Claims
- 1. A peptide comprising the sequence
- SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF (SEQ ID NO:2)
- wherein:
- positions 11, 19, 22, and 29 have been substituted with an arginine; and
- position 34 is couple to Hol, Ho, a homoserine amide, or the sequence of amino acids comprising residues 35-84 of PTH (SEQ ID NO:1).
- 2. The peptide of claim 1, wherein position 34 is coupled to Hol.
- 3. A pharmaceutical composition comprising a peptide of claim 1 in association with a pharmaceutical carrier or diluent.
CROSS-REFERENCE
This application is a continuation-in-part of U.S. patent application Ser. No. 07/965,677, filed Oct. 22, 1992, now abandoned, which is expressly incorporated herein by reference. This application is also a continuation-in-part of U.S. patent application Ser. No. 08/077,296, filed Jun. 14, 1993, now abandoned, which is also expressly incorporated herein by reference and a continuation-in-part of U.S. patent application Ser. No. 07/898,219, filed Jun. 12,1992, now abandoned.
US Referenced Citations (15)
| Number |
Name |
Date |
Kind |
|
3886132 |
Brewer et al. |
May 1975 |
|
|
4423037 |
Rosenblatt et al. |
Dec 1983 |
|
|
4632780 |
Seidah et al. |
Dec 1986 |
|
|
4656250 |
Morita et al. |
Apr 1987 |
|
|
4771124 |
Rosenblatt et al. |
Sep 1988 |
|
|
4968669 |
Rosenblatt et al. |
Nov 1990 |
|
|
5001223 |
Rosenblatt et al. |
Mar 1991 |
|
|
5010010 |
Gautvik et al. |
Apr 1991 |
|
|
5171670 |
Kronenberg et al. |
Dec 1992 |
|
|
5455329 |
Wingender et al. |
Oct 1995 |
|
|
5457047 |
Wingender et al. |
Oct 1995 |
|
|
5589452 |
Krstenansky et al. |
Dec 1996 |
|
|
5599792 |
Kronis et al. |
Feb 1997 |
|
|
5693616 |
Krstenansky et al. |
Dec 1997 |
|
|
5695955 |
Krstenansky et al. |
Dec 1997 |
|
Foreign Referenced Citations (1)
| Number |
Date |
Country |
| 293158 |
May 1988 |
EPX |
Related Publications (2)
|
Number |
Date |
Country |
|
77296 |
Jun 1993 |
|
|
898219 |
Jun 1992 |
|
Continuation in Parts (1)
|
Number |
Date |
Country |
| Parent |
965677 |
Oct 1992 |
|