FUNCTIONAL AAV CAPSIDS FOR INTRAVITREAL ADMINISTRATION

Abstract

Disclosed herein are engineered AAV VP capsid polypeptides with the ability to assemble into virus particles and having improved tissue tropism to eye tissues, for example, retinal tissues, retinal pigment epithelial cells, or photoreceptor cells. The capsids are engineered using the high throughput discovery system described herein. In certain embodiments, provided herein are recombinant adeno-associated virus (AAV) VP capsid polypeptides having at least one mutation in a 581 to 589 region of the VP capsid polypeptide, corresponding to residues 581 to residue 589 of a VP1 polypeptide of SEQ ID NO: 1.

Description

BACKGROUND

Recombinant adeno-associated viruses (rAAV) provide the leading platform for in vivo delivery of gene therapies. Current clinical trials employ a limited number of AAV capsids, primarily from naturally occurring human or primate serotypes such as AAV1, AAV2, AAV5, AAV6, AAV8, AAV9, AAVrh.10, AAV4rh.74, and AAVhu.67. These capsids often provide suboptimal targeting to tissues of interest, both due to poor infectivity of the tissue of interest and competing liver tropism. Increasing the dose to ensure infection of desired tissues can lead to dose-dependent liver toxicity. In addition, use of naturally-occurring capsids presents an immunological memory challenge—pre-immune patient populations are excluded from treatment and repeat dosing in a previously immune naïve patient is often not possible. Thus, there is a need for additional AAV capsids for use in gene therapy, in particular capsids that confer upon the rAAV high infectivity for specific tissues, such as ocular tissues.

SUMMARY OF THE INVENTION

Described herein is a system for high throughput engineering of functional AAV capsids with altered tropism for various tissues, and using this system, have identified capsid variants with increased tropism for target tissues, such as eye tissues.

In various aspects, the present disclosure provides a viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence of SEQ ID NO: 5014 and further comprises at least one substitution relative to SEQ ID NO: 9; and wherein the 581 to 589 region comprises one or more basic amino acid residues.

In some aspects, the 581 to 589 region comprises more basic amino acid residues than acidic amino acid residues. In some aspects, the acidic amino acid residues are selected from the group consisting of D and E. In some aspects, the basic amino acid residues are selected from the group consisting of K, R, and H.

In various aspects, the present disclosure provides a viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581-589 region of the VP capsid polypeptide comprises a sequence of SEQ ID NO: 5014, wherein X¹, X², X³, X⁴, X⁵, or X⁶ of SEQ ID NO: 5014, or any combination thereof is K or R.

In some aspects, X¹ of SEQ ID NO: 5014 is K or R. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2343, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, or 1555.

In some aspects, X² of SEQ ID NO: 5014 is K or R. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 752, 2144, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 285, 1626, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 3646, 4059, 1431, 1331, 310, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 1959, 1840, 3736, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 2382, 3675, 1833, 3974, 419, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 3879, 2698, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 1019, 2012, 1803, 3642, 497, 1322, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 1675, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1050, 3515, 2219, 1433, 1323, 4301, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2324, 605, 1368, 3827, 4103, 606, 607, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 4879, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 3815, 2005, 1964, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, or 2250.

