Patent Application
20200339681
The present disclosure relates to an antibody that binds, in the form of an intact immunoglobulin, to a membrane protein receptor on the surface of cells overexpressed in tumor tissues and thus undergoes endocytosis, is then located in the cytoplasm of the cells due to the endosomal escape capacity, and specifically binds to activated Ras(Ras⋅GTP) coupled to GTP in the cytoplasm to inhibit the activity of tumor mutant Ras, a method of preparing the same and the use thereof.
Specifically, the present disclosure relates to a heavy-chain variable region (VH) having high affinity for Ras⋅GTP that is produced by modifying a heavy-chain variable region (VH) of an antibody that penetrates, in an intact immunoglobulin form, into the cytoplasm of cells to directly inhibit intracellular Ras⋅GTP, an antibody including the same, a method of producing the same and the use thereof.
The antibody of the present disclosure includes an improved technology to impart tumor-tissue-specific cytoplasmic penetration ability for a light-chain variable region (VL).
The present disclosure relates to an intact immunoglobulin-type antibody that includes a combination of an improved light-chain variable region (VL), modified to impart tumor-tissue-specific cytoplasmic penetration ability thereto, with a heavy-chain variable region (VH) having improved affinity, and thus penetrates into the cytoplasm and directly inhibits intracellular Ras⋅GTP.
The present disclosure includes an improved technology for a heavy chain to advance the intracellular stability, in-vivo persistence and tumor-tissue specificity of the antibody.
In addition, the present disclosure relates to a method of inhibiting the growth of cancer or tumor cells using the antibody and a method of treating cancer or tumors using the antibody.
In addition, the present disclosure relates to a method of constructing a library for improving the affinity of a heavy-chain variable region specifically binding to Ras⋅GTP, and a library constructed by the method.
In addition, the present disclosure relates to a method for screening, using the library, a heavy-chain variable region that specifically binds to Ras⋅GTP and has improved affinity therefor.
Mutations and abnormal overexpression occur in enzymes or transcription- or signaling-associated proteins, which play an important role in intracellular protein-protein interactions (PPIs) in a variety of diseases including cancer. In order for small molecule drugs to specifically bind to these tumors and disease-related proteins, a hydrophobic pocket is required on the protein surface, but only about 10% of all intracellular-disease-related substances have such a hydrophobic pocket. For this reason, small molecule drugs cannot specifically target most intracellular tumor- and disease-related proteins. Ras, which is one of representative examples of tumor- and disease-related proteins having no hydrophobic pocket, acts as a molecular switch that delivers an extracellular signal to an intracellular signaling system through a cell membrane receptor on the cell surface. Cancer-related proteins in the Ras protein family are three isoform proteins, namely, KRas, NRas and HRas. KRas may be expressed as either of two splicing variants, namely KRas4A and KRas4B. After the Ras protein is expressed in the cytoplasm, it passes through the endoplasmic reticulum (ER) and the Golgi apparatus and then is located in the cell membrane due to the lipidation reaction of the C-terminal region, but the portion thereof having GTPase activity is exposed toward the cytoplasm. In the absence of external stimulation, the Ras protein exists as inactivated Ras(Ras⋅GDP) bound to GDP by GTPase-activating protein (GAP) in the cell. In the presence of external stimulation, the Ras protein exists as activated Ras(Ras⋅GTP) bound to GTP by guanine nucleotide exchange factor (GEF). Ras⋅GTP activates signals such as lower Raf-MEK-ERK and PI3K-Akt through protein-protein interactions with effector proteins such as Raf, PI3K and RalGDS in the cytoplasm to transfer a variety of signals pertaining to cell growth, apoptosis inhibition, migration, differentiation, etc. In normal cells, Ras⋅GTP is converted to Ras⋅GTP immediately after signaling due to the phosphate dissociation by GAP, so signaling is regulated in a way that only signals are temporarily transferred. However, the carcinogenic mutant Ras protein does not undergo a phosphate dissociation process by GAP but maintains the form of Ras⋅GTP and thus continuously interacts with the effector protein, thus continuously leading to downstream signaling and carcinogenesis of normal cells. The most frequently occurring Ras protein carcinogenic mutations include the 12th residue mutations (such as G12D, G12V, G13D and G12C), the 13th residue mutations (such as G13D) and the 61st residue mutations (such as Q61R and Q61H). It has been found that these cancer-related Ras mutations occur in about 30% of all tumors, with lung cancer (≈25%), colorectal cancer (≈30-40%) and pancreatic cancer (≈90%), depending on the carcinoma. These carcinogenic Ras mutations are known to cause strong resistance to conventional anti-cancer treatments.
The development of small molecule drugs has been mainly attempted to treat carcinogenic Ras mutant tumors, and the main strategies include inhibition of the activity of enzymes associated with C-terminal lipidation of Ras to thereby prevent the placement of Ras into the intracellular membrane, inhibition of protein-protein interaction between Ras and effect proteins to thereby directly target Ras, and the like. The C-terminal lipidation of Ras is a process for locating Ras expressed in the cytoplasm into the intracellular membrane for activation, and related enzymes thereof include farnesyltransferase (FTase), Ras-converting CAAX endopeptidase 1 (RCE1), isoprenylcysteine carboxylmethyltransferase (ICMT) and the like. Although small molecule drugs targeting the enzymes described above have been developed, they have side effects of cell growth inhibition and apoptosis in the normal Ras wild-type cell line and a limitation in which the drug is not effective due to the indirect (bypass) route by geranylgeranyltransferase 1 (GGTase1) in the KRas mutant tumor having the highest frequency of Ras mutants. As another strategy, small molecule drugs directly targeting Ras include Kobe0065 and Kobe2602, which have a mechanism of binding to activated Ras to inhibit the interaction with Raf, the subeffector protein, but these drugs have limitations in that the stability of the drug is low and a high dose of the drug is required for treatment. In addition, ARS853, which has a mechanism of covalently binding to the KRas G12C mutant to inhibit the interaction with the subeffector protein, Raf, has been developed, but it has a limitation in that it is a drug limited only to the KRas G12C mutant, which accounts for only a small proportion of KRas mutants. In addition, rigosertib having a mechanism of binding to the Ras-binding domain (RBD) of Raf, PI3K and RalGDS as subeffector proteins to inhibit binding to Ras, has been developed, but it has a limitation in that a high dose of the drug is required for treatment.
In addition to small molecule drugs, stapled peptides, which are being developed as structural analogs to alpha helixes, are developed as therapeutic agents targeting proteins inside cells owing to the advantages of improved structural stability of peptides as well as enhanced metabolic stability and cell permeability through linking of two non-adjacent units with hydrocarbon chains. Staple peptides are capable of cytoplasmic penetration using a strategy of mimicking, with a peptide, a site binding to Ras of a Ras guanine nucleotide exchange factor (RasGEF), which converts inactivated Ras to activated Ras, based on these properties. However, such staple peptides have limitations in that a high dose of the peptide is required to obtain the treatment effect and they have non-specific effects on Ras wild-type cell lines as well as Ras mutant cell lines.
In order to overcome these technical limitations of small molecule drugs and staple peptides, various studies have been conducted to impart the ability to penetrate into living cells to high-molecule materials, such as antibody fragments or recombinant proteins, and to effectively inhibit protein-protein interactions. In particular, protein transduction domains (PTDs) having basic amino acid sequences, hydrophobicity and amphipathicity have been found to have the ability to penetrate into living cells, and many attempts have been made to genetically fuse protein permeation domains with various types of antibody fragments to recognize specific proteins inside cells using the same. However, most thereof are not secreted from animal cells, or only a small amount is released into the supernatant, resulting in limitations of low production yield and poor penetration efficiency into the cells. In order to overcome this expression problem, studies have been conducted to fuse cell permeation domains through chemical covalent bonding or biotin-streptavidin-mediated binding, etc., but there is a limitation in that the structure of the corresponding protein is changed.
In general, intact immunoglobulin-type antibodies cannot penetrate directly into living cells due to the large size and hydrophilicity thereof. However, a cytotransmab, which is an intact immunoglobulin-type antibody having cytoplasmic penetration ability, has the ability to penetrate into the cytoplasm through a mechanism that involves binding to the cell membrane receptors, HSPGs (heparan sulfate proteoglycans), entering the cell by clathrin-mediated endocytosis, and then escaping from the endosome into the cytoplasm. HSPG, which is a cytotransmab receptor, is generally expressed in most animal tissues, and acts as a co-receptor for binding various receptors with growth factors and cytokine, functions to form tissues, heal wounds or the like, and is partially cut off from the cell membrane and thus acts as an effector protein in the blood as well. Due to these characteristics, the hepatocyte growth factor/scatter factor having a site binding to HSPG has a low half-life in the blood. In an attempt to overcome this problem, research to remove the HSPG-binding site to thereby increase the half-life in the blood has been reported.
The therapeutic immunoglobulin antibody has a longer development period than a small molecule drug, and must be produced at a high concentration for administration to a patient. For this reason, determining the developability into a therapeutic drug enabling stability and solubility of the antibody has arisen as a big issue in the early stages of development. Cytotransmab is introduced into the cells through binding via electrostatic attraction between the negative charges of the HS chain of the extracellular receptor HSPG and the positively charged amino acid residues of the complementarity-determining regions (CDRs) of the cytotransmab antibody. It has been reported that the positively charged amino acid residues in the CDRs of antibodies adversely affect antibody stability, and when these positively charged amino acid residues are replaced with hydrophobic or negatively charged amino acids, the physical properties thereof are significantly improved.
After the immunoglobulin antibody binds to several pathogens in the body, it may penetrate into the cells along with the pathogens. The immunoglobulin antibody can bind to the TRIM21 protein in the cytoplasm to thus create an intracellular immune system. TRIM21 is a cytoplasmic protein belonging to the E3 ligase family, which binds to the CH2-CH3 region of immunoglobulins to form a complex with pathogens and immunoglobulins, wherein the complex is decomposed through the ubiquitin-proteasome mechanism. It has been reported that, when the binding between the immunoglobulin antibody and TRIM21 is inhibited, the immune system against the pathogen does not work, and that TRIM21 plays an important role in the degradation of the immunoglobulin antibody. In addition, the immunoglobulin antibody has an immune system that induces tumor death by inducing antibody-dependent cell-mediated cytotoxicity (ADCC) through binding to Fcγ receptors of immune cells in the blood. Each subclass of immunoglobulin has a different binding affinity to the Fcγ receptor, and specifically, IgG2 and IgG4 antibodies lack ADCC function due to very low affinity with the Fcγ receptor. In the same subclass of immunoglobulin, IgG2 and IgG4 have a longer in-vivo half-life than IgG1 due to the affinity with the Fcγ receptor.
Therefore, the present inventors established a heavy-chain variable region (VH) library based on the conventional anti-Ras⋅GTP iMab antibody (RT11), which directly inhibits intracellular Ras activity through cytoplasmic penetration, selected the heavy-chain variable region (VH) having improved affinity for Ras⋅GTP in the cytoplasm, and constructed an intact immunoglobulin-type antibody by simultaneously expressing the heavy-chain variable region (VH) with a light chain having a humanized light-chain variable region (VL) that penetrates into the living cells and is located in the cytoplasm, thereby producing an anti-Ras⋅GTP iMab antibody with an improved Ras-mutant-specific cell growth inhibitory effect.
In addition, in order to discover an intact immunoglobulin-type anti-Ras⋅GTP iMab antibody having tumor-tissue-specific cytoplasmic penetration ability, the present inventors developed a single domain of a light-chain variable region (VL) that reduces non-specific binding ability to HSPG and has improved stability and productivity even after fusing peptides for imparting tumor-tissue specificity thereto, and developed a tumor-tissue-specific anti-Ras⋅GTP iMab antibody with high productivity by simultaneously expressing a light chain including the light-chain variable region (VL) and a heavy-chain including a single domain of a heavy-chain variable region (VH) having binding ability to Ras⋅GTP with high specificity.
In addition, the present inventors produced an anti-Ras⋅GTP iMab antibody having an improved Ras-mutant-specific cell growth inhibitory effect by modifying the heavy chain to improve the intracellular stability, in-vivo persistence and tissue specificity of the intact immunoglobulin-type anti-Ras⋅GTP iMab antibody having tumor-tissue-specific cytoplasmic penetration ability.
In addition, the present inventors found that the tumor-tissue-specific anti-Ras⋅GTP iMab antibody penetrates into various Ras-mutant-dependent cancer cell lines, exhibits the Ras⋅GTP-specific binding ability in the cytoplasm, and has improved cell growth inhibition effect compared to the conventional anti-Ras⋅GTP iMab antibody. In addition, the present inventors found that tumor-tissue-specific anti-Ras⋅GTP iMab antibody reduces the HSPG-binding ability to impart tumor-tissue specificity, and exhibits a high level of production yield even when fused with integrin- or EpCAM-targeting protopeptides overexpressed in tumor tissues, and exhibits activity of specifically inhibiting Ras⋅GTP in Ras-mutant-dependent tumors without adverse effects on cytoplasmic penetration or inhibition of Ras⋅GTP activity. Based on this finding, the present disclosure has been completed.
Patent Document
Korean Patent No. 10-1602870
Korean Patent No. 10-1602876
It is one object of the present disclosure to provide a method for improving the functions of antibodies in the form of an intact immunoglobulin, which bind to the membrane protein receptor on the cell surface overexpressed in tumor tissue, undergo endocytosis, and then are located in the cytoplasm by escaping from the endosome, and directly inhibit tumor mutant Ras activity by binding to intracellular Ras⋅GTP, and a method of producing the antibodies.
It is another object of the present disclosure to provide an amino acid sequence of a heavy-chain variable region that specifically binds to Ras activated by GTP bound thereto.
It is another object of the present disclosure to provide an intact immunoglobulin antibody including the heavy-chain variable region.
The antibody may have cytoplasmic penetration ability, and may include a specific sequence of amino acids for this purpose. In addition, the antibody may include specific amino acid sequences required to fuse the peptides targeting EpCAM (epithelial cell adhesion molecule), integrin αvβ3 or integrin αvβ5, as membrane proteins expressed on the surface of cancer cells, with the light-chain variable region or the heavy-chain variable region in order to improve the cancer-cell-targeting ability.
In addition, the antibody may include a heavy-chain constant region or a light-chain constant region derived from human immunoglobulin selected from the group consisting of IgA, IgD, IgE, IgG1, IgG2, IgG3, IgG4, and IgM.
In addition, in order to improve cancer-cell-targeting ability, the heavy-chain constant region of the antibody may include at least one mutation of N434D of the region CH3, and L234A, L235A or P329G of the CH2 region (the amino acid position is determined according to EU numbering).
In addition, the antibody may be selected from the group consisting of single-chain Fvs (scFV), single-chain antibodies, Fab fragments, F(ab′) fragments, disulfide-binding Fvs (sdFV) and epitope-binding fragments of the antibodies.
In addition, the antibody may be a bispecific antibody (bispecific Ab), and may be fused with any one or more selected from the group consisting of proteins, peptides, small molecule drugs, toxins, enzymes and nucleic acids.
It is another object of the present disclosure to provide a method for preparing an intact immunoglobulin-type antibody that has improved affinity for intracellular Ras⋅GTP and a tumor tissue-specific cytoplasmic penetration ability.
It is another object of the present disclosure to provide a composition for preventing or treating cancer including the antibody. The cancer may have a mutation with an activated intracellular Ras. In particular, the mutation of Ras may be a mutation in 12nd, 13rd or 61st amino acid of the Ras.
The prevention or treatment of cancer provided in the present disclosure is characterized in that the antibody provided in the present disclosure has a mechanism for inhibiting the binding of activated Ras (Ras⋅GTP) with B-Raf, C-Raf or PI3K in the cytoplasm.
It is another object of the present disclosure to provide a composition for diagnosing tumors including the antibody.
It is another object of the present disclosure to provide a polynucleotide encoding the antibody.
It is another object of the present disclosure to provide a heavy-chain variable-region library that specifically binds to Ras⋅GTP and has improved affinity therefor, and a method for constructing the same.
It is another object of the present disclosure to provide a method for screening a heavy-chain variable region that specifically binds to Ras⋅GTP and has improved affinity therefor.
