4 and 7 of U.S. Pat. No. 6,242,578 B1,


[0072] As an example of the production of agents to attach to Replikins for labeling, nutritional or destructive purposes: Injection of the 16-mer Replikin into rabbits to produce the specific antibody to the 16-mer Replikin is shown in Example 6 and FIGS. 9A and 9B of U.S. Pat. No. 6,242,578 B1.


[0073] As an example of the use of agents to label Replikins: The use of antibodies to the 16-mer Replikin to label specific cells which contain this Replikin is shown in FIG. 5 and Example 6 of U.S. pat. No. 6,242,578 B1.


[0074] As an example of the use of agents to destroy Replikins: The use of antibodies to the 16-mer Replikin to inhibit or destroy specific cells which contain this Replikin is shown in FIG. 6 of U.S. Pat. No. 6,242,578 B1.


[0075] From a proteomic point of view the construction of a “3-point recognition” template based on the new glioma peptide sequence led directly to identification of a biology-wide class of proteins having related structures and functions. The operation of the 3-point-recognition method resembles identification by the use of a “keyword”search; but instead of using the exact spelling of the keyword “kagvafihkk” as in a typical sequence homology search, or in the nucleotide specification of an amino acid, an abstraction of the keyword delimited by the “3-point-recognition” parameters is used. This delimited abstraction, although derived from a single relatively short amino acid sequence leads to identification of a class of proteins with structures that are defined by the same specifications. That particular functions, in this case transformation and replication, in addition to structures, turn out also to be shared by members of the exposed class suggests that these structures and functions are related. Thus, from this newly identified short peptide sequence, a molecular recognition ‘language’ has been formulated, which previously has not been described. Further, the sharing of immunological specificity by diverse members of the class, as here demonstrated for the cancer replikins, suggests that B cells and their product antibodies recognize replikins by means of a similar recognition language. Since “3-point-recognition” is a proteomic method that specifies a particular class of proteins, using three or more different recognition points for other peptides similarly should provide useful information concerning other proteins classes. Further, the “3-point-recognition” method is applicable to other recognins, for example to the TOLL ‘innate’ recognition of lipopolyssacharides of organisms.


[0076] Several embodiments of the present invention are specifically illustrated and described herein. However, it will be appreciated that modifications and variations of the present invention are encompassed by the above teachings and within the purview of the appended claims without departing from the spirit and intended scope of the invention.


Claims
  • 1. An isolated Bacillus anthracis peptide comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues.
  • 2. The peptide of claim 1 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 91.
  • 3. The peptide of claim 1 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 92.
  • 4. The peptide of claim 1 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 93.
  • 5. The peptide of claim 1 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 94.
  • 6. The peptide of claim 1 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 95.
  • 7. The peptide of claim 1 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 96.
  • 8. The peptide of claim 1 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 97.
  • 9. The peptide of claim 1 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 98.
  • 10. An isolated small pox virus peptide comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues.
  • 11. The peptide of claim 10 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 99.
  • 12. The peptide of claim 10 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 100.
  • 13. The peptide of claim 10 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 101.
  • 14. The peptide of claim 10 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 102.
  • 15. The peptide of claim 10 wherein the peptide has the amino acid sequence as set forth in SEQ ID NO. 103.
  • 16. An antibody that specifically binds to a Bacillus anthracis peptide or polypeptide sequence comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten amino acid residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues.
  • 17. An antibody cocktail comprising a plurality of antibodies, wherein each of said antibodies specifically binds to a Bacillus anthracis peptide or polypeptide sequence comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten amino acid residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues.
  • 18. An antibody that specifically binds to a small pox virus peptide or polypeptide sequence comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten amino acid residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues.
  • 19. An antibody cocktail comprising a plurality of antibodies, wherein each of said antibodies specifically binds to a small pox virus peptide or polypeptide sequence comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten amino acid residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues.
  • 20. A method of stimulating the immune system of a subject to produce antibodies to Bacillus anthracis comprising administering an effective amount of at least one Bacillus anthracis peptide comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten amino acid residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues.
  • 21. The method of claim 18 comprising administering at least one peptide selected from the group consisting of SEQ ID NO. 91, SEQ ID NO. 92, SEQ ID NO. 93, SEQ ID NO. 94, SEQ ID NO. 95, SEQ ID NO. 96, SEQ ID NO. 97, SEQ ID NO. 98. and combinations thereof.
  • 22. A method of stimulating the immune system of a subject to produce antibodies to small pox virus comprising administering an effective amount of at least one small pox virus peptide comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten amino acid residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues.
  • 23. The method of claim 20 wherein the at least one peptide is selected from the group consisting of SEQ ID NO. 99, SEQ ID NO. 100, SEQ ID NO. 101, SEQ ID NO. 102, SEQ ID NO. 103 and combinations thereof.
  • 24. An antisense nucleic acid molecule complementary to a mRNA encoding a Bacillus anthracis polypeptide comprising a replikin sequence comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues.
  • 25. An antisense nucleic acid molecule complementary to the coding strand of the gene or to the mRNA encoding the Bacillus anthracis Anthrax Lethal Factor Protein pX01-107 peptide, wherein said antisense nucleic acid molecule is complementary to a nucleotide sequence encoding the peptide of SEQ ID NO. 91, SEQ ID NO. 92, SEQ ID NO. 93, SEQ ID NO. 94, SEQ ID NO. 95, SEQ ID NO. 96, SEQ ID NO. 97, SEQ ID NO. 98.
  • 26. An antisense nucleic acid molecule complementary to a mRNA encoding a Small Pox Virus polypeptide comprising a replikin sequence comprising from 7 to about 50 amino acids including (1) at least one lysine residue located six to ten residues from a second lysine residue; (2) at least one histidine residue; and (3) at least 6% lysine residues.
  • 27. An antisense nucleic acid molecule complementary to the coding strand of the gene or to the mRNA encoding the Small Pox Virus Surface Antigen S Precursor Protein, wherein said antisense nucleic acid molecule is complementary to a nucleotide sequence encoding the peptide of SEQ ID NO. 99, SEQ ID NO. 100, SEQ ID NO. 101, SEQ ID NO. 102, or SEQ ID NO. 103.
CROSS REFERENCE TO OTHER APPLICATIONS

[0001] This application claims priority to Provisional Applications Serial Nos. 60/303,396 filed Jul. 09, 2001 and 60/278,761 filed Mar. 27, 2001, and Continuation-in-Part applications Ser. Nos. 09/146,755 filed Sep. 04, 1998 (issued as U.S. Pat. No. 6,242,578 B1) and 09/817,144 filed Mar. 27, 2001 (pending), the latter of which claim priority to application Ser. No. 08/198,139 filed Feb. 17, 1994 (abandoned), which are incorporated herein in their entirety by reference thereto.

Provisional Applications (2)
Number Date Country
60303396 Jul 2001 US
60278761 Mar 2001 US
Continuation in Parts (2)
Number Date Country
Parent 09146755 Sep 1998 US
Child 09984056 Oct 2001 US
Parent 09817144 Mar 2001 US
Child 09984056 Oct 2001 US