In some aspects, X³ of SEQ ID NO: 5014 is K or R. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 4177, 1289, 740, 741, 18, 745, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 23, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 34, 35, 36, 37, 38, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 45, 756, 46, 48, 1952, 758, 49, 3122, 2551, 3718, 3484, 3577, 759, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 760, 53, 3925, 55, 3654, 56, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 63, 64, 768, 771, 65, 66, 67, 68, 3816, 2599, 2706, 74, 3865, 1549, 1361, 3882, 3713, 1942, 1312, 4501, 76, 77, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 82, 4065, 83, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 90, 91, 779, 1180, 92, 785, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 794, 795, 104, 105, 106, 1849, 108, 1579, 110, 1906, 113, 1444, 1344, 116, 802, 117, 118, 121, 803, 804, 1463, 805, 122, 124, 125, 127, 807, 132, 809, 810, 133, 1978, 812, 135, 136, 137, 138, 813, 140, 815, 1326, 141, 142, 143, 144, 145, 1634, 1302, 817, 146, 818, 147, 148, 149, 151, 152, 153, 154, 155, 819, 820, 157, 159, 160, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 826, 827, 181, 828, 182, 829, 184, 185, 186, 187, 188, 189, 830, 191, 192, 193, 194, 195, 196, 1391, 197, 200, 201, 202, 203, 204, 205, 832, 833, 206, 834, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 215, 1896, 1522, 3490, 838, 217, 218, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 226, 227, 230, 231, 842, 232, 233, 844, 236, 237, 851, 852, 853, 1536, 240, 854, 242, 243, 244, 245, 246, 247, 249, 250, 251, 252, 253, 254, 255, 857, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 264, 1241, 265, 266, 866, 1477, 267, 867, 869, 870, 271, 871, 872, 272, 1252, 273, 1591, 275, 1980, 276, 876, 877, 277, 278, 279, 1892, 1539, 880, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 282, 1799, 283, 1626, 1374, 287, 1620, 1290, 1354, 888, 291, 1956, 889, 292, 4324, 293, 4138, 891, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1515, 1617, 1961, 304, 306, 1589, 4370, 308, 309, 894, 3646, 4059, 1431, 1331, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 898, 321, 322, 899, 1958, 901, 325, 902, 326, 1491, 329, 330, 905, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 1762, 4472, 1472, 1529, 4057, 1976, 4507, 1583, 338, 911, 1711, 340, 912, 2013, 341, 4440, 917, 344, 918, 919, 921, 922, 347, 351, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 925, 1782, 926, 927, 3610, 357, 359, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 1211, 1873, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 1359, 1734, 3650, 1910, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 390, 391, 4406, 4341, 1480, 395, 1714, 1422, 396, 397, 3618, 4433, 1177, 3898, 398, 949, 950, 399, 951, 400, 1965, 4471, 952, 402, 2475, 403, 404, 4139, 1482, 3602, 4434, 3721, 1592, 1519, 1352, 4202, 4409, 1977, 1917, 407, 408, 1631, 1684, 409, 3889, 958, 959, 412, 960, 414, 415, 961, 1905, 416, 963, 417, 3675, 1833, 3974, 420, 421, 965, 966, 969, 970, 422, 1897, 423, 4133, 3830, 972, 424, 973, 427, 1708, 4141, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 434, 1606, 979, 2604, 2895, 436, 3448, 1692, 983, 3862, 4055, 4358, 984, 985, 1664, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 987, 988, 990, 451, 452, 991, 992, 1728, 994, 995, 454, 1696, 3116, 1869, 456, 1386, 999, 3879, 2698, 1001, 461, 1447, 462, 464, 4425, 1645, 1231, 1468, 472, 473, 476, 1273, 1007, 1744, 1488, 1659, 477, 1604, 481, 4313, 482, 483, 1499, 484, 1016, 4073, 1777, 1458, 4274, 487, 1775, 4205, 1526, 1697, 1017, 2000, 489, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 491, 1948, 3699, 1735, 3792, 4290, 495, 4090, 496, 2012, 1803, 3642, 1322, 498, 1021, 1022, 502, 1333, 503, 1023, 1890, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1029, 1366, 2112, 1261, 4027, 3478, 3763, 2959, 517, 3197, 1595, 3413, 1448, 518, 1675, 1797, 520, 1999, 3759, 1215, 4122, 1730, 524, 526, 3966, 3911, 529, 3289, 1821, 530, 531, 1874, 1038, 536, 537, 3767, 1929, 1041, 1042, 3683, 542, 1338, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 546, 4240, 3580, 1046, 1047, 550, 2598, 551, 552, 3819, 1259, 4062, 2841, 1050, 3515, 4301, 1052, 1053, 3738, 1567, 1270, 3857, 1055, 1257, 1238, 3662, 561, 562, 1058, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 572, 1912, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1451, 1654, 3934, 4080, 4352, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 1950, 1963, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 1559, 1250, 1555, 4114, 1818, 1075, 1076, 1077, 1704, 4448, 1078, 1079, 1786, 585, 3354, 1832, 3432, 2891, 2505, 1903, 1081, 1082, 4459, 1083, 1563, 590, 591, 1085, 594, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 600, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1087, 1088, 3888, 1368, 3827, 4103, 606, 1090, 1571, 1091, 1438, 1092, 1093, 612, 1094, 3701, 4389, 613, 1603, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1100, 1702, 1101, 1667, 1384, 623, 3700, 1788, 1600, 624, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4860, 2557, 2795, 2906, 3118, 1614, 1947, 4479, 3766, 632, 1104, 1105, 633, 1813, 636, 3706, 1110, 640, 1111, 641, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 1114, 1766, 3221, 2643, 2739, 3920, 644, 1116, 645, 646, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2369, 2695, 3293, 650, 651, 1120, 652, 1121, 3264, 655, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3994, 1319, 4467, 1802, 1227, 1623, 662, 663, 664, 1124, 1125, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 1135, 672, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 679, 1142, 1143, 681, 1145, 682, 685, 3822, 689, 690, 691, 1147, 1601, 3905, 694, 695, 1414, 1150, 1795, 1372, 1695, 1866, 4115, 1719, 698, 1920, 699, 700, 1544, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1854, 1902, 1510, 4182, 706, 707, 708, 4476, 1245, 714, 1841, 4234, 1314, 4096, 717, 1155, 4217, 1156, 723, 1157, 1627, 725, 1159, 1953, 1160, 1201, 727, 3787, 3747, 730, 1846, 3815, 2005, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 734, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1628, 3705, 1195, 3859, 1164, 1165, 1166, 1745, 1973, 1168, 3807, 4307, 1454, or 1781.