In accordance with one aspect of the present disclosure, the above and other objects can be accomplished by the provision of a heavy-chain variable region specifically binding to Ras(Ras⋅GTP) activated by GTP bound thereto, including CDR1 having an amino acid sequence represented by the following Formula 1, CDR2 having an amino acid sequence represented by the following Formula 2, and CDR3 having an amino acid sequence represented by the following Formula 3:
D-X11-SMS [Formula 1]
wherein X11 is F or Y,
YISRTSHT-X21-X22-YADSVKG [Formula 2]
wherein X21 is T, I or L, and X22 is Y, C, S, L or A,
G-F-X31-X32-X33-Y [Formula 3]
wherein X31 is K, F, R or N, X32 is M or L, and X33 is D or N.
In another aspect, the present disclosure provides a method for improving the function of an antibody to inhibit the activity of intracellular Ras⋅GTP by actively penetrating, in the form of intact immunoglobulin, into the cytoplasm in living cells through endocytosis by tumor-tissue-specific cell membrane receptors and endosomal escape, and a method for preparing the antibody.
Hereinafter, the present disclosure will be described in detail.
The method of the present disclosure is capable of increasing the efficiency of tumor suppression specific for Ras mutant tumors through an intact immunoglobulin-type antibody having a heavy-chain variable region (VH), which exhibits improved affinity for intracellular Ras⋅GTP and thus high binding ability thereto, and a light-chain variable region (VL), which has cytoplasmic penetration ability specific for tumor tissues.
That is, the present disclosure aims at developing an intact immunoglobulin-type antibody that enables tumor-specific cytoplasmic penetration and binds to intracellular Ras⋅GTP with high affinity after cytoplasmic penetration to inhibit Ras activity.
The antibody may be an intact immunoglobulin-type antibody or a fragment thereof.
The antibody may be a chimeric, human or humanized antibody.
The heavy-chain variable region of the antibody according to the present disclosure includes CDR1 having the amino acid sequence represented by the following Formula 1, CDR2 having the amino acid sequence represented by the following Formula 2, and CDR3 having the amino acid sequence represented by the following Formula 3:
D-X11-SMS [Formula 1]
wherein X11 is F or Y,
YISRTSHT-X21-X22-YADSVKG [Formula 2]
wherein X21 is T, I or L, and X22 is Y, C, S, L or A,
G-F-X31-X32-X33-Y [Formula 3]
wherein X31 is K, F, R or N, X32 is M or L, and X33 is D or N.
Specifically, in an embodiment of the present disclosure, in Formula 1, defining CDR included in the heavy-chain variable region, X11 is F or Y, in Formula 2, X21-X22 is TY, IY, TC, TS, IS, LC, LL or IA, and in Formula 3, X31-X32-X33 is KMD, RMD, FMN, RLD or NLD.
Specifically, in one embodiment of the present disclosure, the heavy-chain variable region having improved affinity for intracellular Ras⋅GTP is a sequence including amino acid sequences selected from the group consisting of SEQ ID NOS: 20 to 32.
The sequence information of the heavy-chain variable region (VH) is as follows.
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
SRTSHTTY
SRDNSKNTLYLQMNSLRAEDTAVYYCARGFKMDYWGQGTLVTVSS
indicates data missing or illegible when filed
Regarding the heavy-chain variable region having improved affinity for intracellular Ras⋅GTP, the CRD1 sequence is selected from the group consisting of amino acid sequences represented by SEQ ID NOS: 2 to 4, and the CDR2 sequence is selected from the group consisting of amino acid sequences represented by SEQ ID NO: 5 and SEQ ID NOS: 10 to 16, and the CDR3 sequence is selected from the group consisting of amino acid sequences represented by SEQ ID NOS: 6 to 9 and SEQ ID NOS: 17 to 18.
The sequence information of the CDR is as follows:
However, all amino acid numbers specified in Sequence numbers excluding the heavy-chain constant region and X11, X21-X22 and X31-X32-X33 included in the Formulas 1, 2 and 3 defining the CDRs provided herein were Kabat numbers (Kabat E A et al., 1991).
In addition, in another aspect, the present disclosure provides a light-chain variable region having cytoplasmic penetration ability specific for tumor cells and inhibited binding ability to HSPG, wherein the light-chain variable region may include an amino acid sequence selected from the group consisting of SEQ ID NOS: 34 to 43 and SEQ ID NOS: 44 to 60.
The sequence information of the light-chain variable region (VL) for this purpose is as follows.
TCKSSQSL
NSR
RKNYLAWYQQKPGKAPKLLIYW
SSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR
TCKSSQSLLDS
DGNTLYLAWYQQKPGKAPKLLIYW
SSLQPEDFATYYCQQYYYHMYTFGQGT
EIK
TCKSSQSLLDSDDGNTLYLAWYQQKPGKAPKLLIYW
SSLQPEDFATY
CQQYWYMYTFGQGT
EIK
TCKSSQSLLNSRTRKNYLAWYQQKPGKAPKLLIYW
SSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR
TCKSSQSL
NSRDGNTYLAWYQQKPGKAPKLLIYW
SSLQPEDFATYFCQQYWYWMYTFGQGTKVE
KR
TCKSSQSL
NSDDRNTYLAWYQQKPGKAPKLLIYW
SSLQPEDFATYFCQQYWYWMYTFGQGTKVE
KR
TCKSSQSL
NSDDGKTYLAWYQQKPGKAPKLLIYW
SSLQPEDFATYFCQQYWYWMYTFGQGTKVE
KR
TCKSSQSL
NSRTGKTYLAWYQQKPGKAPKLLIYW
SSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR
TCKSSQSL
NSRDGKNYLAWYQQKPGKAPKLLIYW
SSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR
TCKSSQSL
NSRTGKTYLAWYQQKPGKAPKLLIYW
SSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR
TCKSSQSL
NSRDGKTYLAWYQQKPGKAPKLLIYW
SSLQPEDFATYFCQQYWYWMYTFGQGTKVEIKR
TCKSSQSLLNS
GNTYLAWY
FTLT
SSLQPEDFATYFCQQYWY
KR
TCKSSQSLLNS
GNTYLAWY
FTLT
SSLQPEDFATYFCQQYWY
KR
TCKSSQSLLNS
GNTYLAWY
FTLT
SSLQPEDFATYFCQQYWY
KR
TCKSSQSLLNS
GNTYLAWY
FTLT
SSLQPEDFATYFCQQYWY
KR
TCKSSQSLLNS
GNTYLAWY
FTLT
SSLQPEDFATYFCQQYWY
KR
TCKSSQSLLNS
GNTYLAWY
FTLT
SSLQPEDFATYFCQQYWY
KR
TCKSSQSLLNS
GNTYLAWY
FTLT
SSLQPEDFATYFCQQYWY
KR
TCKSSQSLLNS
GNTYLAWY
FTLT
SSLQPEDFATYFCQQYWY
KR
TCKSSQSLLNS
GNTYLAWY
FTLT
SSLQPEDFATYFCQQYWY
KR
TCKSSQSLLNS
GNTYLAWY
FTLT
SSLQPEDFATYFCQQYWY
KR
TCKSSQSLLNS
GNTYLAWY
FTLT
SSLQPEDFATYFCQQYWY
KR
indicates data missing or illegible when filed
In addition, in one embodiment of the present disclosure, the heavy-chain variable region modified (improved) to improve tumor-tissue-targeting ability is a sequence including amino acid sequences selected from the group consisting of SEQ ID NOS: 61 to 63.
The sequence information of the heavy-chain variable region (VH) is as follows.
In addition, in one embodiment of the present disclosure, the heavy-chain constant region to improve the intracellular stability of the antibody having the tumor-tissue-specific cytoplasmic penetration antibody and to impart a long half-life thereto is a sequence including an amino acid sequence selected from the group consisting of SEQ ID NOS: 65 to 69.
The sequence information of the heavy-chain constant region (CH1-CH2-CH3) for this purpose is as follows.
In addition, in another aspect, the present disclosure provides a method for constructing a heavy-chain variable region library that specifically binds to Ras⋅GTP and has improved affinity therefor.
The method includes:
(1) determining an amino acid site having high potential to bind to intracellular Ras⋅GTP among three complementarity determining regions (CDRs) involved in antigen binding of a RT11 heavy-chain variable region (VH) as a library template;
(2) designing a degenerated codon primer capable of encoding an amino acid in need of inclusion in a library at the determined amino acid site; and
(3) expressing the designed heavy-chain variable-region library in the form of scFab or Fab using a yeast surface expression system.
In addition, in another aspect, the present disclosure provides a method for screening a heavy-chain variable region that specifically binds to Ras⋅GTP and has improved affinity therefor,
the method including:
(1) expressing a heavy-chain variable-region library capable of binding to Ras⋅GTP using a yeast surface expression system;
(2) constructing Avi-KRasG12D bound to GppNHp, a GTP analogue, in a stable form without deformation during biotinylation;
(3) binding the library with the GppNHp-bound Avi-KRasG12D; and
(4) measuring the affinity of the binding between the library and the GppNHp-bound Avi-KRasG12D.
In addition, in another aspect, the present disclosure provides an intact immunoglobulin antibody including the antibody fused with one or more selected from the group consisting of proteins, peptides, small molecule drugs, toxins, enzymes, nucleic acids and nanoparticles.
The proteins include antibodies, fragments of antibodies, immunoglobulins, peptides, enzymes, growth factors, cytokines, transcription factors, toxins, antigenic peptides, hormones, transport proteins, motor function proteins, receptors, signaling proteins, storage proteins, membrane proteins, transmembrane proteins, internal proteins, external proteins, secreted proteins, viral proteins, sugar proteins, truncated proteins, protein complexes, chemically modified proteins and the like.
The term “small molecule drug” refers to an organic compound, an inorganic compound or an organometallic compound that has a molecular weight of less than about 1,000 daltons and has activity as a therapeutic agent for diseases, which is widely used herein. The small molecule drug used herein includes oligopeptides and other biomolecules having a molecular weight of less than about 1,000 daltons.
As used herein, the term “nanoparticle” refers to a particle including a material having a diameter of 1 to 1,000 nm, and the nanoparticle may be a metal/metal core-shell complex including a metal nanoparticle, a metal nanoparticle core and a metal shell including the core, a metal/non-metal core-shell complex including a metal nanoparticle core and a non-metal shell surrounding the core, or a nonmetal/metal core-shell complex including a nonmetal nanoparticle core and a metal shell surrounding the core. According to one embodiment, the metal may be selected from gold, silver, copper, aluminum, nickel, palladium, platinum, magnetic iron and oxides thereof, but is not limited thereto, and the nonmetal may be selected from silica, polystyrene, latex and acrylic substances, but is not limited thereto.
As used herein, the term “fusion” refers to the integration of two molecules having different or identical functions or structures, and includes fusion through any physical, chemical or biological method capable of binding the tumor specific-cytoplasmic penetration antibody to the protein, small-molecule drug, nucleic acid or nanoparticle. The fusion may preferably be carried out using a linker peptide, and the linker peptide may mediate the fusion with the bioactive molecule at various positions of the antibody light-chain variable region according to the present disclosure, antibody, or fragment thereof.
In addition, the present disclosure provides a pharmaceutical composition for preventing or treating cancer containing a biologically active molecule selected from the group consisting of the antibody, or a peptide, protein, small molecule drug, nucleic acid and nanoparticle fused thereto.
The biologically active molecule selected from the group consisting of the antibody, or a peptide, protein, small molecule drug, nucleic acid and nanoparticle fused thereto, enables intercellular permeation and remains in the cytoplasm without affecting antibody specificity and high affinity of the human antibody heavy-chain variable region (VH) and thus is expected to be highly effective in the treatment and diagnosis of tumor- and disease-related factors, which are classified as target substances for the treatment of diseases using small molecule drugs and are present in the cytoplasm and form structurally complex interactions through a wide and flat surface between protein and protein.
In another aspect, the present disclosure provides a method of inhibiting the growth of cancer or tumor cells using the antibody and a method of treating cancer or tumors.
The cancer may be selected from the group consisting of squamous cell carcinoma, small cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lungs, squamous cell carcinoma of the lungs, peritoneal cancer, skin cancer, skin or ocular melanoma, rectal cancer, anal cancer, esophageal cancer, small intestine cancer, endocrine cancer, parathyroid cancer, adrenal cancer, soft tissue sarcoma, urethral cancer, chronic or acute leukemia, lymphoma, hepatoma, gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, liver tumor, breast cancer, colon cancer, colorectal cancer, endometrial cancer or uterine cancer, salivary gland cancer, kidney cancer, liver cancer, prostate cancer, vulva cancer, thyroid cancer, liver cancer and head and neck cancer.
When the composition is prepared as a pharmaceutical composition for preventing or treating cancer, the composition may include a pharmaceutically acceptable carrier. The pharmaceutically acceptable carrier included in the composition is conventionally used in the preparation of a drug, and includes, but is not limited to, lactose, dextrose, sucrose, sorbitol, mannitol, starch, acacia rubber, calcium phosphate, alginate, gelatin, calcium silicate, microcrystalline cellulose, polyvinyl pyrrolidone, cellulose, water, syrup, methyl cellulose, methylhydroxy benzoate, propylhydroxy benzoate, talc, magnesium stearate, mineral oil and the like. The pharmaceutical composition may further include a lubricant, a wetting agent, a sweetener, a flavoring agent, an emulsifier, a suspending agent, a preservative or the like, in addition to the above ingredients.
The pharmaceutical composition for preventing or treating cancer may be administered orally or parenterally. The parenteral administration may be intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection, endothelial administration, topical administration, intranasal administration, pulmonary administration or rectal administration. Upon oral administration, proteins or peptides are digested, so that an oral composition may be coated with an active drug or formulated so as to protect the same from degradation in the stomach. In addition, the composition may be administered using any device capable of delivering the active substance to target cells.
The suitable dose of the pharmaceutical composition for preventing or treating cancer may vary depending on factors such as the formulation method, administration method, and age, body weight, gender, pathological conditions, diet, administration time, administration route, excretion rate and responsiveness of the patient. For example, the suitable dose of the composition may be within the range of 0.001 to 100 mg/kg for an adult. The term “pharmaceutically effective amount” may mean an amount sufficient to prevent or treat cancer or to prevent or treat neovascular diseases.
The composition may be prepared into a unit dose form, or may be incorporated into a multi-dose container through formulation using a pharmaceutically acceptable carrier and/or excipient according to a method that can be easily implemented by those skilled in the art to which the present disclosure pertains. In this case, the formulation may be in the form of a solution, a suspension, a syrup or an emulsion in an oil or aqueous medium, or may be formulated in the form of an extract, a powder, a granule, a tablet or a capsule. The composition may further include a dispersant or a stabilizer. In addition, the composition may be administered alone or in combination with other therapeutics. In this case, the composition of the present disclosure may be administered sequentially or simultaneously with conventional therapeutics. Meanwhile, since the composition includes an antibody or an antigen-bonding fragment thereof, it can be formulated as an immunoliposome. Liposomes including the antibody can be prepared according to a method well-known in the art. The immunoliposome can be prepared through reverse phase evaporation in the form of a lipid composition including phosphatidylcholine, cholesterol and polyethyleneglycol-derived phosphatidyl ethanolamine. For example, Fab′ fragments of antibodies can be fused to liposomes via disulfide interchange reaction. A chemotherapeutic agent such as doxorubicin may further be included in the liposomes.
In addition, in another aspect, the present disclosure provides a composition for the diagnosis of cancer containing a biologically active molecule selected from the group consisting of the antibody and a peptide, protein, small molecule drug, nucleic acid or nanoparticle fused thereto.
As used herein, the term “diagnosis” means determining the presence or features of pathophysiology. In the present disclosure, diagnosis serves to determine the onset or progress of cancer.
The intact immunoglobulin antibody or fragment thereof may bind to a phosphor for molecular imaging to diagnose cancer through imaging.
The phosphor for molecular imaging is any material that generates fluorescence, and preferably emits red or near-infrared fluorescence, and is more preferably a phosphor having a high quantum yield, but is not limited thereto.
The phosphor for molecular imaging is preferably, but without limitation, a phosphor, a fluorescent protein, or other imaging material capable of specifically binding to the intact immunoglobulin antibody or a fragment thereof.