In some aspects, X⁴ of SEQ ID NO: 5014 is K or R. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 739, 4177, 1289, 15, 743, 3477, 3051, 2982, 2877, 746, 3036, 3426, 3073, 3169, 3362, 2784, 3192, 1638, 25, 1703, 1836, 3660, 30, 32, 752, 1653, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 2633, 757, 1952, 3122, 2551, 3718, 2216, 3484, 3577, 1308, 1230, 3960, 2994, 3080, 2589, 3681, 51, 761, 3925, 3654, 763, 764, 57, 4086, 1740, 767, 772, 2599, 2706, 70, 3865, 1549, 1361, 3882, 1942, 1312, 4501, 1413, 3593, 4043, 1806, 3908, 4397, 1615, 2006, 3945, 2854, 3523, 3669, 1356, 777, 4065, 84, 1484, 778, 87, 3891, 4456, 4040, 4496, 2001, 1478, 1189, 1490, 1885, 2270, 1180, 786, 4458, 1970, 1590, 98, 1298, 101, 1688, 794, 107, 1849, 797, 1579, 111, 112, 113, 1444, 801, 114, 115, 119, 120, 122, 1760, 123, 124, 806, 125, 126, 127, 128, 129, 130, 134, 811, 814, 139, 1326, 144, 816, 1302, 150, 152, 821, 160, 161, 162, 1651, 1483, 179, 180, 183, 185, 187, 1391, 198, 199, 831, 204, 833, 207, 3901, 3312, 2649, 1301, 4386, 3028, 1896, 1522, 3490, 216, 218, 1612, 225, 228, 229, 234, 239, 849, 850, 1536, 241, 246, 248, 855, 249, 252, 253, 261, 4966, 864, 263, 4749, 2296, 1241, 866, 268, 868, 269, 270, 873, 874, 1252, 273, 1591, 274, 1980, 878, 1539, 3601, 3877, 1930, 1420, 1678, 1460, 1799, 1374, 1290, 1354, 290, 2391, 4324, 294, 4138, 3903, 892, 3829, 298, 3844, 1436, 300, 1515, 1617, 1961, 303, 1589, 893, 4370, 3646, 4059, 1331, 1558, 1552, 320, 1958, 1491, 1635, 332, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 2785, 3249, 3527, 3352, 2569, 4457, 2011, 3906, 1533, 1755, 1888, 4248, 1557, 3804, 1363, 1934, 1602, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 1852, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 2662, 2875, 3223, 2878, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 4472, 1472, 4057, 4507, 1711, 913, 916, 1594, 4440, 343, 918, 345, 348, 350, 1518, 3728, 3637, 3570, 3429, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 355, 1782, 928, 3610, 358, 4224, 1918, 1959, 1840, 3736, 4155, 1543, 4049, 1633, 1495, 372, 1873, 1726, 1748, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 4149, 1313, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 3979, 4461, 4113, 3817, 4232, 3902, 1857, 1904, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 3785, 3687, 4318, 4243, 3866, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 3296, 375, 1395, 1584, 4093, 3940, 3778, 4374, 4210, 4009, 4264, 4368, 1610, 4194, 4474, 4013, 4266, 1759, 1922, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3790, 3712, 1969, 934, 1790, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 3845, 4511, 3656, 1406, 1596, 4504, 1359, 1734, 3650, 1305, 1208, 1988, 4451, 1282, 4380, 1658, 1452, 1687, 3791, 4491, 4323, 4014, 1304, 1440, 4422, 3861, 1383, 3644, 3691, 4259, 1749, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 1297, 1586, 1251, 1299, 1954, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 3627, 3777, 1371, 3685, 1325, 1940, 4482, 4258, 3812, 1581, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1666, 1407, 4187, 1188, 1724, 1646, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 2561, 4442, 3900, 4298, 1203, 4441, 3628, 3725, 937, 4447, 3776, 3658, 4064, 1324, 1367, 3594, 3680, 1300, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 1546, 3613, 3273, 3452, 3525, 4105, 3835, 1263, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 4333, 3146, 4281, 4211, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 1471, 4176, 1232, 1989, 4125, 1741, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 3826, 1473, 1883, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1410, 1823, 1498, 1329, 386, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 3953, 4228, 4226, 4277, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 1859, 4183, 1408, 1403, 941, 4033, 3623, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 4322, 3991, 4106, 1641, 1570, 3978, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 4201, 1898, 1845, 1226, 1220, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1884, 1682, 4364, 4306, 3869, 3600, 3914, 1968, 1670, 3811, 1865, 3961, 1506, 4221, 1376, 1379, 3768, 4225, 945, 394, 1714, 1422, 3618, 4433, 1965, 4471, 954, 4139, 1482, 3721, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 3889, 413, 962, 418, 3675, 3974, 964, 420, 967, 968, 1897, 1272, 4133, 425, 4141, 430, 3749, 4044, 3590, 1944, 4126, 977, 4400, 1606, 980, 2604, 2895, 3448, 4563, 1692, 4055, 4358, 1664, 4309, 4045, 3854, 3682, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3985, 3535, 1306, 4084, 3282, 447, 1353, 1780, 449, 1485, 453, 1728, 454, 1696, 455, 3116, 1869, 457, 1386, 3879, 2698, 459, 1447, 4425, 1645, 467, 1488, 478, 1604, 1011, 4313, 4073, 4274, 1775, 2000, 2480, 1882, 1817, 1880, 1800, 4473, 3783, 3870, 1948, 3699, 1735, 3792, 4290, 492, 4090, 1019, 1803, 3642, 497, 500, 1333, 1890, 1024, 3608, 1864, 1531, 3636, 1699, 1028, 1366, 1030, 4027, 3478, 3763, 2959, 1293, 517, 3197, 1595, 3413, 2238, 1031, 1448, 1032, 1675, 1797, 3759, 1215, 4122, 3966, 528, 3911, 3289, 1821, 1874, 1037, 536, 1039, 3767, 3683, 540, 541, 1338, 1616, 1901, 1517, 2719, 3803, 4123, 4233, 3129, 3087, 3505, 4158, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 543, 4240, 3580, 2598, 4062, 2841, 1049, 3515, 1433, 1323, 4301, 1051, 3738, 1270, 3857, 1056, 3662, 1057, 3981, 1063, 568, 570, 3620, 1064, 4002, 3964, 3707, 3666, 1348, 4273, 4497, 1401, 4438, 1895, 1912, 3939, 4170, 4056, 1221, 1654, 1067, 3934, 4080, 4352, 574, 3739, 1565, 3950, 1397, 3716, 1569, 1465, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 4455, 4512, 3750, 3633, 4070, 4104, 4162, 4235, 4346, 1572, 4443, 3761, 1346, 3592, 1891, 4469, 1275, 577, 1963, 4129, 1296, 1360, 3733, 4111, 3993, 4108, 3949, 1556, 1435, 1424, 1830, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 4293, 1827, 3839, 3983, 4395, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1650, 4299, 1773, 2004, 1267, 1364, 4007, 3729, 3665, 3722, 1712, 1751, 3924, 3952, 1343, 4114, 1704, 4448, 1786, 3354, 586, 3432, 2891, 587, 1903, 2077, 1080, 1563, 2274, 595, 2559, 2590, 2738, 4478, 4069, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 4017, 4477, 1794, 4263, 3072, 2199, 3888, 604, 605, 1368, 3827, 4103, 607, 1571, 1438, 3701, 4389, 4897, 1603, 2154, 1715, 4369, 1652, 1733, 4218, 1798, 621, 1667, 1384, 3700, 1788, 1600, 1102, 1423, 2771, 1339, 3070, 2557, 2795, 2906, 3299, 3118, 4779, 2028, 1614, 1947, 630, 4479, 3766, 1106, 634, 1108, 635, 638, 3706, 3735, 3390, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1585, 3221, 2643, 2739, 3920, 1801, 4279, 2502, 1117, 2965, 2695, 3293, 3264, 2076, 657, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 667, 1133, 1134, 673, 1933, 1731, 1793, 3342, 683, 1146, 687, 3822, 1601, 692, 3905, 1414, 696, 1695, 4115, 701, 1544, 702, 703, 4031, 2010, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 1532, 1493, 1854, 1510, 705, 1153, 4476, 1375, 712, 1245, 715, 4234, 1154, 1314, 4096, 720, 1311, 721, 722, 4217, 726, 3815, 2005, 1964, 1262, 4480, 4294, 1582, 3439, 2833, 4287, 4509, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 1195, 3859, 3807, 4307, 1454, or 1781.