The phosphor is preferably fluorescein, BODYPY, tetramethylrhodamine, Alexa, cyanine, allophycocyanin or derivatives thereof, but is not limited thereto.
The fluorescent protein is preferably a Dronpa protein, a fluorescent color gene (EGFP), a red fluorescent protein (DsRFP), a cy5.5 phosphor, which exhibits near-infrared cyanine fluorescence, or other fluorescent protein, but is not limited thereto.
Other imaging materials are preferably iron oxide, radioisotopes and the like, but are not limited thereto, and may be applied to imaging equipment such as MR and PET.
In addition, the present disclosure provides a polynucleotide encoding an antibody including a heavy-chain variable region (VH) having improved affinity for intracellular Ras⋅GTP and a light-chain variable region (VL) having cytoplasmic penetration ability specific for tumor tissues.
As used herein, the term “polynucleotide” refers to a polymer of deoxyribonucleotide or ribonucleotide present in single- or double-stranded form, encompasses RNA genome sequences and DNA (gDNA and cDNA) and RNA sequences transcribed therefrom, and includes analogues of naturally derived polynucleotides, unless mentioned otherwise.
The polynucleotide includes not only nucleotide sequences encoding the heavy-chain variable region (VH) having improved affinity for intracellular Ras⋅GTP, the light-chain variable region (VL) having cytoplasmic penetration ability specific for tumor tissues, and the heavy-chain constant region (CH1-CH2-CH3) to impart intracellular stability and long half-life, but also sequences complementary to the sequences. Such complementary sequences include completely complementary sequences as well as substantially complementary sequences. This refers to a sequence that can hybridize with the nucleotide sequence encoding any one amino acid sequence of SEQ ID NOS: 20 to 69 under stringent conditions known in the art.
The polynucleotide can be varied. Such variation includes addition, deletion, or non-conservative or conservative substitution of nucleotides. The polynucleotide encoding the amino acid sequence is interpreted to include a nucleotide sequence having substantial identity with the nucleotide sequence. The expression “nucleotide sequence having substantial identity” means a nucleotide sequence that has a homology of at least 80%, more preferably a homology of at least 90%, and most preferably a homology of at least 95%, when aligning the nucleotide sequence of the present disclosure with any other sequence so as to correspond thereto as much as possible and analyzing the aligned sequence using algorithms commonly used in the art.
In another aspect, the present disclosure provides a method for preparing an intact immunoglobulin-type antibody that penetrates into cells and is disposed in the cytoplasm using a heavy-chain variable region (VH) having improved affinity for intracellular Ras⋅GTP and a light-chain variable region (VL) having cytoplasmic penetration ability specific for tumor tissues, the method comprising:
(1) preparing an endosomal escape heavy-chain expression vector cloned with nucleic acids, substituted with a humanized heavy-chain variable region (VH) having improved affinity for intracellular Ras⋅GTP from a heavy-chain variable region (VH) included in a heavy chain comprising a human heavy-chain variable region (VH) and a human heavy-chain constant region (CH1-hinge-CH2-CH3);
(2) preparing a cytoplasmic penetration light-chain expression vector cloned with nucleic acids, substituted with a humanized light-chain variable region (VL) having cytoplasmic penetration ability and a humanized light-chain variable region (VL) having cytoplasmic penetration ability specific for tumor tissues from a light-chain variable region (VL) included in a light chain comprising a human light-chain variable region (VL) and a human light-chain constant region (CL);
(3) co-transforming the prepared heavy- and light-chain expression vectors into animal cells for protein expression to express an intact immunoglobulin-type antibody including a heavy-chain variable region (VH) having improved affinity for intracellular Ras⋅GTP and a light-chain variable region (VL) having cytoplasmic penetration ability specific for tumor tissues; and
(4) purifying and recovering the expressed intact immunoglobulin-type antibody.
The method can express a vector expressing a heavy chain and a vector expressing a light chain, thereby specifically expressing an antibody that penetrates into cells specifically for tumor tissues and is located in the cytoplasm and is capable of targeting intracellular Ras/GTP with high affinity. The vector may be a vector system that simultaneously expresses the light and heavy chains in one vector or a system that independently expresses the chains in separate vectors. In the latter case, both vectors can be introduced into the host cells through co-transformation and targeted transformation.
The light-chain variable region (VL), light-chain constant region (CL), heavy-chain variable region (VH) and heavy-chain constant region (CH1-hinge-CH2-CH3) provided by the present disclosure in the recombinant vector are operatively linked to a promoter. The term “operatively linked” means functional linkage between a nucleotide expression control sequence (e.g., a promoter sequence) and another nucleotide sequence, which enables the control sequence to regulate transcription and/or translation of the other nucleotide sequence.
The recombinant vector can typically be constructed as a vector for cloning or a vector for expression. The vector for expression may be a conventional vector used in the art to express foreign proteins in plants, animals or microorganisms. The recombinant vector may be constructed through any of various methods known in the art.
The recombinant vector may be constructed using prokaryotic or eukaryotic cells as hosts. For example, when a vector that is used is an expression vector and a prokaryotic cell is used as a host, the vector generally includes a potent promoter capable of conducting transcription (such as a pLλ promoter, trp promoter, lac promoter, tac promoter, T7 promoter, etc.), a ribosome-binding site to initiate translation, and a transcription/translation termination sequence. In addition, for example, when a eukaryotic cell is used as a host, the replication origin that operates in eukaryotic cells included in the vector includes, but is not limited to, an f1 replication origin, a SV40 replication origin, a pMB1 replication origin, an adeno replication origin, an AAV replication origin, a CMV replication origin, a BBV replication origin and the like. Also, a promoter derived from the genome of mammalian cells (e.g., a metallothionein promoter), or a promoter derived from a mammalian virus (e.g., adenovirus late promoter, vaccinia virus 7.5K promoter, SV40 promoter, cytomegalovirus (CMV) promoter, or HSV tk promoter) may be used, and the vector generally has a polyadenylation sequence as a transcription termination sequence.
In another aspect, the present disclosure provides a host cell transformed with the recombinant vector.
The host cell may be any host cell well-known in the art, and in the case of transforming prokaryotic cells, includes, for example, E. coli JM109, E. coli BL21, E. coli RR1, E. coli LE392, E. coli B, E. coli X 1776, E. coli W3110, strains of the genus Bacillus, such as Bacillus subtilis and Bacillus thuringiensis, and enterococci and strains such as Salmonella typhimurium, Serratia marcescens and various Pseudomonas species. In the case of transforming eukaryotic cells, as host cells, yeast (Saccharomyces cerevisiae), insect cells, plant cells and animal cells such as SP2/0, Chinese hamster ovary K1, CHO DG44, PER.C6, W138, BHK, COS-7, 293, HepG2, Huh7, 3T3, RIN and MDCK cell lines and the like can be used.
In another aspect, the present disclosure provides a method for producing an intact immunoglobulin-type antibody that penetrates specifically into tumor tissue cells and is located in the cytoplasm and is thus capable of targeting intracellular Ras/GTP with high affinity, the method including culturing the host cell.
Insertion of the recombinant vector into the host cell may be carried out using an insertion method well-known in the art. The delivery method may be a CaCl2 method or an electroporation method, for example, when the host cell is a prokaryotic cell. When the host cell is a eukaryotic cell, the delivery method may be micro-injection, calcium phosphate precipitation, electroporation, liposome-mediated transfection, gene bombardment or the like, but is not limited thereto. The use of microorganisms such as E. coli realizes higher productivity than when using animal cells, but is not suitable for the production of intact Ig-type antibodies due to the problem of glycosylation, and is suitable for the production of antigen-binding fragments such as Fab and Fv.
The method for selecting the transformed host cell can be easily carried out according to methods well-known in the art using a phenotype expressed by a selection marker. For example, when the selection marker is a gene specific for antibiotic resistance, the transformant can be easily selected by culturing the transformant in a medium containing the antibiotic.
Hereinafter, the present disclosure will be described in more detail with reference to examples. However, it will be obvious to those skilled in the art that these examples are provided only for illustration of the present disclosure and should not be construed as limiting the scope of the present disclosure.
An Avi-KRasG12D antigen including an Avi tag (GLNDIFEAQKIEWHE) fused to an N-term thereof for use in library selection was constructed. The Avi-KRasG12D antigen was constructed in order to minimize structural denaturation which may cause problems with antigen biotinylation during library selection.
Specifically, DNA in which catalytic G domains (residues 1 to 169) of the KRasG12D protein, excluding the C-terminal hypervariable region are fused to an 8× his tag and an Avi-tag at the N-terminus using a GSG linker was constructed by PCR and was cloned using the restriction enzymes NcoI and HindIII in the pET23 vector, which is a vector for E. coli expression. Then, the constructed pET23-8Xhis-Avi-KRasG12D (1-169) vector was transformed through electroporation into the E. coli strain BL21(DE3)plysE along with a vector (pBirAcm) encoding BirA as a biotin ligase for in-vivo biotinylation, and then was selected in a selective medium containing 100 μg/ml ampicillin and 10 μg/ml chloramphenicol. After culturing the selected E. coli in the selective medium (LBCA) containing 5 mM MgCl2 at 37° C. until absorbance at 600 nm reached 0.6, 0.5 mM IPTG for protein expression and 50 μM d-biotin for in-vivo biotinylation were added thereto, followed by further culturing at 30° C. for 4 hours. The stock solution for addition of 50 μM d-biotin was prepared by adding 12 mg of d-biotin to 10 mL of 10 mM bicin buffer (pH 8.3). After culturing E. coli, the E. coli collected using a centrifuge were resuspended in buffer containing 20 mM Tris, 500 mM NaCl, 5 mM imidazole and 2 mM β-ME, and E. coli (SONICS) was pulverized with ultrasound waves. Only the supernatant, from which the pulverized E. coli was removed, was collected using a centrifuge, and then purified using Ni-NTA resin for specifically purifying the protein fused with the His tag. The Ni-NTA resin was washed with 50 ml of washing buffer (20 mM Tris, pH 7.4, 300 mM NaCl, 20 mM imidazole, 2 mM MgCl2 and 2 mM β-ME) and proteins were eluted with an elution buffer (20 mM Tris, pH 7.4, 300 mM NaCl, 250 mM imidazole, 2 mM MgCl2 and 2 mM β-ME). The eluted proteins were buffered with a storage buffer (50 mM Tris-HCl, pH 8.0, 1 mM DTT, 2 mM MgCl2) using a dialysis method. The purified proteins were quantified using absorbance and the absorption coefficient measured at a wavelength of 280 nm. Purity of about 98% or more was identified through SDS-PAGE analysis.
The fusion of the purified Avi-KRasG12D protein with Avi-tag and biotin at high yield through the in-vivo biotinylation reaction was identified using a gel shift method. Specifically, the Avi-KRasG12D protein was diluted in an SDS-PAGE loading buffer (25 mM Tris-HCl, pH 6.8, 1% SDS, 10% glycerol, 175 mM β-ME), allowed to react for 10 minutes and then allowed to react with 1 μg of streptavidin at room temperature for 30 minutes, the protein separated through SDS-PAGE was transferred to the PVDF membrane and identified using the anti-His antibody fused with HRP.
The Avi-KRasG12D protein was reacted with GTP analog (GppNHp) or GDP and was then analyzed by SDS-PAGE. Specifically, in order to form a complex of the GTP analog (GppNHP) and Ras protein, the purified Ras protein was diluted in a substrate exchange buffer (40 mM Tris-HCl, pH 7.5, 200 mM (NH4)2SO4, 10 μM ZnCl2, 5 mM DTT) and an alkaline phosphatase fused with 2 units of beads per mg of Ras protein and GppNHp having a molar amount at least 10 times that of the Ras protein were added thereto, followed by allowing a reaction to proceed at room temperature for 1 hour. In order to form a complex of GDP and Ras protein, GDP in a molar amount at least 20 times that of the Ras protein and 20 mM EDTA were added and allowed to react at 30° C. for 30 minutes, and then 60 mM MgCl2 was added thereto, and the result was allowed to stand at 4° C. for 30 minutes to stop the reaction. The GppNHp or GDP-bound Ras protein obtained through the method was analyzed through SDS-PAGE after the buffer was exchanged with a storage buffer (50 mM Tris-HCl, pH 8.0, 1 mM DTT, 2 mM MgCl2) using a PD10 Sephadex G25 column. For long-term storage, the Ras protein bound to the substrate was stored at −80° C.
ELISA was performed to analyze the RT11 binding capacity of the Avi-KRasG12D protein prepared through the above method and the His-KRasG12D protein having no Avi-tag. Specifically, RT11, an anti-Ras⋅GTP iMab, was bound at a concentration of 5 μg/ml in a 96-well EIA/RIA plate (COSTAR Corning) at room temperature for 1 hour, and was then washed with 0.1% TBST (12 mM Tris, pH 7.4, 137 mM NaCl, 2.7 mM KCl, 0.1% Tween20, 5 mM MgCl2) at room temperature for 10 minutes. After binding with 4% TBSB (12 mM Tris, pH 7.4, 137 mM NaCl, 2.7 mM KCl, 4% BSA, 10 mM MgCl2) for 1 hour, the result was washed 3 times with 0.1% TBST for 10 minutes. Then, the KRas protein bound with GppNHp and the KRas protein bound with GDP were diluted in 4% TBSB and then bound at a concentration of 100 nM for 1 hour at room temperature, followed by washing three times with 0.1% TBST for 10 minutes. The result was bound to HRP-conjugated anti-his antibody (HRP-conjugated anti-his mAb) as a labeling antibody. The result was reacted with a TMB ELISA solution, and absorbance at 450 nm was quantified.
The above experiment showed that the KRasG12D protein fused with Avi-tag can be used to select the RT11 affinity-improvement library.
The anti-Ras⋅GTP iMab RT11 in the conventional patent (Koran Patent No. 10-1602876) binds highly specifically to Ras⋅GTP and exhibits biological activity in various Ras mutant cell lines, but exhibits a level of affinity of about 12 nM for Ras⋅GTP, which is a lower affinity than the affinity of various antibodies in the IgG format. In addition, anti-Ras⋅GTP iMab RT11, which exhibits biological activity through inhibition of binding between Ras⋅GTP and effector molecules, can enhance biological activity through the improvement of affinity with Ras⋅GTP. Accordingly, the present inventors tried to increase the affinity of anti-Ras⋅GTP iMab RT11 for Ras⋅GTP in addition to modifying (improving) the light-chain variable region to impart tissue specificity thereto in order to increase the therapeutic efficiency of anti-Ras⋅GTP iMab.
The light-chain variable region used during selection of the Ras⋅GTP specific heavy-chain variable region with improved affinity based on RT11 is the hT4-3 light-chain variable region with improved endosomal escape ability, which is obtained by introducing CDR3 in which WYW (Trp-Tyr-Trp) is located at residues 92-94 of the hT4 light-chain variable region (VL) for cytoplasmic penetration used in the conventional patent (Korean Patent No. 10-1602876) and substituting, with phenylalanine (Phe), the residue 87 of the light-chain variable region framework region corresponding to the interface between the light-chain variable region (VL) and heavy-chain variable region (VH) in order to overcome the increased exposure of hydrophobic residues to solvents and thus decreased production yield due to the introduction of WYW (Korean Patent Application No. 10-2016-0065365).
The binding structure between Ras⋅GTP and RT11 antibody was predicted using homology modeling and docking programs, and random mutations were introduced into CDRs and surrounding regions predicted to play an important role in antigen binding based on the prediction result.
Specifically, degenerated codons that may include a suitable amino acid sequence in the predicted binding structure were used for the residues of CDR1 (Nos. 31 to 33) and CDR2 (Nos. 52 to 56). The degenerate codons RNC, THC and KSG were sequentially used for CDR1 (Nos. 31 to 33) and the degenerate codons ASC, MRA, ASC, ASC, CRC and WMC were sequentially used for CDR2 (Nos. 52 to 56). ARG degenerate codons capable of encoding Arg and Lys present in the germline antibody sequence were used because the residue 94 of the CDR3-surrounding framework is a residue at a position that can affect the CDR structure. The residues (Nos. 95 to 97) of CDR3 were spiked oligomers capable of conserving the sequence of RT11 with a 50% probability. This is a technique that can maintain the wild-type amino acid at 50% during the PCR process by designing a primer such that, in each of 3 nucleotides encoding amino acids for each residue, wild-type nucleotides can be maintained at 79%, and the ratio of remaining nucleotides was adjusted to 7%. The CDR3 (No. 100a) residue is an important residue for VH/VL binding, and a WTK degenerate codon, which may include Phe, Ile and Leu present in the germline antibody sequence, including Met of the RT11 antibody was used therefor.
Specifically, hT4-3 VL with improved cytoplasmic penetration ability was used for the light-chain variable region in the affinity improvement library.
Specifically, the designed library-encoding DNA was amplified using a PCR technique and was then concentrated using an ethanol precipitation method. The yeast surface expression vector (C-aga2), which expresses aga2 protein at the c-terminus for homologous recombination, was treated with NheI and MluI restriction enzymes and then purified using agarose gel extraction and concentrated using ethanol precipitation. The 5 μg vector treated with restriction enzymes for 12 μg of each library-encoding DNA was transformed by electroporation into the yeast EBY100 for yeast surface expression (Baek D. S. and Kim Y. S., 2014), and the number of colonies grown in a selective medium, SD-CAA (20 g/L glucose, 6.7 g/L yeast nitrogen base without amino acids, 5.4 g/L Na 2HPO4, 8.6 g/L NaH2PO4, 5 g/L casamino acids) through serial dilution was measured to determine the library size.
The RT11-3-based affinity improvement library constructed in Example 2 was selected using the GppNHp-bound KRasG12D as an antigen.
Specifically, about 100 nM of the purified GppNHp-bound Avi-KRasG12D was reacted with yeast inducing expression of the single-chain Fab (scFab)-type heavy-chain variable region library on the cell surface using an SG-CAA medium (20 g/L galactose, 6.7 g/L yeast nitrogen base without amino acids, 5.4 g/L Na2HPO4, 8.6 g/L NaH2PO4, 5 g/L casamino acids) at room temperature for 1 hour. Then, the yeast expressing the library linked with GppNHp-bound Avi-KRasG12D was reacted with Streptavidin Microbead™ (Miltenyi Biotec) for 20 minutes at 4° C., and then a yeast expressing the heavy-chain variable region having high affinity for the GppNHp-bound Avi-KRasG12D was enriched using MACS (magnetic activated cell sorting). The yeast expressing the selected library was cultured in selective media SD-CAA (20 g/L glucose, 6.7 g/L yeast nitrogen base without amino acids, 5.4 g/L Na2HPO4, 8.6 g/L NaH2PO4, 5 g/L casamino acids) and SG-CAA to induce library expression, the GppNHP-bound Avi-KRasG12D and Avi-KRasG12D antigen bound with GDP undergoing no in-vivo biotinylation for primary FACS screening were competitively reacted at a ratio of 1:10 with the library-expressing yeast for 1 hour at room temperature, reacted with PE-conjugated Streptavidin-R-phycoerythrin (SA-PE, Invitrogen), and suspended through FACS (fluorescence activated cell sorting, FACS Caliber, BD biosciences). Then, secondary FACS screening was performed in the same manner as above at a ratio of 1:100 using 10 nM of the GppNHp-bound Avi-KRasG12D antigen and the Avi-KRasG12D antigen bound with GDP undergoing no in-vivo biotinylation, and tertiary FACS screening was performed in the same manner as above at a ratio of 1:100 using 1 nM of the GppNHp-bound Avi-KRasG12D antigen and the GDP-bound Avi-KRasG12D antigen undergoing no in-vivo biotinylation.
Six unique clones (RT21, RT22, RT23, RT24, RT25, RT26) having high affinity and specificity to the GppNHp-bound Avi-KRasG12D were selected through the analysis of individual clone binding ability as described above.
The following Table 1 shows the heavy-chain variable region sequences of six individual clones that have high binding ability to the selected GppNHp-bound Avi-KRasG12D, and Table 2 shows the CDR sequences of the heavy-chain variable regions of Table 1.
In order to construct the cytoplasmic penetration antibody (cytotransmab) introduced with the mutation in the heavy-chain variable region, a heavy chain including a heavy-chain variable region having improved affinity for Ras⋅GTP and a heavy-chain constant region (CH1-CH2-CH3) based on RT11 were cloned into an animal expression vector, and RGD10 protopeptides having specificity for integrins (Integrin αvβ3 and αvβ5), which are overexpressed in neovascular cells and various tumors, were fused with the N-terminus of the cytoplasmic penetration humanized hT4-3 light-chain using two GGGGS linkers using a genetic engineering technique, and were cloned into an animal expression vector. The RGD10 protopeptide has affinity similar to that of the RGD4C protopeptide, but has only one disulfide bond between two cysteines, and it can be fused using a genetic engineering technique. The heavy-chain expression vector having improved affinity for Ras⋅GTP and the cytoplasmic penetration humanized light-chain expression vector (hT4-i3 LC) fused with the RGD10 protopeptide were simultaneously subjected to transient transfection in HEK293F protein-expressing cells to express an anti-Ras⋅GTP iMab mutation with improved affinity.
Specifically, in order to construct a heavy-chain expression vector for producing an intact immunoglobulin-type cytoplasmic penetration antibody, DNA encoding a heavy-chain including the heavy-chain constant region (CH1-CH2-CH3) and being introduced with the heavy-chain variable mutation having improved affinity based on RT11, which is fused with a DNA encoding a secretion signal peptide at the 5′ end thereof, was cloned into the pcDNA3.4 vector with NotI/HindIII. Proteins were expressed and purified through transient transfection using the heavy-chain expression vector and the light chain of the previous cytoplasmic penetration antibody (Korean Patent Application No. 10-2016-0065365), and yields were compared. HEK293F cells suspended and grown in a serum-free FreeStyle 293 expression medium were transfected with a mixture of plasmids and polyethyleneimine (PEI) in a shake flask. During 200 mL transfection into the shake flask, the HEK293F cells were seeded in 100 ml of medium at a density of 2.0×106 cells/ml and cultured at 120 rpm, 8% CO2, and 37 degrees. In order to produce the antibody, suitable heavy-chain and light-chain plasmids were diluted in a 10 ml FreeStyle 293 expression medium to a total of 250 μg (2.5 μg/ml) including 125 μg of a heavy chain and 125 μg of a light chain and filtered, then mixed with 10 ml of a medium, in which 750 μg (7.5 μg/ml) of PEI was diluted, and reacted at room temperature for 10 minutes. Then, 100 ml of the reacted mixed medium was added to previously seeded cells, and then the cells were cultured at 120 rpm and 8% CO2 for 4 hours, and the remaining 100 ml of FreeStyle 293 expression medium was added thereto, followed by culturing for 6 days. Proteins were purified from the cell culture supernatant collected in accordance with the standard protocol. Antibodies were applied to a Protein A Sepharose column and washed with PBS (pH 7.4). The antibodies were eluted at pH 3.0 using 0.1M glycine and 0.5M NaCl buffer, and then the sample was immediately neutralized with 1M Tris buffer. The eluted antibody fraction was concentrated in a fresh PBS (pH 6.5) buffer exchanged through a dialysis method. The purified protein was quantified using absorbance and absorption coefficient at a wavelength of 280 nm.
Specifically, RT11-i, an anti-Ras⋅GTP iMab, and six affinity-enhanced iMabs fused with RGD protopeptides were bound at a concentration of 5 μg/ml in a 96-well EIA/RIA plate at room temperature for 1 hour. Then, the result was washed with 0.1% TBST (12 mM Tris, pH 7.4, 137 mM NaCl, 2.7 mM KCl, 0.1% Tween20, 5 mM MgCl2) three times for 10 minutes. Then, the result was bound to 4% TBSB (12 mM Tris, pH 7.4, 137 mM NaCl, 2.7 mM KCl, 4% BSA, 10 mM MgCl2) for 1 hour and then washed 3 times with 0.1% TBST for 10 minutes. The GppNHp-bound KRas protein and the GDP-bound KRas protein were diluted in 4% TBSB, bound at various concentrations of 100 nM, 10 nM and 1 nM for 1 hour at room temperature, and washed 3 times with 0.1% TBST for 10 minutes. The result was bound to HRP-conjugated anti-his antibody (HRP-conjugated anti-his mAb) as a labeling antibody. The result was reacted with TMB ELISA solution, and the absorbance at 450 nm was quantified.
ELISA analysis showed that the selected 6 types of anti-Ras⋅GTP iMabs exhibited higher antigen-binding capacity than the conventional RT11-i3.
Specifically, an SW480 cell line was diluted in 0.5 ml of 2×104 cells/well in a 24-well plate, cultured for 12 hours at 37° C. under 5% CO2, and then treated with TMab4-i, RT11-i, and 6 types of 1 μM anti-Ras⋅GTP iMab with improved affinity and then cultured at 37° C. for 12 hours. Then, the medium was removed, the residue was washed with PBS, and proteins attached to the cell surface were removed with a weakly acidic solution (200 mM glycine, 150 mM NaCl pH 2.5). After washing with PBS, 4% paraformaldehyde was added and cells were immobilized at 25 degrees for 10 minutes. After washing with PBS, the cells were cultured in a buffer containing PBS supplemented with 0.1% saponin, 0.1% sodium azide and 1% BSA at 25 degrees for 10 minutes and a hole was formed in the cell membrane. Then, the cells were washed with PBS again and reacted with a buffer containing 2% BSA in addition to PBS for 1 hour at 25 degrees in order to inhibit non-specific binding. Each antibody was stained with an antibody that specifically recognizes human Fc linked with Alexa-488 (green fluorescence). The nuclei were stained (blue fluorescence) using Hoechst33342, and KRas-labeled antibodies were stained (red fluorescence) and then observed with a confocal microscope. All of the anti-Ras⋅GTP iMabs except TMab4-i3 were found to have fluorescence overlapping that of the intracellular Ras.
Among them, the RT22-i3 iMab that exhibits the ability to bind to activated intracellular Ras and the highest binding capacity with Avi-KRasG12D⋅GppNHp during ELISA experiments was subjected to SPR (surface plasmon resonance) analysis using a Biacore2000 instrument to more quantitatively analyze the binding ability thereof to GppNHp-bound KRasG12D.
Specifically, RT22-i3 was diluted to a concentration of 20 μl/ml in 10 mM NaAc buffer (pH 4.0) and immobilized at approximately 1800 response units (RU) on a CM5 sensor chip (GE Healthcare). Subsequently, Tris buffer (20 mM Tris-HCl, pH 7.4, 137 mM NaCl, 5 mM MgCl2, 0.01% Tween 20) was analyzed at a flow rate of 30 μl/min, and GppNHp-bound GST-KRasG12D complete antibody was analyzed at a concentration of 50 nM to 3.125 nM. After binding and dissociation analysis, regeneration of the CM5 chip was performed by flowing a buffer (20 mM NaOH, 1M NaCl, pH10.0) at a flow rate of 30 μl/min for 1 minute. Each sensorgram, obtained by binding for 3 minutes and dissociation for 3 minutes, was normalized with reference to a blank cell and subtracted, and the affinity was thus calculated.
The following Table 3 shows the results of affinity analysis of anti-Ras⋅GTP iMab RT11-i and RT22-i3 for complete-form GppNHp-bound GST-KRasG12D using SPR (BIACORE 2000).
The anti-Ras⋅GTP iMab (RT22-i3) including a heavy-chain variable region (RT22 VH) with improved binding ability to Ras⋅GTP has high affinity of about 1.4 nM. However, it was selected through combination with the light-chain variable region (hT4-3 VL), which maintains binding to the cell membrane receptor, HSPG. Since HSPG is expressed in most tissues, a light-chain variable region in which germline antibody sequences were introduced into CDR1 and CDR2 was constructed, and the anti-Ras⋅GTP iMab constructed using the light-chain variable region was found to have a serious decrease in production yield during fusion of RGD protopeptides. Accordingly, the CDR of the heavy-chain variable region (VH) combined with the light-chain variable region having tissue specificity was modified to overcome the problems of reduced affinity and production yield.
A description of the light-chain variable region having reduced HSPG binding and tissue specificity is given in detail below.
To improve the affinity, 3D structural models were analyzed using Galaxy modeling, and mutations were imparted to CDR2 (Nos. 55 to 58) and CDR3 (Nos. 95, 97, and 100a), considered to have a significant effect on antigen binding, based on the analysis result.
Specifically, a degeneration codon (VRC) was used for the residue 55 of CDR2 so that the residue amino acid sequence could be maintained at a probability of 16.67% and a hydrophilic or negatively charged amino acid could be located thereat, and a degeneration codon (MYT) was used for residue 57 of CDR3 so that the affinity with the antigen could be increased in consideration of the size and direction of the side chain while maintaining the conventional amino acid sequence with a 25% probability. A degeneration codon (VST) was used for residue 95 of CDR3 so that the binding ability to Ras⋅GTP could be maintained or improved in consideration of the size and direction of the side chain while maintaining the conventional amino acid sequence with a 16.67% probability, and a degeneration codon (WTK) was used for residue 100a so that a hydrophobic amino acid could be located thereat. The same spiked oligomer as in Example 2 was used for residues 56 and 58 of CDR2 and residue 97 of CDR3. This is a mutation method in which all amino acids can be applied while preserving the conventional wild-type RT22 VH sequence at 50% probability, and is a technique that can maintain the wild-type amino acid at 50% during the PCR process by designing a primer such that, in each of 3 nucleotides encoding amino acids, the wild-type nucleotide can be maintained at 79%, and the ratio of remaining nucleotides is adjusted to 7%.
Specifically, a yeast expressing the initial RT22-based library on the surface thereof was mated with a yeast secreting the cytoplasmic penetration light chain (hT4-33 VL) from which HSPG-binding ability was removed and the resulting product was expressed in the form of Fab on the yeast surface.
Specifically, in order to construct the yeast secreting the cytoplasmic penetration light chain (hT4-33 VL) to be conjugated with the heavy-chain variable region (VH) library, pYDS-K-hT4-33 VL, obtained by cloning the DNA encoding hT4-33 VL having cytoplasmic penetration ability and reduced HSPG binding ability into the light-chain variable region yeast secretion vector, pYDS-K using restriction enzymes NheI and BsiWI, was transformed by electroporation into the YVH10 strain, which is a mating-α-type yeast-mating strain, and was mated with a yeast selectively cultured in a selective medium SD-CAA+Trp (20 g/L glucose, 6.7 g/L yeast nitrogen base without amino acids, 5.4 g/L Na 2HPO4, 8.6 g/L NaH 2PO4, 5 g/L casamino acids, 0.4 mg/L tryptophan) (SIGMA).
Specifically, in the case of yeast mating, when absorbance at 600 nm of 1 indicates 1×107 yeast individuals. Among cultured yeast, yeast expressing the heavy-chain variable region library based on RT22 and yeast containing hT4-33 VL were mixed in amounts of 1.5×107 individuals and washed three times with YPD (20 g/L dextrose, 20 g/L peptone, 10 g/L yeast extract, 14.7 g/L sodium citrate, 4.29 g/L citric acid, pH 4.5) (SIGMA), and then resuspended with 100 μl of YPD and dropped while preventing the same from spreading over the YPD plate, dried and cultured at 30 degrees for 6 hours. Then, the dried spreading yeast site was washed three times with YPD medium and cultured at 30° C. for 24 hours in a selective medium SD-CAA to a final yeast concentration of 1×106 or less, and only the mated yeast was selected.
GppNHp, a GTP analogue, was bound to the in-vivo biotinylated Avi-KRasG12D protein in the same manner as in Example 1, and was used for library selection. For the primary MACS selection, about 100 nM of the antigen was reacted with the Fab library expressed on the yeast surface at room temperature for 1 hour. Then, the yeast expressing the Fab library bound with the antigen was reacted with Streptavidin Microbead™ at 4 degrees for 20 minutes, and then the yeast expressing the heavy-chain variable region having high affinity to GppNHp-bound Avi-KRasG12D was enriched using magnetic activated cell sorting (MACS). The selected library-expressing yeast was cultured in selective media SD-CAA+URA (20 g/L D-glucose, 6.7 g/L yeast nitrogen base without amino acids, 5.4 g/L Na2HPO4, 8.6 g/L NaH2PO4, 5 g/L casamino acids, 0.2 mg/L uracil) and SG-CAA+URA (20 g/L Galactose, 6.7 g/L yeast nitrogen base without amino acids, 5.4 g/L Na2HPO4, 8.6 g/L NaH2PO4, 5 g/L casamino acids, 0.2 mg/L Uracil) to induce library expression and primary to tertiary FACS selection was performed.