In some aspects, X⁵ of SEQ ID NO: 5014 is K or R. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 2498, 4177, 742, 16, 17, 18, 745, 3477, 1548, 2982, 3426, 3073, 3169, 747, 3362, 4942, 23, 28, 2038, 3660, 750, 31, 32, 1640, 34, 37, 4925, 1205, 4288, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3688, 4320, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 1225, 3178, 3006, 3252, 2991, 2642, 2519, 3363, 2633, 42, 755, 44, 756, 46, 1952, 758, 2410, 2551, 3718, 1308, 1230, 3960, 1378, 2589, 3681, 760, 53, 4951, 4591, 762, 3925, 55, 3654, 763, 60, 61, 4086, 1740, 766, 1966, 63, 2041, 64, 769, 770, 2384, 771, 65, 772, 2197, 68, 3816, 69, 2599, 70, 3865, 1549, 3882, 75, 4501, 76, 774, 1413, 776, 3757, 3593, 4043, 4397, 4415, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 1356, 81, 82, 4065, 83, 84, 1294, 87, 3891, 4456, 4040, 1189, 1490, 90, 92, 782, 94, 1831, 1867, 4458, 1936, 100, 792, 2007, 4556, 795, 104, 106, 1849, 2509, 110, 1906, 798, 2359, 2461, 4864, 1344, 116, 120, 121, 803, 1463, 805, 1760, 123, 124, 806, 127, 2085, 130, 132, 809, 1978, 134, 813, 139, 815, 1326, 141, 142, 145, 4816, 1302, 817, 146, 818, 148, 149, 4546, 150, 153, 156, 157, 163, 164, 166, 169, 823, 824, 1483, 175, 177, 178, 179, 826, 827, 182, 183, 829, 184, 185, 190, 191, 192, 2361, 195, 1391, 197, 2223, 201, 202, 4775, 1334, 837, 3901, 3312, 212, 4386, 3028, 213, 1446, 214, 215, 1896, 3490, 217, 219, 223, 225, 2088, 4542, 226, 227, 230, 843, 844, 237, 845, 239, 849, 852, 1536, 854, 244, 245, 248, 855, 251, 253, 255, 257, 858, 860, 262, 863, 4535, 865, 264, 1241, 265, 1477, 267, 867, 1252, 273, 275, 1980, 277, 281, 1892, 879, 1539, 881, 1295, 282, 285, 1626, 2082, 1374, 1620, 4564, 289, 887, 888, 889, 4324, 293, 4138, 296, 3903, 892, 3829, 298, 301, 302, 1589, 4370, 2342, 309, 4059, 310, 1779, 1558, 1552, 317, 320, 898, 321, 2016, 2134, 324, 325, 327, 1635, 4484, 1756, 4609, 332, 4635, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3214, 3163, 2541, 3090, 3097, 3462, 3037, 3419, 2780, 2931, 1276, 2789, 3228, 2657, 3189, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3102, 3466, 3461, 2788, 2660, 3344, 2720, 3379, 2826, 3249, 3527, 4460, 3352, 4319, 3906, 4248, 3804, 1363, 1404, 4349, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3782, 3629, 3578, 3885, 4081, 1764, 1852, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 4222, 1504, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3909, 4269, 3019, 1415, 3020, 2748, 2646, 2787, 2760, 3158, 3170, 2703, 3494, 3404, 2675, 2749, 3341, 3355, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 2875, 3223, 2878, 1808, 2951, 3519, 2579, 2853, 3387, 3401, 3007, 3568, 3152, 3367, 3358, 336, 3290, 3550, 3309, 2613, 2765, 1355, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 1622, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 1464, 3560, 3236, 2730, 3572, 1607, 909, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 3002, 2338, 4472, 1472, 1529, 4507, 1583, 340, 912, 2013, 913, 2277, 1594, 4440, 917, 343, 344, 345, 346, 350, 351, 4498, 3637, 3570, 3429, 4091, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4034, 2820, 3912, 3287, 1218, 1190, 4145, 354, 3610, 4224, 1840, 3736, 1770, 4155, 932, 363, 1279, 2156, 1722, 368, 1566, 370, 4967, 372, 1211, 2494, 1726, 1748, 1191, 4039, 4411, 4506, 4270, 4156, 3780, 1550, 3899, 1181, 3919, 1639, 3664, 4189, 4001, 3799, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 1605, 4408, 4149, 3741, 3893, 1280, 1983, 3979, 3817, 1489, 4214, 3902, 1857, 1904, 3820, 3789, 4252, 4330, 4082, 3785, 3687, 4243, 3704, 4172, 4315, 1192, 2769, 2678, 3296, 2343, 4093, 4453, 3940, 3778, 4374, 4339, 4368, 4194, 4474, 4013, 1771, 1759, 3860, 3832, 1381, 4356, 1233, 4212, 3858, 1198, 3611, 1919, 1819, 3790, 1969, 4247, 1790, 3894, 1554, 3576, 4314, 1851, 1850, 4511, 3656, 3638, 1406, 1443, 1661, 4504, 3831, 4435, 1208, 1988, 3849, 1835, 4380, 4024, 4491, 4323, 4014, 1511, 1981, 1676, 1547, 1383, 3644, 3691, 4259, 1176, 4216, 1924, 1387, 4423, 1256, 4119, 1251, 3990, 4029, 4097, 3890, 3796, 4343, 1202, 4413, 4384, 3808, 3892, 3926, 3756, 4405, 4109, 1210, 4492, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3784, 4470, 4010, 4334, 3821, 4171, 3824, 3631, 4494, 1320, 1204, 1223, 1284, 1685, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4100, 4327, 3634, 3617, 4445, 4303, 1370, 3838, 1187, 3615, 3746, 3935, 1941, 4419, 1171, 3670, 3777, 936, 3685, 1325, 1940, 4482, 4258, 3812, 4124, 4508, 4500, 3652, 3972, 1630, 4421, 1172, 4026, 2740, 3125, 3546, 4513, 4340, 1763, 1487, 3589, 3907, 4041, 3851, 4077, 4187, 1193, 1196, 1724, 1717, 1200, 1975, 1613, 4006, 