As a result of analyzing 47 individual clones of the final primary MACS and tertiary FACS selected libraries in the same manner as in Example 3, seven heavy-chain variable regions having unique amino acid sequences having high affinity for the GppNHp-bound Avi-KRasG12D protein were selected.
The following Table 4 shows seven heavy-chain variable-region (VH) sequences having unique amino acid sequences of the individual clones selected from the affinity improvement library based on RT22 as a template.
The following Table 5 shows the sequences of CDRs 1, 2 and 3 of the selected heavy-chain variable regions (VH).
The heavy-chain variable region selected from the RT22-based library was cloned into a heavy-chain animal expression vector in the same manner as in Example 4, subjected to transient co-transfection into the cytoplasm-penetrating humanized light chain expression vector and the HEK293F protein-expressing cell to express separate clones, and purified in the same manner as in Example 4. Among the seven heavy-chain variable regions with improved affinity, RT32 and RT35 clones were excluded from expression purification because they included the cysteine in the CDR2 sequence and thus could not be present as a monomer (alone), and had the potential to form a dimer or oligomer through an unnatural disulfide bond when purified with IgG.
The RT22-based affinity-enhanced heavy-chain variable region was expressed in combination with a light-chain variable region (hT4-i33 VL: SEQ ID NO: 38) fused with RGD protopeptide that has an inhibitory activity of HSPG binding ability and endosome escape ability through introduction of a WYW mutation in CDR3. The description of the light-chain variable region (hT4-i33 VL) having reduced binding affinity to HSPG, SEQ ID NO: 38 and tissue specificity will be described in detail below.
As a result of expression, anti-Ras⋅GTP iMabs having improved affinity similar to RT22-i33, used as a template, also showed a low production yield of 1 mg/L, as in Example 3.
Specifically, a molecular weight of about 150 kDa was detected under non-reducing conditions, and the molecular weight of the heavy chain and the molecular weight of the light chain were found to be 50 kDa and 25 kDa, respectively, under reducing conditions. This indicated that the expressed and purified individual clones were present as monomers (alone) in the solution, and did not form dimmers or oligomers through unnatural disulfide bonds.
Specifically, in the same manner as in Example 4, the anti-Ras⋅GTP iMab, RT11 and RT22-i33, used as a library template, were used as a control group, and five affinity-enhanced iMabs fused with RGD protopeptides were bound at a concentration of 5 μg/ml in a 96-well EIA/RIA plate at room temperature for 1 hour and washed three times with 0.1% TBST (12 mM Tris, pH 7.4, 137 mM NaCl, 2.7 mM KCl, 0.1% Tween20, 5 mM MgCl2) for 10 minutes. Then, the result was bound in 4% TBSB (12 mM Tris, pH 7.4, 137 mM NaCl, 2.7 mM KCl, 4% BSA, 10 mM MgCl2) for 1 hour and then washed 3 times with 0.1% TBST for 10 minutes. The GppNHp-bound KRas protein was diluted to various concentrations of 100 nM, 10 nM, and 1 nM, and the GDP-bound KRas protein was diluted in 4% TBSB to a concentration of 100 nM, bound for 1 hour at room temperature, and washed 3 times with 0.1% TBST for 10 minutes. The result was bound to an HRP-conjugated anti-his antibody (HRP-conjugated anti-his mAb) as a labeling antibody. The result was reacted with a TMB ELISA solution, and the absorbance at 450 nm was quantified.
Specifically, in the same manner as in Example 4, the anti-Ras⋅GTP iMab, RT11 and RT22-i33, used as a library template, were used as a control group, and five affinity-enhanced iMabs fused with RGD protopeptides were bound at a concentration of 5 μg/ml in a 96-well EIA/RIA plate at room temperature for 1 hour and washed three times with 0.1% TBST (12 mM Tris, pH 7.4, 137 mM NaCl, 2.7 mM KCl, 0.1% Tween20, 5 mM MgCl2) for 10 minutes. Then, the result was bound in 4% TBSB (12 mM Tris, pH 7.4, 137 mM NaCl, 2.7 mM KCl, 4% BSA, 10 mM MgCl2) for 1 hour and then washed 3 times with 0.1% TBST for 10 minutes. The GppNHp-bound KRas protein was diluted to various concentrations of 100 nM, 10 nM and 1 nM, and the GDP-bound KRas protein was diluted to a concentration of 100 nM in 4% TBSB, bound for 1 hour at room temperature, and washed 3 times with 0.1% TBST for 10 minutes. The result was bound to an HRP-conjugated anti-his antibody (HRP-conjugated anti-his mAb) as a labeling antibody. The result was reacted with TMB ELISA solution, and the absorbance at 450 nm was quantified.
In addition, ELISA analysis was performed using a BIACORE2000 instrument to determine the quantitative affinity for GppNHp-bound KRasG12D, of the affinity-improved anti-Ras⋅GTP iMabs having higher antigen-binding ability than RT22-i33.
Specifically, in the same manner as in Example 4, RT22-i33 was used as a control group, and RT31-i33, RT34-i33 and RT36-i33 were diluted in 10 mM Na-acetate buffer (pH 4.0) and immobilized in an amount of approximately 1600 response units (RU) on a CM5 sensor chip (GE Healthcare). Subsequently, Tris buffer (20 mM Tris-HCl, pH 8.0, 100 mM NaCl, 5 mM MgCl2, 0.01% Tween 20) was analyzed at a flow rate of 30 μl/min, and GppNHp-bound KRasG12D was analyzed at a concentration of 100 nM to 6.25 nM. After binding and dissociation analysis, regeneration of the CM5 chip was performed by flowing a buffer (20 mM NaOH, 1M NaCl, pH 10.0) at a flow rate of 30 μl/min for 1.5 minutes. Each sensorgram, obtained by binding for 3 minutes and dissociation for 3 minutes, was normalized with reference to a blank cell and subtracted and the affinity was thus calculated.
The following Table 6 shows the result of affinity analysis of anti-Ras⋅GTP iMab having improved affinity for GppNHp-bound KRasG12D using SPR (BIACORE 2000).
The results showed that all of RT31-i33, RT34-i33, and RT36-i33, which are anti-Ras⋅GTP iMabs with improved affinity based on RT22 VH, have higher affinity than the conventional RT22-i33.
The results showed that the cytoplasm-penetrating anti-RasGTP iMab of the prior patents (Korean Patent Nos. 10-1602870 and 10-1602876) was constructed by substituting the heavy-chain variable region of the conventional cytoplasmic penetration antibody (cytotransmab), having cytoplasmic penetration ability, with the heavy-chain variable region (VH) having binding ability highly specific to Ras⋅GTP. The cytoplasmic penetration antibody (cytotransmab) is an antibody capable of penetrating into the cytoplasm based on the light-chain variable region (VL), and cell penetration is initiated through binding with heparan sulfate proteoglycan (HSPG) on the cell surface. However, HSPG is a cell-surface protein that is highly expressed in normal cells as well, and thus HSPG-binding ability thereof needs to be suppressed in order to modify the protein to be capable of penetrating specifically into the cytoplasm of tumor tissue cells.
Therefore, the present inventors found that CDR1 and CDR2, in hT4 VL of the light-chain variable region (VL) of the cytoplasmic penetration antibody (cytotransmab), which are expected to contribute to HSPG binding, were substituted with CDR sequences that have amino acid sequences having the same number of amino acids in the human germline sequence and not including a cationic patch sequence of CDR1, which is responsible for endocytosis. At this time, amino acids known to be important for the stability of the conventional light-chain variable region were preserved.
The light-chain variable region developed based on this logic is hT4-03 (Korean Patent Application No. 10-2016-0065365).
In order to further improve the endosome escape ability of this light-chain variable region, CDR3 in where WYW (Trp-Tyr-Trp) is located was introduced into residues 92-94 of the light-chain variable region (VL) (Koran Patent Application No. 10-2016-0065365), and residue 87 of the light-chain variable region framework region corresponding to the interface between the light-chain variable region (VL) and the heavy-chain variable region (VH) was substituted with phenylalanine (Phe) in order to overcome the increased exposure of hydrophobic residues to solvents and thus decreased production yield due to the introduction of WYW (Korean Patent Application No. 10-2016-0065365).
This was designated as “hT4-33 light-chain variable region” (VL).
The following Table 7 shows the sequence and name of the light-chain variable region (hT4-33 VL) having improved cytoplasmic penetration specific for tumor tissue cells and endosome escape ability constructed using an overlapping PCR technique.
RT11, which is an anti-Ras⋅GTP iMab using hT4 VL, enters cells and binds to Ras⋅GTP in the cells to exhibit tumor growth inhibitory ability, but has the disadvantage of low tumor-tissue specificity due to the HSPG-binding ability thereof. In order to overcome this disadvantage, the light chain having reduced HSPG-binding capacity was obtained through Example 8 above and experiments were conducted using an iMab form introduced with a light-chain variable region fused at the N-terminal thereof with RGD10 protopeptides for targeting integrin receptors as in Examples above.
Additionally, various protopeptides to impart tumor-tissue specificity were selected in addition to the integrin-targeting protopeptides.
The EpCAM (epithelial cell adhesion molecule) receptor is a receptor that is mainly overexpressed in colorectal cancer cells, and is a target located on a suitable cell membrane for imparting tumor specificity to anti-Ras⋅GTP iMab. Accordingly, a light-chain variable region including an Ep133 protopeptide (EHLHCLGSLCWP) capable of targeting the EpCAM receptor (U.S. patent application Ser. No. 14/428,017) fused with the N-terminus thereof was constructed.
The following Table 8 shows the sequences and names of protopeptides for targeting tumor-tissue-specific cell surface proteins and inducing endocytosis.
Specifically, for expression in animal cells of iMab fused with protopeptides, protopeptides were genetically fused to the N-terminus of hT4-33, the light-chain variable region (VL) using two G4S linkers. Subsequently, a DNA encoding a light chain including the protopeptide-fused hT4-light-chain variable region and a light-chain constant region (CL) was cloned with NotI/BsiWI into a pcDNA3.4 vector fused with a DNA encoding a secretory signal peptide at the 5′ end thereof.
The heavy-chain variable region (RT22 VH) having specific binding ability to GTP-bound Ras and the cytoplasmic penetration humanized light chain expression vector were subjected to transient co-transfection into the HEK293F-protein-expressing cells to express individual clones in the same manner as in Example 4, and were purified in the same manner as in Example 4.
The following Table 9 shows the production yield of cytotransmab and anti-Ras⋅GTP iMab including a light-chain variable region (VL) fused with a tumor-tissue-specific protopeptide using a genetic-engineering technique.
aThe 2 plasmids that encode the HC and LC of each IgG antibody were co-transfected with the equivalent molar ratio into HEK293F cells in 1 L of culture media. After 6 d of culture, antibodies were purified from the cell culture supernatant using a protein-A affinity column.
It was found that the production yield of the anti-RasGTP iMab fused with integrin- or EpCAM-targeting protopeptide was significantly low, that is, 1 mg/l L.
Specifically, SW480 cells were prepared in the same manner as in Example 4, treated with RT22-33 1 μM, RT22-i33 MG 0.5 μM, RT22-ep33 MG 1 μM, CT-33 1 μM, CT-i33 MG 0.5 μM, and CT-ep33 MG 1 μM, and then cultured at 37° C. for 12 hours. Then, the cells were stained under the same conditions as in Example 4 and observed with a confocal microscope. RT22-i33 MG and RT22-ep33 MG, except for RT22-33, which does not undergo endocytosis, were found to have fluorescence overlapping that of intracellular Ras. In addition, CT-33, CT-i33 MG and CT-ep33 MG, not targeting intracellular Ras, were found to have no fluorescence overlapping that of intracellular Ras.
Like the results of analysis of Example 10, it was found that the production yield did not decrease upon fusion of the protopeptide with the conventional light-chain variable region (hT4-3 VL) having HSPG-binding ability, but the production yield decreased upon fusion with the light-chain variable region (hT4-33 VL) having reduced HSPG-binding ability. In addition, CDR1 and CDR2 of the light-chain variable region (VL), which greatly affects HSPG-binding ability, were modified to improve production yield upon fusion with protopeptides recognizing specifically for tumor tissues (RGD10, Ep133).
Specifically, in order to maintain low binding capacity to HSPG, a mutation was formed in common by substituting the phenylalanine, residue 27c, which is considered to affect the formation of the loop structure of CDR1 of the light-chain variable region of hT4 VL, with leucine, preserved in the light-chain variable region having reduced HSPG-binding capacity, and mutations were formed in residues 27f to 30, which are considered to be located at the tip of the CDR1 loop structure due to the canonical structure and thus to be exposed to the side chain.
Specifically, in the case of hT4-34 VL, a point mutation was formed only in the residue 27c, which is considered to affect the formation of the loop structure of CDR1, among CDR1 and CDR2 of the light-chain variable region, using hT4 VL as a template.
Specifically, hT4-35 VL, hT4-36 VL and hT4-37 VL were mutated according to each strategy using hT4-33 VL having greatly reduced HSPG-binding ability as a template. The hT4-35 VL was designed by respectively mutating the aspartate at residues 27d and 27f of CDR1 to asparagine and arginine, preserved in hT4 VL. The hT4-36 VL was designed by respectively mutating aspartate and glycine at residues 27d and 29 of CDR1 to asparagine and arginine, and hT4-37 VL was designed by respectively mutating aspartate and asparagine at residues 27d and 30 of CDR1 to asparagine and lysine. The residue numbers followed the Kabat number.
Specifically, hT4-38 VL was designed by mutating arginine at residue 29 to glycine present in the sequence of hT4-33 VL and mutating asparagine at residue 31 to threonine present in the sequence of hT4-33 VL, while preserving arginine at residue 27f and lysine at residue 30, which had increased yield when maintaining the sequence of hT4 VL in order to minimize HSPG-binding capacity. Like hT4-38 VL, hT4-39 VL was designed by mutating threonine at residue 28 to aspartate and mutating arginine at residue 29 to glycine while preserving arginine at residue 27f and lysine at residue 30 in order to minimize HSPG-binding capacity using the sequence preserved in hT4-33 VL.
The following Table 10 shows the sequence of a light-chain variable region (VL) having a mutation for increasing production yield upon tumor-tissue-cell-specific cytoplasmic penetration and protopeptide fusion.
The decrease degree in HSPG-binding ability of anti-Ras⋅GTP iMab introduced with mutants of CDR1 and CDR2 of a light-chain variable region (VL) for improving production yield and inhibiting HSPG-binding ability constructed in Example 12 above, compared to cytotransmab (TMab4) using a conventional hT4 light-chain, was observed using a confocal microscope and cell-based ELISA.
Specifically, the HeLa cell line expressing HSPG was seeded at 5×104 cells/well in a 24-well plate in 0.5 ml of a medium containing 10% FBS and cultured at 5% CO2 and 37 degrees for 12 hours. When the cells were stabilized, PBS, TMab4, RT22-33, RT22-34, RT22-35, RT22-36, RT22-37, RT22-38, RT22-39, CT-33, CT-38 and CT-39 were cultured at 1 μM at 37 degrees for 6 hours. After washing with PBS and a weakly acidic solution in the same manner as in Example 4, the cells were immobilized, perforated and then blocked. Each antibody was stained with an antibody that specifically recognizes human Fc conjugated with Alexa488 (green fluorescence). Then, the nuclei were stained (blue fluorescence) using Hoechst33342 and observed under a confocal microscope.
The results showed that anti-RasGTP iMabs located in the cytoplasm through HSPG exhibited decreasing fluorescence intensity in the order of TMab4 (100%), RT22-34 (40%), RT22-36 (25%), RT22-38 (26%), RT22-39 (19%), RT22-37 (15.5%), RT22-(12.4%), and RT22-33 (6.8%).
Specifically, the HeLa (HSPG+) cell line was cultured in a 96-well plate such that the cells completely filled the bottom of the well, and was then washed three times with a washing buffer (HBSS buffer, 50 mM HEPES). Then, TMab4, RT22-33, RT22-34, RT22-35, RT22-36, RT22-37, RT22-38, RT22-39, CT-33, CT-38 and CT-39 were diluted to concentrations of 100, 50, 25, 12.5, 6.25, 3.125 ng/ml in a blocking buffer (HBSS buffer, 50 mM HEPES, 1% BSA) and cultured for 2 hours at 4° C. After washing three times with a washing buffer, the cells were linked to an HRP-conjugated anti-human mAb as a labeling antibody. The cells were reacted with TMB ELISA solution, and the absorbance at 450 nm was quantified.
With the same behavior as in
Specifically, 1×105 HeLa (HSPG+) cells were prepared for each sample. The cells were cultured in PBSF (PBS buffer, 2% BSA) supplemented with 500 nM of TMab4, RT22-33, RT22-34, RT22-35, RT22-36, RT22-37, RT22-38, and RT22-39 for 1 hour at 4° C. Then, each antibody was reacted with an antibody specifically recognizing human Fc conjugated to Alexa488 (green fluorescence) for 30 minutes at 4° C. The resulting product was washed with PBS and analyzed using flow cytometry. The result showed that fluorescence intensity binding to the cells was measured in the order of TMab4, RT22-34, RT22-38, RT22-36, RT22-39, RT22-37, RT22-35 and RT22-33, in the same behavior as in the confocal microscopy results.
Anti-Ras⋅GTP iMab using the hT4-34 light chain having a remaining HSPG-binding capacity of 40%, which was found based on the result, was not used in subsequent biochemical identification experiments.
RGD or Ep133 protopeptides were fused to the light-chain variable regions (VL) introduced with mutants for providing tumor-tissue-cell-specific cytoplasmic penetration and improving production yield to conduct cloning upon fusion with protopeptides using a Mg linker using a genetic-engineering technique in the same manner as in Example 10.
The following Table 11 shows the sequence of the light-chain variable regions (VL) having improved production yield and tumor-tissue-cell-specific cytoplasmic penetration ability and being fused with an integrin-targeting protopeptide.
The following Table 12 shows the sequences of the light-chain variable regions (VL) having a mutation for improving production yield and inhibiting HSPG-binding ability, and fused with EpCAM-targeting protopeptide.
A RT22 heavy-chain animal expression vector and a light-chain expression vector including a light-chain variable region having CDR1 and CDR2 mutations fused with integrin-targeting protopeptide for providing tumor-tissue specificity and improving production yield, were subjected to transient co-transfection into HEK293F-protein-expressing cells in the same manner as in Example 4, and then the process of purifying the antibody was conducted in the same manner as in Example 4.
In addition, the quantitative affinity for GppNHp-bound KRasG12D of the anti-Ras⋅GTP iMabs introduced with CDR1 and CDR2 mutations in the light-chain variable region (VL) for improving production yield and inhibiting HSPG-binding ability was analyzed using a BIACORE2000 instrument.
Specifically, RT22-i35 MG, RT22-i37 MG, RT22-i38 MG, RT22-i39 MG, RT22-ep37 MG, RT22-ep38 MG and RT22-ep39 MG were diluted to a concentration of 20 μl/ml in 10 mM NaAc buffer (pH 4.0) and immobilized at approximately 1800 response units (RU) on a CM5 sensor chip (GE Healthcare). Subsequently, Tris buffer (20 mM Tris-HCl, pH 7.4, 137 mM NaCl, 5 mM MgCl2, 0.01% Tween 20) was analyzed at a flow rate of 30 μl/min, and complete GppNHp-bound GST-KRasG12D was analyzed at a concentration of 50 nM to 3.125 nM. After binding and dissociation analysis, regeneration of the CM5 chip was performed by flowing a buffer (20 mM NaOH, 1M NaCl, pH 10.0) at a flow rate of 30 μl/min for 1 minute. Each sensorgram, obtained by binding for 3 minutes and dissociation for 3 minutes, was normalized with reference to a blank cell and subtracted, and the affinity was thus calculated.
The following Table 13 shows the production yield of the anti-RasGTP iMabs obtained by expressing an RT22 heavy chain in combination with hT4-i33 and hT4-ep33, and light chains (hT4-i34 MG to hT4-i39 MG and hT4-ep34 MG to hT4-ep39) introduced with mutations of CDR1 and CDR2 to improve production yield and inhibit HSPG-binding capacity, and of the cytotransmabs obtained by expressing a TMab4 heavy chain in combination with the light chains, and the result of analysis of the affinity of tumor-tissue-specific anti-Ras⋅GTP iMab based on SPR using a BIACORE2000 instrument.
aThe 2 plasmids that encode the HC and LC of each IgG antibody were co-transfected with the equivalent molar ratio into HEK293F cells in 1 L of culture media. After 6 d of culture, antibodies were purified from the cell culture supernatant using a protein-A affinity column.
bND, not determined
It was found that the affinity for GppNHp-bound KRasG12D of tumor-tissue-specific anti-Ras⋅GTP iMabs introduced with mutants of light-chain variable region (VL) CDR1 and CDR2 to improve production yield was not changed.
The anti-Ras⋅GTP iMab using the hT4-36 light chain, which did not increase the production yield, found through the above results, was not used in subsequent biochemical identification experiments.
Specifically, in order to compare the antigen-binding ability of the CDR1 and CDR2 mutant light chains, the heavy-chain variable region binding to GppNHp is fixed at RT22 VH, and analysis was conducted on RT11, RT22-i33 MG, RT22-i34 MG, RT22-i35 MG, RT22-i36 MG and RT22-i37 MG.
Specifically, ELISA was conducted in the same manner as Example 4, and tumor-tissue-specific anti-Ras⋅GTP iMabs introduced with mutants of CDR1 and CDR2 were fixed on a 96-well EIA/RIA plate, after which the GppNHp-bound KRas protein was bound at various concentrations of 100 nM, 10 nM and 1 nM and the GDP-bound KRas protein was bound at a concentration of 100 nM and was then bound to an HRP-conjugated anti-his antibody (HRP-conjugated anti-his mAb) as a labeling antibody. The result was reacted with TMB ELISA solution, and the absorbance at 450 nm was quantified.
The result of analysis of the antigen-binding ability by ELISA showed that, compared to the conventional RT22-i33, hT4-i34 VL, maintaining the cation patch of CDR1, had improved binding capacity to the GppNHp-bound KRasG12D antigen due to the light chain, while the heavy chain was the same as in the conventional case.
Specifically, ELISA was conducted in the same manner as Example 4, and cytotransmabs and tumor-tissue-specific anti-Ras⋅GTP iMabs introduced with mutants of CDR1 and CDR2 were fixed on a 96-well EIA/RIA plate, after which the GppNHp-bound KRas protein was bound at various concentrations of 100 nM, 10 nM and 1 nM and the GDP-bound KRas protein was bound at a concentration of 100 nM and then was bound to an HRP-conjugated anti-his antibody (HRP-conjugated anti-his mAb) as a labeling antibody. The result was reacted with TMB ELISA solution, and the absorbance at 450 nm was quantified.
The result of analysis of the antigen-binding ability by ELISA showed that, compared to the conventional RT11-i, hT4-38 and hT4-39 light-chain variable regions improved binding capacity to the GppNHp-bound KRasG12D antigen.
Specifically, SW480 cells were prepared in the same manner as in Example 4, and were treated with 1 μM CT-i33 MG (=TMab4-i33 MG), CT-i38 MG, CT-i39 MG, RT22-i33 MG, RT22-i34 MG, RT22-i35 MG, RT22-i36 MG, RT22-i37 MG, RT22-i38 MG, RT22-i39 MG, CT-ep33 MG, CT-ep38 MG, CT-ep39 MG, RT22-ep38 MG and RT22-ep39 MG, and then cultured for 12 hours at 37° C. under 5% CO2. Then, the cells were stained under the same conditions as in Example 4 and observed with a confocal microscope. RT22-i33 MG, RT22-i34 MG, RT22-i35 MG, RT22-i36 MG, RT22-i37 MG, RT22-i38 MG, RT22-i39 MG, RT22-ep38 MG, and RT22-ep39 MG, excluding CT-i33 MG, CT-i38 MG, CT-i39 MG, CT-ep33 MG, CT-ep38 MG and CT-ep39 MG, were found to have fluorescence overlapping that of the intercellular Ras.
The light-chain variable region (VL) CDR1 mutants constructed in Example 12 increased yield when fused with the protopeptide for providing tumor-tissue specificity compared to the conventional hT4-33, but antibodies (RT22-ep38 MG, RT22-ep39 MG) fused with the Ep133 protopeptide, showing the best production yield, exhibited production yields that were approximately 2 times lower than antibodies fused with RGD10 protopeptides (RT22-i38 MG, RT22-i39 MG). Therefore, in order to further increase the stability and yield of the antibody fused with the Ep133 protopeptide, an additional mutant of the light-chain variable region (VL) antibody framework was constructed.
Specifically, most of sequences 2 and 3 of the antibody skeleton in the light chain used in the human complete IgG-type antibody include isoleucine and glutamine, present in human germline sequences, but the sequences 2 and 3 are preserved as leucine and valine in the light chain used in Anti-Ras⋅GTP iMab. Thus, a light-chain variable region (VL) antibody framework mutant was constructed by mutating these sequences 2 and 3 to isoleucine and glutamine, which are mainly present in human complete-IgG type antibodies, in order to increase the stability and yield.
The following Table 14 shows sequence information of a light-chain variable region (VL) having a modified antibody skeleton to improve the production yield based on hT4-38 and hT4-39 and a light-chain variable region (VL) fused with EpCAM-targeting protopeptide and having a modified antibody skeleton to improve the production yield.
A RT22 heavy-chain animal expression vector and a light-chain expression vector including a light-chain variable region fused with EpCAM-targeting protopeptide for providing tumor-tissue specificity, and having a modified antibody framework to improve the production yield, were subjected to transient co-transfection into HEK293F-protein-expressing cells in the same manner as in Example 10, and then the process of purifying the antibody was conducted in the same manner as in Example 4.
Then, the quantitative affinity for GppNHp-bound KRasG12D of the tissue-cell-specific anti-Ras⋅GTP iMab introduced with the light-chain variable region (VL) having a modified antibody framework to improve production yield was analyzed using a BIACORE2000 instrument.
Specifically, RT22-ep58 MG and RT22-ep59 MG were diluted to a concentration of 20 μl/ml in 10 mM NaAc buffer (pH 4.0) and immobilized at approximately 1800 response units (RU) on a CM5 sensor chip (GE Healthcare). Subsequently, Tris buffer (20 mM Tris-HCl, pH 7.4, 137 mM NaCl, 5 mM MgCl2, 0.01% Tween 20) was analyzed at a flow rate of 30 μl/min, and complete GppNHp-bound GST-KRasG12D was analyzed at a concentration of 50 nM to 3.125 nM. After binding and dissociation analysis, regeneration of the CM5 chip was performed by flowing a buffer (20 mM NaOH, 1M NaCl, pH 10.0) at a flow rate of 30 μl/min for 1 minute. Each sensorgram, obtained by binding for 3 minutes and dissociation for 3 minutes, was normalized with reference to a blank cell and subtracted, and the affinity was thus calculated.
The following Table 15 shows the production yield of the anti-RasGTP iMab obtained by expressing an RT22 heavy chain in combination with light chains (hT4-ep58 MG and hT4-ep59 MG) fused with EpCAM-targeting protopeptide for providing tumor-tissue specificity and introduced with an antibody framework mutation to improve the production yield, and of the cytotransmabs obtained by expressing a TMab4 heavy chain in combination with the light chains, and the result of analysis of the affinity of tumor-tissue-specific anti-Ras⋅GTP iMab based on SPR using a BIACORE2000 instrument.
aThe 2 plasmids that encode the HC and LC of each IgG antibody were co-transfected with the equivalent molar ratio into HEK293F cells in 1 L of culture media. After 6 d of culture, antibodies were purified from the cell culture supernatant using a protein-A affinity column.
It was found that the affinity for GppNHp-bound KRasG12D of the anti-Ras⋅GTP iMab was not changed compared to RT22-ep38 MG and RT22-ep59 MG, tumor-tissue-specific anti-Ras⋅GTP iMabs introduced with mutants of light-chain variable region (VL) CDR1 and CDR2 to improve production yield.
Specifically, ELISA was conducted in the same manner as in Example 4, and tumor-tissue-specific anti-Ras⋅GTP iMabs having light chains introduced with mutants of CDR1 and CDR2 were fixed on a 96-well EIA/RIA plate, after which the GppNHp-bound KRas protein was bound at various concentrations of 100 nM, 10 nM and 1 nM, and the GDP-bound KRas protein was bound at a concentration of 100 nM and was then bound to an HRP-conjugated anti-his antibody (HRP-conjugated anti-his mAb) as a labeling antibody. The result was reacted with TMB ELISA solution, and the absorbance at 450 nm was quantified.
The result of analysis on the antigen-binding ability by ELISA showed that, compared to the conventional RT11-i, hT4-58 and hT4-59 light-chain variable regions improved binding capacity to the GppNHp-bound KRasG12D antigen.
Specifically, an SW480 cell line was diluted in 0.5 ml at 2×104 cells/well in a 24-well plate, cultured for 12 hours at 37° C. under 5% CO2, and then treated with 1 μM of CT-ep58 MG and anti-Ras⋅GTP iMabs, RT22-ep58 MG and RT22-ep59 MG with improved affinity and then cultured at 37° C. for 12 hours. Then, the medium was removed, the residue was washed with PBS, and proteins attached to the cell surface were removed with a weakly acidic solution (200 mM glycine, 150 mM NaCl pH 2.5). After washing with PBS, 4% paraformaldehyde was added, and cells were immobilized at 25 degrees for 10 minutes. After washing with PBS, the cells were cultured in a buffer containing PBS supplemented with 0.1% saponin, 0.1% sodium azide and 1% BSA at 25° C. for 10 minutes, and a hole was formed in the cell membrane. Then, the cells were washed with PBS again and reacted with a buffer containing 2% BSA in addition to PBS for 1 hour at 25° C. in order to inhibit non-specific binding. Each antibody was stained with an antibody that specifically recognizes human Fc linked with Alexa-488 (green fluorescence). The nuclei were stained (blue fluorescence) using Hoechst33342, and KRas-labeled antibodies were stained (red fluorescence) and then observed with a confocal microscope. All of the anti-Ras⋅GTP iMabs excluding CT-ep59 were found to have fluorescence overlapping that of the intracellular Ras.
The decrease level in HSPG-binding ability of cytotransmabs and the anti-Ras⋅GTP iMabs introduced with light-chain variable-region (VL) mutants having a modified antibody framework to improve production yield constructed in Example 17 above, compared to cytotransmab (TMab4) using the conventional hT4 light-chain, was observed using a confocal microscope and cell-based ELISA.
Specifically, the HeLa cell line expressing HSPG was seeded at 5×104 cells/well in a 24-well plate in 0.5 ml of a medium containing 10% FBS and cultured at 5% CO2 and 37° C. for 12 hours. When the cells were stabilized, PBS, TMab4, Avastin, RT22-58, RT22-59, CT-58 and CT-59 were cultured at 1 μM at 37° C. for 6 hours. After washing with PBS and a weakly acidic solution in the same manner as in Example 4, the cells were immobilized, perforated and then blocked. Each antibody was stained with an antibody that specifically recognizes human Fc conjugated with Alexa488 (green fluorescence). Then, the nuclei were stained (blue fluorescence) using Hoechst33342 and observed under a confocal microscope.
The result showed that anti-RasGTP iMabs located in the cytoplasm through HSPG exhibited fluorescence intensity in the order of TMab4 (100%), RT22-58 (30%), CT-58 (27%), CT-59 and RT22-59 (20%).