3653, 3833, 1593, 4442, 3900, 4388, 1820, 4317, 4249, 3628, 3794, 4447, 3776, 3658, 1377, 4011, 4272, 3594, 4185, 3686, 3696, 1350, 4230, 3853, 4244, 1909, 3897, 1546, 3273, 3452, 3525, 4105, 3835, 383, 1263, 1492, 3856, 3586, 1175, 4144, 1224, 1199, 3667, 2778, 4412, 1507, 3146, 4281, 1179, 3843, 3740, 1388, 1474, 1342, 1471, 4176, 1741, 1508, 4378, 1212, 4015, 1207, 3698, 3825, 4231, 3806, 3896, 3963, 4286, 3743, 4130, 3605, 4173, 4265, 1246, 1737, 3826, 1473, 1992, 1883, 1656, 3671, 4063, 1847, 4239, 3915, 1265, 1498, 1329, 3874, 4261, 1791, 3579, 4359, 4131, 4297, 4357, 4046, 3788, 4169, 1925, 4228, 4101, 1889, 1369, 4088, 4019, 1194, 3772, 3850, 1315, 1530, 1859, 4183, 1408, 4033, 3623, 1928, 1459, 1765, 4004, 3591, 3967, 4168, 3957, 3878, 3980, 3958, 4051, 3798, 4032, 3991, 4106, 1641, 4464, 3813, 4257, 3846, 4345, 1787, 1214, 4483, 4201, 1220, 3867, 3640, 3916, 1209, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3883, 4326, 4092, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3987, 3583, 3647, 389, 4304, 3793, 1937, 3996, 3800, 4367, 4099, 1390, 4364, 4306, 1278, 1672, 1542, 1915, 3600, 3948, 3811, 1362, 4276, 1445, 1721, 1632, 3607, 1317, 1778, 1668, 391, 4406, 4341, 1480, 393, 394, 395, 946, 3618, 4433, 1177, 947, 950, 400, 4471, 401, 402, 954, 3602, 4434, 3721, 1825, 4202, 4409, 406, 1631, 1684, 3889, 410, 412, 2352, 1905, 417, 418, 3675, 1833, 3974, 419, 964, 420, 421, 969, 4733, 1272, 971, 423, 3830, 973, 426, 1708, 428, 4141, 3749, 1619, 975, 4044, 3590, 1706, 4400, 979, 2895, 3448, 438, 982, 2433, 983, 442, 3862, 2435, 443, 4309, 4045, 3854, 3682, 444, 445, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3599, 3775, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 3694, 446, 3985, 3535, 4084, 3282, 988, 2107, 990, 451, 452, 453, 992, 993, 1696, 996, 3116, 1386, 999, 458, 3879, 460, 461, 462, 2339, 1003, 4425, 1645, 1004, 466, 2328, 468, 1231, 1468, 2496, 473, 474, 2108, 1273, 1007, 1744, 1659, 478, 1009, 1012, 4313, 482, 1499, 484, 2513, 2205, 4592, 1458, 4274, 2122, 4905, 4205, 2000, 488, 1894, 3917, 3616, 4311, 4085, 4401, 1310, 3783, 1538, 3870, 1948, 3699, 1735, 3792, 2202, 4090, 2378, 2012, 3642, 1020, 2302, 4665, 4781, 500, 1022, 1023, 4686, 505, 507, 508, 509, 1025, 1732, 1816, 3636, 1028, 516, 1366, 4572, 2489, 1261, 4027, 3763, 2959, 1293, 3197, 1448, 1032, 519, 2420, 522, 3759, 1215, 4122, 1730, 524, 526, 3966, 1035, 527, 528, 529, 530, 531, 1036, 532, 533, 536, 537, 3767, 1929, 1041, 3683, 1043, 4906, 542, 1338, 1796, 4331, 4332, 4466, 3803, 3087, 3505, 1449, 1044, 4414, 3453, 3254, 544, 546, 1045, 547, 4240, 3580, 4680, 549, 550, 2598, 551, 3819, 1259, 4062, 554, 1049, 1050, 1433, 555, 1052, 1053, 3738, 3857, 2089, 1056, 2193, 1257, 1238, 3662, 1059, 1060, 4203, 3981, 1303, 4116, 567, 569, 3620, 4002, 3679, 3707, 4497, 4438, 1264, 3939, 4170, 4056, 1271, 1451, 1654, 3934, 4080, 4352, 574, 3739, 1565, 1419, 3950, 3716, 1465, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4164, 3630, 4229, 4292, 4215, 1729, 4223, 4455, 4512, 3633, 4070, 4104, 4162, 4443, 3761, 1587, 3592, 1891, 4469, 1963, 4129, 1360, 3949, 1861, 4120, 1292, 4293, 3839, 3983, 3928, 4295, 3715, 3855, 3609, 1990, 4007, 3722, 1624, 3924, 3952, 580, 2003, 1343, 582, 4114, 1818, 1704, 4448, 584, 1078, 1786, 585, 1832, 586, 2891, 587, 4936, 1082, 4459, 2113, 590, 2308, 593, 1858, 597, 2738, 4150, 3260, 3481, 4439, 1268, 4050, 3377, 4424, 3492, 1412, 4477, 4263, 3072, 2009, 3888, 3827, 4103, 1438, 609, 610, 611, 3701, 4389, 613, 4369, 617, 1921, 1373, 1870, 4218, 1099, 1702, 4801, 623, 3700, 1788, 625, 4878, 1423, 1339, 3875, 628, 2557, 2906, 2029, 4876, 1103, 631, 4479, 3766, 632, 1104, 1105, 634, 4651, 1108, 1813, 636, 638, 641, 4581, 1112, 2164, 3735, 3390, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 4398, 1269, 3624, 4481, 1432, 3295, 1568, 1766, 2643, 2739, 4760, 1115, 3920, 644, 645, 646, 4279, 3762, 1637, 1509, 2200, 1117, 4780, 2965, 2695, 650, 651, 653, 654, 655, 658, 4035, 2910, 3391, 2808, 3676, 2852, 3284, 3537, 1319, 4467, 1802, 1227, 660, 4812, 2364, 1124, 1125, 665, 4917, 1127, 1129, 1132, 1133, 2236, 673, 4557, 1136, 1139, 678, 4737, 4531, 679, 680, 1144, 681, 4525, 2415, 685, 2445, 3822, 690, 691, 1601, 4621, 3905, 695, 1149, 696, 2027, 2160, 1795, 1372, 4115, 2194, 1920, 4031, 1393, 1277, 1400, 4402, 4157, 4028, 704, 1902, 1510, 4182, 1153, 4476, 2053, 710, 1375, 715, 4096, 717, 1155, 719, 1311, 722, 4217, 1156, 723, 1157, 1627, 4566, 1158, 724, 725, 1953, 1201, 3787, 3747, 1846, 3815, 1822, 1537, 1318, 4294, 733, 734, 3439, 2833, 4505, 4267, 3697, 4112, 2967, 3651, 1805, 1163, 3859, 2275, 737, 1167, 1745, 3807, or 4307.

In some aspects, X⁶ of SEQ ID NO: 5014 is K or R. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 738, 4177, 1289, 740, 14, 743, 744, 17, 3477, 1548, 3051, 2982, 2877, 746, 19, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 22, 1638, 748, 24, 749, 27, 1703, 1836, 28, 3660, 29, 750, 1640, 33, 35, 36, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 44, 45, 756, 47, 48, 1952, 3122, 2551, 3718, 3484, 3577, 1308, 3960, 1378, 2994, 3080, 2589, 3681, 51, 760, 762, 3925, 3654, 763, 59, 60, 4086, 1740, 1660, 62, 1966, 63, 2438, 768, 66, 67, 68, 3816, 2599, 2706, 72, 73, 74, 3865, 1549, 1361, 3882, 773, 3713, 1942, 1312, 4501, 76, 1413, 775, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 1356, 4065, 1294, 1484, 85, 86, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 780, 1180, 92, 781, 782, 783, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 1936, 1590, 98, 99, 789, 790, 1298, 1688, 791, 792, 2007, 102, 103, 104, 105, 107, 108, 1579, 1906, 111, 798, 112, 799, 800, 1444, 801, 114, 115, 1344, 116, 802, 117, 118, 119, 121, 803, 1463, 1760, 806, 126, 128, 807, 129, 131, 808, 133, 1978, 811, 812, 135, 136, 137, 138, 814, 140, 1326, 141, 142, 143, 2344, 816, 1634, 1302, 817, 818, 147, 148, 149, 150, 151, 154, 155, 819, 820, 156, 157, 158, 161, 162, 165, 822, 168, 169, 170, 823, 172, 1651, 173, 1483, 174, 825, 176, 178, 180, 827, 181, 828, 4911, 184, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 198, 199, 200, 201, 202, 203, 205, 832, 206, 834, 207, 208, 209, 210, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 225, 228, 229, 230, 231, 842, 232, 233, 234, 238, 847, 239, 850, 851, 853, 1536, 240, 241, 242, 243, 244, 245, 247, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 864, 263, 2318, 865, 2326, 264, 1241, 266, 1477, 867, 268, 868, 269, 270, 869, 870, 271, 871, 872, 272, 873, 1252, 1591, 875, 274, 275, 276, 876, 877, 277, 278, 280, 1892, 1539, 881, 3601, 3877, 1460, 282, 1799, 284, 1626, 286, 1374, 1620, 1290, 1354, 887, 1956, 889, 292, 4324, 4138, 891, 296, 3903, 297, 3829, 3809, 4271, 3844, 1436, 300, 1617, 1961, 302, 304, 305, 2147, 1589, 4370, 307, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 318, 319, 322, 1958, 323, 324, 901, 1491, 328, 329, 4484, 907, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 3804, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 3548, 3179, 3407, 3841, 3347, 3142, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 344, 920, 921, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 354, 1782, 927, 3610, 356, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 364, 1279, 365, 1543, 366, 367, 4049, 1633, 1722, 369, 1495, 1566, 373, 1211, 1726, 1442, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 4149, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 3902, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3687, 4318, 4243, 3866, 3704, 4172, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 1584, 4093, 4453, 4210, 4009, 4264, 4339, 1738, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1336, 3894, 3576, 4314, 3695, 1850, 4362, 1815, 3638, 4454, 1661, 4504, 1359, 3650, 1305, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 1283, 3861, 3644, 4259, 1418, 1176, 4216, 1421, 3992, 4423, 4253, 3748, 4119, 1297, 1954, 4450, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 4275, 4492, 4365, 4118, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 4470, 3941, 4348, 3587, 3818, 4350, 3821, 3929, 3824, 4465, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 3627, 3777, 1371, 3685, 4258, 3812, 1581, 4124, 4508, 4500, 3652, 3972, 1528, 3717, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 3758, 4510, 3742, 1710, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1997, 1701, 4280, 4006, 1984, 3833, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1324, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 3826, 1992, 1656, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1410, 1823, 1498, 1329, 386, 940, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1859, 4183, 1403, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 3937, 3801, 1787, 1214, 4483, 4201, 1845, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 953, 401, 403, 955, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4409, 1977, 405, 1631, 1684, 409, 3889, 2117, 411, 413, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 1272, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 978, 4400, 1606, 980, 2604, 2895, 436, 3448, 2188, 438, 1692, 442, 3862, 4055, 4358, 2276, 985, 1664, 443, 4309, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3985, 3535, 1306, 4084, 3282, 1780, 448, 990, 991, 1485, 992, 1728, 993, 994, 1696, 997, 3116, 1869, 456, 1386, 1000, 3879, 2698, 460, 1001, 461, 1447, 1002, 1003, 463, 464, 4425, 465, 1004, 466, 469, 1231, 1468, 470, 1005, 476, 1273, 1744, 1488, 1659, 1604, 479, 1013, 1014, 481, 4313, 1499, 1016, 4073, 1777, 485, 4274, 487, 1775, 4205, 1526, 1697, 2000, 488, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 4473, 4085, 4401, 3783, 3765, 1538, 3870, 491, 3699, 3792, 4290, 494, 2421, 4090, 2012, 1803, 3642, 1322, 1020, 502, 1333, 504, 1890, 507, 3608, 1732, 1864, 1816, 1531, 513, 3636, 514, 1699, 1027, 1366, 4950, 4027, 3478, 2959, 1293, 3197, 1595, 3413, 518, 1032, 1033, 1675, 1797, 2315, 521, 1999, 3759, 1215, 4122, 1730, 3966, 1035, 4973, 528, 3911, 3289, 1821, 530, 532, 1874, 533, 1038, 538, 539, 3767, 1929, 3683, 1338, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 548, 549, 2598, 552, 553, 3819, 1259, 4062, 554, 2841, 3515, 1433, 1323, 4301, 555, 558, 3738, 1567, 559, 1054, 1270, 3857, 2175, 1257, 1238, 3662, 561, 1058, 563, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 1912, 573, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 4195, 4223, 1540, 4455, 4512, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1814, 4443, 3761, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 1287, 1713, 1556, 1736, 1995, 1705, 1861, 4120, 4417, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1712, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 1903, 4459, 589, 1563, 1084, 591, 592, 594, 595, 1858, 596, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 1412, 4017, 4477, 1794, 602, 4263, 3072, 2009, 1754, 3888, 603, 604, 1368, 3827, 4103, 1571, 1438, 611, 1093, 612, 1094, 3701, 4389, 614, 615, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2473, 1423, 2771, 1339, 3875, 3070, 2015, 2557, 2795, 2906, 2103, 3299, 3118, 4576, 1103, 1614, 1947, 631, 4479, 3766, 1107, 635, 1813, 636, 2431, 637, 1109, 639, 3706, 1110, 640, 642, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1568, 1766, 3221, 2643, 2739, 3920, 647, 1801, 4279, 3762, 1637, 1509, 648, 1117, 1119, 2965, 2695, 3293, 4722, 1121, 653, 1122, 3264, 655, 656, 657, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3537, 3994, 1319, 4467, 1623, 660, 1123, 664, 1126, 1128, 1129, 1130, 670, 1527, 671, 1772, 1137, 5005, 1933, 1731, 1793, 3342, 1140, 1141, 687, 3822, 1601, 1148, 693, 3905, 694, 1414, 1149, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 1920, 4999, 1544, 703, 4031, 4305, 1636, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 4028, 3989, 704, 1493, 1902, 1152, 4182, 707, 708, 709, 4476, 1375, 713, 714, 1841, 4234, 1154, 1314, 4096, 718, 719, 720, 2063, 1311, 721, 4217, 1627, 1158, 1953, 1201, 3787, 729, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1805, 3705, 1195, 3859, 1164, 1165, 2351, 2423, 1745, 1973, 3807, 4307, 1169, 1454, or 1781.