Specifically, the HeLa (HSPG+) cell line was cultured in a 96-well plate such that the cells completely filled the bottom of the well and then washed three times with a washing buffer (HBSS buffer, 50 mM HEPES). Then, PBS, TMab4, Avastin, RT22-58, RT22-59, CT-58 and CT-59 were diluted to concentrations of 100, 50, 25, 12.5, 6.25 and 3.125 ng/ml in a blocking buffer (HBSS buffer, 50 mM HEPES, 1% BSA) and the cells were cultured for 2 hours at 4° C. After washing three times with washing buffer, the cells were bound to an HRP-conjugated anti-human mAb as a labeling antibody. The cells were reacted with TMB ELISA solution, and the absorbance at 450 nm was quantified.
With the same behavior as in
Specifically, 1×105 HeLa (HSPG+) cells were prepared for each sample. The cells were cultured in PBSF (PBS buffer, 2% BSA) supplemented with 500 nM of TMab4, Avastin, RT22-58, RT22-59, CT-58 and CT-59 for 1 hour at 4° C. Then, each antibody was reacted with an antibody specifically recognizing human Fc conjugated to Alexa488 (green fluorescence) for 30 minutes at 4° C. The result was washed with PBS and analyzed with flow cytometry. The result showed that fluorescence intensity binding to the cells was measured in the order of TMab4, TMab4, RT22-58, CT-58, CT-59 and RT22-59, in the same behavior as in the confocal microscopy results.
The result showed that the light-chain variable region (VL) mutants having a modified antibody framework to improve production yield also have no HSPG-binding ability.
RT31, RT36 and RT37 heavy-chain animal expression vectors and light-chain expression vectors including a light-chain variable region fused with integrin or EpCAM-targeting protopeptides for providing tumor-tissue specificity and having inhibited HSPG-binding ability and improved production yield were subjected to transient co-transfection into HEK293F-protein-expressing cells in the same manner as in Example 4, and then the process of purifying the antibody was conducted in the same manner as in Example 4.
In addition, the quantitative affinity for GppNHp-bound KRasG12D of the anti-Ras⋅GTP iMabs introduced with the RT31, RT36 and RT37 heavy-chain animal expression vectors and the light-chain variable regions fused with integrin or EpCAM-targeting protopeptide for providing tumor-tissue specificity and having inhibited HSPG-binding ability and improved production yield was analyzed using a BIACORE2000 instrument.
Specifically, RT31-i37 MG, RT31-ep37 MG, RT36-i37 MG, RT36-i38 MG, RT36-i39 MG, RT36-ep37 MG, RT36-ep38 MG and RT36-ep39 MG were diluted to a concentration of 20 μl/ml in 10 mM NaAc buffer (pH 4.0) and immobilized at approximately 1800 response units (RU) on a CM5 sensor chip (GE Healthcare). Subsequently, Tris buffer (20 mM Tris-HCl, pH 7.4, 137 mM NaCl, 5 mM MgCl2, 0.01% Tween 20) was analyzed at a flow rate of 30 μl/min, and complete GppNHp-bound GST-KRasG12D was analyzed at a concentration of 50 nM to 3.125 nM. After binding and dissociation analysis, regeneration of the CM5 chip was performed by flowing a buffer (20 mM NaOH, 1M NaCl, pH 10.0) at a flow rate of 30 μl/min for 1 minute. Each sensorgram, obtained by binding for 3 minutes and dissociation for 3 minutes, was normalized with reference to a blank cell and subtracted, and the affinity was thus calculated.
The following Table 16 shows the production yield of the tumor-tissue-specific anti-RasGTP iMabs introduced with the RT31, RT36 and RT37 heavy-chain animal expression vectors and the light-chain variable regions fused with integrin or EpCAM-targeting protopeptide for providing tumor-tissue specificity, and having inhibited HSPG-binding ability and improved production yield, and the result of analysis of the affinity of tumor-tissue-specific anti-Ras⋅GTP iMabs based on SPR using a BIACORE2000 instrument.
aThe 2 plasmids that encode the HC and LC of each IgG antibody were co-transfected with the equivalent molar ratio into HEK293F cells in 1 L of culture media. After 6 d of culture, antibodies were purified from the cell culture supernatant using a protein-A affinity column.
bND, not determined
The antibodies (RT31-i37 MG, RT31-ep37 MG, RT37-i37 MG) introduced with RT31 and RT37 heavy chains with improved affinity based on RT22 and light-chain variable region (VL) mutants for improving production yield and inhibiting HSPG-binding capacity have a problem of low production yield, and the antibodies (RT36-i38 MG, RT36-i39 MG, RT36-ep58 MG and RT36-ep59 MG) introduced with RT36 and light-chain variable-region (VL) mutants having improved production yield and tumor-tissue-cell-specific cytoplasmic penetration have a problem of low affinity for Ras⋅GTP, compared to RT22-i38 MG, RT22-i39 MG, RT22-ep58 MG and RT22-ep59 MG. Therefore, experiments were conducted on RT22-i38 MG, RT22-i39 MG, RT22-ep58 MG and RT22-ep59 MG, having high production yield and excellent affinity for Ras⋅GTP.
Specifically, 1×105 of each of SW480, LoVo, K562 and K562 ανβ3 cell lines were prepared for each sample. The cells were cultured in a dilution of PE-conjugated anti-integrin ανβ3 or PE-conjugated anti-integrin ανβ5 at 1:100 at 4° C. for 1 hour. The cells were washed with PBS and analyzed by flow cytometry. The result showed that the ανβ3 antibody bound to the K562 ανβ3-expressing cell line and the ανβ5 antibody bound to SW480 and LoVo cells.
Specifically, 1×105 of each of SW480, LoVo, K562 and K562 ανβ3 cells were prepared for each sample. The cells were cultured for 1 hour at 4° C. in PBSF (PBS buffer, 2% BSA) supplemented with 500 nM of RT11-i, RT22-i38 MG, RT22-i39 MG and CT-i39 MG. Then, each antibody was reacted with an antibody specifically recognizing human Fc conjugated to Alexa488 (green fluorescence) for 30 minutes at 4 degrees. The cells were washed with PBS and analyzed by flow cytometry. The result showed that the fluorescence intensities of RT11-i, RT22-i38 MG, RT22-i39 MG and CT-i39 MG antibodies bound to SW480, LoVo and K562 ανβ3 cells expressing ανβ3 or ανβ5 were measured.
Specifically, 1×105 of each of SW480, LoVo, K562 and K562 ανβ3 cells were prepared for each sample. The anti-EpCAM antibody was diluted at 1:200 and cultured for 1 hour at 4° C. Then, the primary antibody was reacted with an antibody specifically recognizing murine Fc conjugated to which Alexa488 (green fluorescence) for 30 minutes at 4° C. The cells were washed with PBS and analyzed by flow cytometry. As a result, the fluorescence intensities of the ανβ3 antibody bound to K562 ανβ3 cells and the ανβ5 antibody bound to SW480 and LoVo cells were measured.
Specifically, 1×105 of each SW480, LoVo and HeLa cells were prepared for each sample. The cells were cultured for 1 hour at 4° C. in PBSF (PBS buffer, 2% BSA) supplemented with 500 nM of RT22-ep58 MG, RT22-ep59 MG, and CT-ep59 MG. Then, each antibody was reacted with an antibody specifically recognizing human Fc conjugated to Alexa488 (green fluorescence) for 30 minutes at 4° C. Then, the cells were washed with PBS and analyzed by flow cytometry. As a result, the fluorescence intensities of the RT22-ep58 MG, RT22-ep59 MG and CT-ep59 MG antibodies bound to SW480 and LoVo cells expressing EpCAM were measured.
Specifically, the cell line was diluted at a density of 1×104 cells/well in 0.2 ml of a medium containing 10% FBS in a 96-well plate and cultured for 24 hours at 37° C. and at 5% CO2. Then, the resulting cells were treated with 0.5 μM of TMab4-i, RT11-i, RT22-i38 MG and RT22-i39 MG for 48 hours, after which 10 μl of a WST solution (Dojindo) was added thereto and the absorbance at 450 nm was quantified.
As can be shown from
Specifically, the cell lines were diluted at a density of 1×104 cells/well in 0.2 ml of a medium containing 10% FBS in a 96-well plate and cultured for 24 hours at 37° C. under 5% CO2. Then, the resulting cells were treated with 1 μM of CT-ep59, RT11, RT22-ep58 MG and RT22-ep59 MG for 36 hours, after which 10 μl of a WST solution (Dojindo) was added thereto and absorbance at 450 nm was quantified.
As can be shown from
As a result, when compared with the conventional anti-Ras⋅GTPs (RT11, RT11-i) in vitro, RT22-i38 MG, RT22-i39 MG, RT22-ep58 MG and RT22-ep59 MG have an improved cell growth inhibitory effect specific for Ras mutant cell lines. Thus, the subsequent experiment was conducted to determine whether or not the effect of inhibiting the tumor growth by the antibodies was also improved in an in-vivo animal model.
Specifically, in order to determine the improved tumor growth inhibition ability of RT22-i38 MG and RT22-i39 MG, tumor-tissue integrin-specific anti-Ras⋅GTP iMabs, having improved affinity and having no HSPG-binding ability, compared to the conventional tumor-tissue integrin-specific anti-Ras⋅GTP iMab, RT11-I in vivo, the KRasG12V mutant human colorectal cancer cell line SW480 was subcutaneously injected into BALB/c nude mice at a density of 5×106 cells/mouse, and the KRasG13D mutant human colorectal cancer cell line LoVo was subcutaneously injected into BALB/c nude mice at a density of 2×106 cells/mouse. After about 10 days, when the tumor volume reached about 50 to 80 mm3, the equivalent volume of a PBS vehicle control group, control group CT-i39 MG (TMab4 VH), and experimental groups RT11-i, RT22-i38 MG and RT22-i39 MG were injected intravenously at 20 mg/kg. A total of 8 intravenous injections were performed every 2 days, and the tumor volume was measured for 16 days using a caliper.
As can be shown from
In addition, as can be seen from
Specifically, in order to determine the in-vivo tumor growth inhibition of RT22-ep58 MG and RT22-ep59 MG, tumor-tissue EpCAM-specific anti-Ras⋅GTP iMabs, the KRasG12V mutant human colorectal cancer cell line SW480 was subcutaneously injected into BALB/c nude mice at a density of 5×106 cells/mouse, and the KRasG13D mutant human colorectal cancer cell line LoVo was subcutaneously injected into BALB/c nude mice at a density of 2×106 cells/mouse. After about 10 days, when the tumor volume reached about 50 to 80 mm3, the equivalent volume of a PBS vehicle control group, a control group, CT-ep59 MG, and experimental groups RT22-ep58 MG and RT22-ep59 MG were injected intravenously at 20 mg/kg. A total of 9 intravenous injections were performed every 2 days, and the tumor volume was measured for 18 days using a caliper.
As can be shown from
In addition, as can be seen from
Specifically,
In order to determine the tumor growth inhibition effect, the KRasG13D mutant human colorectal cancer cell line LoVo was subcutaneously injected into BALB/c nude mice at a density of 2×106 cells/mouse. After about 10 days, when the tumor volume reached about 50 to 80 mm3, the equivalent volume of a PBS vehicle control group, control group CT-i39 MG (TMab4 VH), and experimental group RT22-i39 MG were injected intravenously or intraperitoneally at 5, 10 and 20 mg/kg. A total of 9 intravenous injections were performed every 2 days, or a total of 6 intravenous injections were performed every week, and the tumor volume was measured for 18 days using a caliper.
As can be shown from
In addition, as can be seen from
Specifically, in order to determine the in-vivo tumor growth inhibition of RT22-ep59 MG, tumor-tissue EpCAM-specific anti-Ras⋅GTP iMab, depending on dose, administration interval and administration route, the KRasG13D mutant human colorectal cancer cell line LoVo was subcutaneously injected into BALB/c nude mice at a density of 2×106 cells/mouse. After about 10 days, when the tumor volume reached about 50 to 80 mm3, the equivalent volume of a PBS vehicle control group, control group CT-ep59 MG, and experimental group RT22-ep59 MG were injected intravenously or intraperitoneally at 5, 10, 20 mg/kg. A total of 9 intravenous injections were performed every 2 days, or a total of 6 intravenous injections were performed every week, and the tumor volume was measured for 18 days using a caliper.
As can be shown from
In addition, as can be seen from
Intracytoplasmic proteins are generally degraded by a ubiquitin-proteasome mechanism. Likewise, an intact immunoglobulin-type antibody in the cytoplasm is bound to TRIM21 E3 ligase and is degraded by the ubiquitin-proteasome mechanism, and the degradation of the antibody is inhibited when a mutation is introduced into the N434 amino acid in the region CH3 of the antibody that binds to TRIM21. Therefore, in order to improve the intracytoplasmic stability of the anti-Ras⋅GTP iMab, the intact immunoglobulin-type antibody, a variant in which a N434D mutation was introduced into the CH3 region was constructed. Specifically, in the same manner as in Example 4, the cytoplasmic penetration humanized light-chain expression vector (hT4-ep59 MG LC) and the heavy-chain expression vector (RT22 IgG1 N434D) of the anti-Ras⋅GTP iMab having improved intracytoplasmic stability were subjected to transient co-transfection into HEK293F-protein-expressing cells to express anti-Ras⋅GTP iMab mutations with improved intracytoplasmic stability.
In addition, the immunoglobulin-type antibody binds to the Fc receptor of immune cells in the body and is removed through an ADCC mechanism. Among the IgG subclass, IgG2 and IgG4 have weak binding force to the Fc gamma receptor and thus inhibition in this function. Therefore, in order to improve the in-vivo stability of the anti-Ras⋅GTP iMab, the intact immunoglobulin IgG1 antibody, a variant introduced with heavy-chain constant regions of IgG4 (CH1 to CH3) was constructed. At this time, the S228P mutation was further introduced into the Hinge site so that Fab-arm exchange, which is the characteristic of IgG4, does not occur in the body. Specifically, in the same manner as in Example 4, cytoplasm-penetrating humanized light-chain expression vector (hT4-ep59 MG LC) and the heavy-chain expression vector (RT22 IgG4 S228P) of the anti-Ras⋅GTP iMab having improved in-vivo persistence were subjected to transient co-transfection into HEK293F protein-expressing cells to express an anti-Ras⋅GTP iMab mutation with improved in-vivo persistence.
The following Table 17 shows the sequence information of the heavy-chain constant region (CH1-CH3) modified to improve the intracytoplasmic stability and in-vivo persistence of anti-Ras⋅GTP iMab.
In addition, in order to improve the tumor-tissue-targeting ability of anti-Ras⋅GTP iMab, a clone that binds to the ep133 peptide having EpCAM targeting ability to the N-terminus of the anti-Ras⋅GTP iMab heavy-chain variable region was constructed, expressed and purified. Specifically, in the same manner as in Example 4, the cytoplasm-penetrating humanized light-chain expression vector (hT4-ep59 MG LC) and the heavy-chain expression vectors (epRT22 GS, epRT22 MG, epRT22 (G4S)2) of the anti-Ras⋅GTP iMab having improved tumor-tissue-targeting ability were subjected to transient co-transfection into HEK293F protein-expressing cells to express anti-Ras⋅GTP iMab mutations having improved tumor-tissue-targeting ability.
The following Table 18 shows the heavy-chain variable-region sequences of anti-Ras⋅GTP iMab having improved tumor-tissue-targeting ability.
The following Table 19 shows the production yield of anti-Ras⋅GTP iMab having improved intracytoplasmic stability, in-vivo persistence and tumor-tissue-targeting ability
In Table 19 above, the conventional RT22-ep59 MG was newly named “epRas03 MG”, the RT22-i39 MG was named “inRas03”, and the heavy chain constant region variants were named based thereon.
An improved split green fluorescent protein complementation system (Korean Patent Application No. 10-2015-0143278) was used to determine the decrease in degradation of the anti-Ras⋅GTP iMab having improved intracytoplasmic stability constructed in Example 25. For this purpose, epRas03-GFP11-SBP2 MG and epRas13-GFP11-SBP2 MG, having a GFP11-SBP2 peptide fused to the heavy-chain C-terminus of epRas03 MG and epRas13 MG, were constructed.
Specifically, an SW480 cell line expressing SA-GFP1-10 at a density of 1×104 cells/well in a 96-well assay plate was diluted in 0.1 ml of medium containing 10% FBS and cultured for 24 hours at 37° C. and 5% CO2. Then, the cells were treated with 2 μM of epRas03 MG, epRas03-GFP11-SBP2 MG and epRas13-GFP11-SBP2 MG for 6 hours, and then the medium was replaced with fresh medium. Then, the cells were cultured for 0, 2, 4, and 6 hours, and green fluorescence at an excitation wavelength of 485 nm and an emission wavelength of 528 nm was quantified using a fluorescent plate reader.
As shown in
Specifically, 0.2 ml of a mixture of a 1.2% agarose solution and a 2× RPMI+20% FBS medium in a ratio of 1:1 was spread on a 24-well plate. After the bottom agar was hardened, a 0.7% agarose solution and a medium of 2×RPMI+20% FBS containing 1×103 cells +1 μM or 4 μM antibody were mixed at a ratio of 1:1, and 0.2 ml of the mixture was spread thereon. After the top agar was hardened, 0.2 ml of medium was added thereto. Subsequently, the medium was replaced with a medium containing 0.5 μM or 2 μM of the antibody every 3 days. After to 3 weeks, the colonies were stained with a BCIP/NBT solution, and then the number of colonies having a size of 200 μm or more was measured.
As shown in
Specifically, the cell lines were diluted at a density of 1×103 cells/well in 0.1 ml of 10% FBS medium in a low-attachment 96-well plate, and cultured along with a 0.5 μM or 2 μM concentration of antibody for 48 hours at 37° C. and 5% CO2. Subsequently, the cells were further treated with 0.5 and 2 μM antibody concentrations and cultured for 48 hours. After culturing for a total of 96 hours, 50 μl of CellTiterGlo (Promega) was added to quantify luminescence.
As shown in
Specifically, the cell lines were diluted at a density of 1×103 cells/well in 0.1 ml medium containing 10% FBS in a low-attachment 96-well plate, and cultured along with a 2 μM antibody for 48 hours at 37° C., and 5% CO2. Subsequently, the cells were further treated with the 2 μM antibody and cultured for 48 hours. After culture for a total of 144 hours, 50 μl of CellTiterGlo (Promega) was added to quantify luminescence.
As shown in
The result showed that both epRas13 MG and inRas13 had cytoplasmic stability superior to the conventional epRas03 MG and inRas03, and thus exhibited an improved cell growth inhibitory effect specific for the Ras mutant cell line.
Specifically, both epRas03 MG and epRas03 MG IgG4 were found to have a molecular weight of about 150 kDa under non-reducing conditions, and the molecular weight of the heavy chain and the molecular weight of the light chain were found to be 50 kDa and 25 kDa, respectively, under reducing conditions. This indicated that the expressed and purified individual clones were present as monomers (alone) in the solution, and did not form dimers or oligomers through non-natural disulfide bonds.
Specifically, 20 mg/kg of experimental group epRas03 MG IgG4 and control group epRas03 MG were intravenously injected into BALB/c nude mice. After 0.5, 1, 4, 8, 12 and 24 hours and 2, 4, 7, 14, 21 and 28 days, mouse blood was collected. The collected blood was centrifuged at 12,000 rpm for 10 minutes at 4° C. and the supernatant plasma was stored at −80° C. Thereafter, ELISA was performed to analyze the concentrations of epRas03 MG IgG4 and epRas03 MG in the plasma. Specifically, the anti-human Fab antibody (Sigma) was bound at a concentration of 2.5 μg/ml to a 96-well half-area plate (Corning) for 1 hour at room temperature and washed three times with 0.1% PBST (PBS, pH 7.4, 0.1% Tween20). The antibody was bound to 1% PBSB (PBS, pH 7.4, 1% BSA) for 1 hour, the collected blood and purified antibody (for the reference curve) was diluted in 1% PBSB, bound for 2 hours, and then washed three times with 0.1% PBST. Then, the HRP-conjugated anti-human IgG, Fc antibody (Sigma) was bound as a labeling antibody for 1 hour, followed by washing 3 times with 0.1% PBST. The result was reacted with TMB ELISA solution, the reaction was stopped with a sulfuric acid solution, and the absorbance at 450 nm was quantified.
As can be seen from
Specifically, 1×105 LoVo cells were prepared for each sample. The cells were cultured for 1 hour at 4° C. in PBSF (PBS buffer, 2% BSA) supplemented with 100 nM of Ras03, epRas03 MG and epRas23 MG. Then, each antibody was reacted with an antibody specifically recognizing human Fc conjugated to Alexa488 (green fluorescence) for 30 minutes at 4° C. Then, the cells were washed with PBS and analyzed by flow cytometry. As a result, the fluorescence intensities of epRas03 MG and epRas23 MG antibodies bound to LoVo cells expressing EpCAM were measured, and epRas23 MG fused with more EpCAM-targeting peptides had higher fluorescence intensity.
Specifically, ELISA was conducted in the same manner as in Example 4, and epRas03 MG and epRas23 MG, tumor-tissue-specific anti-Ras⋅GTP iMabs including EpCAM-targeting peptide fused with the N-terminal of the heavy-chain variable region in order to improve tumor-tissue-targeting ability were fixed on a 96-well EIA/RIA plate, after which the GppNHp-bound KRas protein was bound at various concentrations of 100 nM, 50 nM and 25 nM, and the GDP-bound KRas protein was bound at a concentration of 100 nM and was then bound to an HRP-conjugated anti-his antibody (HRP-conjugated anti-his mAb) as a labeling antibody. The result was reacted with TMB ELISA solution, and the absorbance at 450 nm was quantified.
The result showed that the fusion of EpCAM-targeting peptide with the N-terminal of the heavy-chain variable region caused no difference in the affinity for Ras.
Specifically, LoVo, DLD-1 and HCT116 cell lines were each diluted at a density of 1×103 cells/well in 0.1 ml of a 10% FBS medium in a low-attachment 96-well plate, and cultured along with a 0.5 or 2 μM antibody for 48 hours at 37° C. under 5% CO2. Subsequently, the cells were further treated with the 0.5 or 2 μM antibody and cultured for 48 hours. After culture for a total of 96 hours, 50 μl of CellTiterGlo (Promega) was added thereto to quantify luminescence.
As can be seen from
Specifically, 20 μg of DyLight fluorescently labeled anti-Ras⋅GTP iMabs, Ras03, epRas03 MG, and epRas23 MG were injected into BALB/c nude mice, and fluorescence emitted from the entire bodies of the mice was observed at 0, 6, 12, 24, 48 and 72 hours with an IVIS Lumina XRMS Series III (Perkin Elmer). At this time, the mice were anesthetized using 1.5-2.5% isoflurane (Piramal Critical Care). Each image shows fluorescence values of the entire body quantified using Living Image software (Perkin Elmer).
As can be seen from
Specifically, following the experiment, 72 hours after antibody injection, the mice were euthanized, the tumors, heart, lungs, liver, kidneys, pancreas and spleen were extracted and the fluorescence in each of these organs was quantified using Living Image software (Perkin Elmer).
As can be seen from
An immunoglobulin-type antibody binds to the Fc receptor of immune cells in the body and is removed through an ADCC mechanism. IgG1 has weak binding force to the Fc gamma receptor due to the introduction of L234A, L235A and P239G mutations and thus inhibition of this function. Therefore, in order to improve the in-vivo stability of anti-Ras⋅GTP iMab, the intact immunoglobulin IgG1 antibody, a mutant (IgG1 LALA-PG) in which L234A, L235A and P239G mutations (LALA-PG) were introduced into the heavy-chain constant regions (CH1 to CH3) of IgG1 was constructed. Specifically, in the same manner as in Example 4, cytoplasm-penetrating humanized light-chain expression vector (hT4-ep59 GSSG LC) and the heavy-chain expression vector (RT22 IgG1 LALA-PG or RT22 IgG1 LALA-PG, N434D) of the anti-Ras⋅GTP iMab having improved in-vivo persistence were subjected to transient co-transfection into HEK293F protein-expressing cells to express an anti-Ras⋅GTP iMab mutant with improved in-vivo persistence.
The following Table 20 shows the sequence information of the heavy-chain constant region (CH1-CH3) introduced with the LALA-PG mutant to improve the in-vivo persistence of anti-Ras⋅GTP iMab.
Specifically, the size-exclusion chromatography was performed using an Agilent Technologies HPLC 1200 series. The column used herein was a Zenix® SEC-300 column. The experiment was conducted at a flow rate of 1 ml/min. The mobile phase included 150 mM sodium phosphate (pH 7.0). The diluent was the mobile phase, and analysis was performed with 280 nm UV. It was identified that the antibody was purified as a monomer, not a multimer, from all iMabs.
Specifically, epRas03, epRas13, epRas33 and epRas83 were intravenously injected at 20 mg/kg into BALB/c nude mice. After 0.5, 1, 4, 8, 12 and 24 hours and 2, 4, 7, 14, 21 and 28 days, mouse blood was collected. The collected blood was centrifuged at 12,000 rpm for 10 minutes at 4° C. and only the supernatant plasma was stored at −80° C. Then, ELISA was performed to analyze the concentrations of epRas03, epRas13, epRas33 and epRas83 in the plasma. Specifically, in the same manner as in Example 28, an anti-human Fab antibody (Sigma) was bound on a 96-well half-area plate (Corning) at a concentration of 2.5 μg/ml for 1 hour at room temperature and then washed three times with 0.1% PBST (PBS, pH 7.4, 0.1% Tween20). After binding with 1% PBSB (PBS, pH 7.4, 1% BSA) for 1 hour, the collected blood and purified antibody (for the reference curve) was diluted in 1% PBSB, bound for 2 hours, and then washed three times with 0.1% PBST 3. Then, the antibody was bound to an HRP-conjugated anti-human IgG, Fc antibody (Sigma) as a labeling antibody for 1 hour and then washed 3 times with 0.1% PBST. The result was reacted with TMB ELISA solution, the reaction was stopped with a sulfuric acid solution, and the absorbance at 450 nm was quantified.
As can be seen from
The binding ability was analyzed based on SPR (surface plasmon resonance) using a Biacore2000 instrument to identify that the LALA-PG mutant to improve in-vivo persistence of anti-Ras⋅GTP iMab maintains the binding ability to GppNHp-bound KRasG12D and has no influence on the binding ability to FcRn.
Specifically, in order to determine the binding ability to GppNHp-bound KRasG12D, epRas03, epRas13, epRas83, inRas03 MG, inRas13 MG and inRas83 MG were diluted to a concentration of 20 μl/ml in 10 mM NaAc buffer (pH 4.0) and immobilized at approximately 1800 response units (RU) on a CM5 sensor chip (GE Healthcare). Subsequently, Tris buffer (20 mM Tris-HCl, pH 7.4, 137 mM NaCl, 5 mM MgCl2, 0.01% Tween 20) was analyzed at a flow rate of 30 μl/min, and complete GppNHp-bound GST-KRasG12D was analyzed at a concentration of 100 nM to 6.25 nM. After binding and dissociation analysis, regeneration of the CM5 chip was performed by flowing a buffer (20 mM NaOH, 1M NaCl, pH 10.0) at a flow rate of 30 μl/min for 1 minute. Each sensorgram, obtained by binding for 3 minutes and dissociation for 3 minutes, was normalized with reference to a blank cell and subtracted, and the affinity was thus calculated.
Specifically, in order to determine the binding ability to FcRn, FcRn was diluted to a concentration of 20 μl/ml in 10 mM NaAc buffer (pH 4.0) and immobilized at approximately 650 response units (RU) on a CM5 sensor chip (GE Healthcare). Subsequently, a phosphate buffer (12 mM phosphate, pH 6.0, 137 mM NaCl, 0.01% Tween 20) was analyzed at a flow rate of 30 μl/min, epRas03 was analyzed at a concentration of 200 nM to 6.25 nM, and epRas13 and epRas83 were analyzed at a concentration of 2000 nM to 62.5 nM. After binding and dissociation analysis, regeneration of the CM5 chip was performed by flowing a phosphate buffer (12 mM phosphate, pH 7.4, 137 mM NaCl, 0.01% Tween 20) at a flow rate of 30 μl/min for 3 minutes. Each sensorgram, obtained by binding for 3 minutes and dissociation for 6 minutes, was normalized with reference to a blank cell and subtracted, and the affinity was thus calculated.
The following Table 21 shows the result of analysis, based on SPR using a BIACORE2000 instrument, of the affinity for complete GppNHp-bound KRasG12D and FcRn of the LALA-PG mutant to improve the in-vivo persistence of anti-Ras⋅GTP iMabs.
aND, not determined
Specifically, size-exclusion chromatography was performed using an Agilent Technologies HPLC 1200 series. The column used herein was a Zenix® SEC-300 column. The experiment was conducted at a flow rate of 1 ml/min. The mobile phase included 150 mM sodium phosphate (pH 7.0). The diluent was the mobile phase, and analysis was performed with 280 nm UV. It was identified that the antibody was purified as a monomer in 95% or more of all iMabs.
Specifically, the KRasA146T mutant human colorectal cancer cell line LS1034 was subcutaneously injected into BALB/c nude mice at a density of 1×107 cells/mouse. After about 14 days, when the tumor volume reached about 120 mm3, the equivalent volume of a PBS vehicle control group, control groups (inCT03 MG, inCT13 MG, inCT33 MG, inCT83 MG), and experimental groups (inRas03 MG, inRas13 MG, inRas33 MG, inRas83 MG) were injected intravenously at 20 mg/kg. A total of 7 intravenous injections were performed every 3 to 4 days, that is, twice a week, and the tumor volume was measured for 24 days using a caliper.
As can be seen from
Specifically, the KRasG12V mutant human colorectal cancer cell line SW403 was subcutaneously injected into BALB/c nude mice at a density of 1×107 cells/mouse. After about 14 days, when the tumor volume reached about 120 mm3, the equivalent volume of a PBS vehicle control group, control groups (inCT03 MG, inCT13 MG, inCT33 MG, inCT83 MG), and experimental groups (inRas03 MG, inRas13 MG, inRas33 MG, inRas83 MG) were injected intravenously at 20 mg/kg. A total of 5 intravenous injections were performed every 3 to 4 days twice for a week, and the tumor volume was measured for 17 days using a caliper.
As can be seen from
As can be seen from
The method for improving the tumor inhibition efficiency of an antibody that specifically penetrates into the cytoplasm of tumor tissue cells in the form of an intact immunoglobulin to directly inhibit intracellular Ras⋅GTP, provided by the present disclosure, is accomplished by selecting heavy-chain variable regions with improved affinity for Ras⋅GTP and developing light-chain variable regions with improved cytoplasmic penetration ability specifically for tumor tissues, and is capable of targeting Ras⋅GTP, which is located in certain tumor cells and is always activated through mutation, and of effectively inhibiting the activity thereof.
In addition, the light-chain variable region, imparting improved tumor-tissue-specific cytoplasmic penetration ability to the antibody provided by the present disclosure or the antibody including the same, lowers the binding ability to HSPG expressed in most normal cells and thereby makes it possible to provide endocytosis and endosomal escape through receptors expressed specifically for tumor tissues by the peptide fused for targeting tumor tissues, and the heavy-chain variable region (VH) having improved affinity for Ras⋅GTP has improved Ras inhibition ability when the antibody reaches the cytoplasm. The antibody, which specifically penetrates into the cytoplasm of tumor tissue cells in the form of an intact immunoglobulin including a combination of the modified light-chain variable region and the heavy-chain variable region, and directly inhibits intracellular Ras⋅GTP, exhibits improved tumor growth inhibitory ability based thereon.
The cytoplasmic penetration Ras-inhibitory antibody including a combination of the improved light-chain variable region and the heavy-chain variable region according to the present disclosure can be easily developed into a therapeutic drug owing to high production yield, is capable of effectively inhibiting mutant Ras through tumor-tissue-specific cytoplasmic penetration, and is thus expected to exert effective anti-cancer activity through treatment using a single drug or a combination thereof with a conventional therapeutic drug.
An electronic file is attached.
| Number | Date | Country | Kind |
|---|---|---|---|
| 10-2017-0152998 | Nov 2017 | KR | national |
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/KR2018/014110 | 11/16/2018 | WO | 00 |