In some aspects, X⁷ of SEQ ID NO: 5014 is R. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 740, 15, 742, 743, 17, 22, 24, 1836, 32, 36, 2450, 39, 752, 753, 1998, 3059, 2519, 757, 48, 1952, 50, 52, 760, 2389, 54, 2346, 58, 4086, 1660, 1966, 768, 2402, 772, 71, 72, 2453, 3882, 775, 1806, 3669, 1356, 2132, 81, 84, 85, 87, 4040, 88, 1885, 782, 783, 784, 785, 94, 788, 2173, 98, 2007, 102, 113, 799, 4848, 1444, 4821, 2329, 115, 119, 2290, 123, 806, 128, 134, 812, 145, 817, 154, 2149, 821, 167, 171, 4596, 183, 830, 191, 194, 2071, 195, 4920, 831, 2223, 207, 3901, 211, 212, 213, 215, 224, 4782, 845, 846, 849, 850, 854, 247, 248, 2245, 255, 261, 264, 265, 1477, 270, 874, 876, 279, 882, 1930, 285, 286, 886, 2119, 2468, 887, 888, 4138, 297, 3844, 302, 893, 307, 308, 2155, 1431, 2312, 900, 1635, 906, 2799, 2128, 2918, 1363, 4251, 2622, 3333, 3474, 3614, 2732, 3166, 3151, 3088, 2883, 3318, 2645, 2733, 3213, 3782, 1844, 2523, 2520, 2997, 2681, 3035, 3279, 2764, 3480, 2787, 1808, 3101, 3689, 4147, 1762, 1976, 340, 1594, 2439, 348, 4498, 1518, 1782, 926, 357, 359, 932, 363, 369, 1873, 3780, 4140, 4001, 3709, 3834, 1752, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 3820, 4330, 1872, 3687, 4318, 375, 4210, 3860, 4212, 3695, 1851, 4504, 1910, 1428, 4323, 4422, 4259, 1176, 3711, 4365, 4383, 3969, 4128, 3802, 3863, 3821, 4171, 3824, 4462, 3760, 3753, 2783, 3880, 3943, 4163, 4178, 4199, 3724, 3670, 4482, 3692, 4430, 4316, 3645, 3690, 3589, 3730, 4426, 3851, 4429, 1335, 1717, 1997, 1975, 4280, 4006, 3900, 4298, 4388, 1341, 1350, 1909, 4412, 4407, 4281, 4167, 1893, 3585, 4015, 1747, 4286, 3826, 1473, 1914, 3984, 4495, 4184, 3977, 1707, 4074, 4003, 3915, 1410, 1498, 940, 4131, 4357, 1925, 1466, 1611, 1530, 4168, 4245, 4075, 3987, 1679, 4306, 3869, 3768, 393, 2265, 3618, 4433, 947, 399, 401, 402, 4139, 1352, 406, 415, 418, 420, 4919, 431, 4044, 976, 433, 434, 435, 442, 3873, 3411, 3985, 987, 1485, 2262, 457, 458, 4425, 466, 467, 468, 1468, 474, 1008, 1012, 1016, 4518, 1697, 490, 3616, 2247, 2302, 499, 500, 501, 509, 2110, 512, 1797, 520, 525, 3966, 1038, 537, 1041, 3683, 2165, 542, 4331, 3129, 1044, 4351, 3453, 1047, 1323, 4301, 557, 3738, 559, 1270, 3857, 1056, 2186, 1057, 1059, 565, 566, 3981, 567, 3620, 4002, 3666, 3939, 1221, 1397, 1437, 4337, 4268, 3938, 4292, 4215, 3750, 3633, 4070, 3592, 1827, 3839, 4395, 3855, 3665, 1624, 2395, 1818, 586, 587, 1903, 1080, 1081, 1082, 589, 1084, 1085, 594, 596, 4439, 3997, 1962, 1087, 4777, 606, 607, 610, 1094, 4389, 1603, 1095, 616, 618, 622, 1104, 4536, 3706, 2481, 3100, 3200, 3621, 4179, 1432, 4381, 643, 1115, 644, 2307, 2477, 652, 657, 658, 3994, 4467, 661, 663, 665, 4600, 1137, 1933, 4840, 1140, 678, 680, 683, 686, 692, 693, 696, 2081, 2280, 698, 1400, 4197, 1532, 1854, 706, 711, 712, 4570, 714, 1841, 1314, 4096, 2249, 726, 1846, 2385, 1318, 733, 3651, 1165, 4839, 4968, 4684, or 1454.

In some aspects, (a) X³ of SEQ ID NO: 5014 is a basic amino acid residue, (b) X⁶ of SEQ ID NO: 5014 is a basic amino acid residue, or (c) X³ of SEQ ID NO: 5014 is a basic amino acid residue and X⁶ of SEQ ID NO: 5014 is a basic amino acid residue. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 739, 4177, 1289, 740, 741, 18, 745, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 23, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 34, 35, 36, 37, 38, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 45, 756, 46, 48, 1952, 758, 49, 3122, 2551, 3718, 3484, 3577, 759, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 52, 760, 53, 762, 4659, 54, 3925, 55, 3654, 56, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 63, 64, 768, 771, 65, 66, 67, 68, 3816, 2599, 2706, 2399, 74, 3865, 1549, 1361, 2453, 3882, 3713, 1942, 75, 1312, 4501, 76, 77, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 82, 4065, 83, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 1180, 92, 785, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 794, 795, 104, 105, 106, 1849, 108, 4736, 1579, 110, 1906, 113, 1444, 1344, 116, 802, 117, 118, 2158, 121, 803, 804, 1463, 805, 122, 2058, 124, 125, 127, 4994, 807, 132, 809, 810, 133, 1978, 812, 135, 136, 137, 138, 813, 4673, 140, 815, 1326, 141, 142, 143, 144, 145, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 151, 152, 153, 154, 155, 819, 820, 157, 821, 159, 160, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 180, 826, 827, 181, 828, 182, 183, 4641, 829, 184, 185, 186, 187, 188, 189, 830, 191, 192, 193, 194, 195, 196, 1391, 197, 2223, 200, 201, 202, 203, 204, 205, 832, 833, 206, 834, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 215, 1896, 1522, 3490, 838, 2241, 217, 218, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 226, 227, 230, 231, 842, 232, 233, 235, 844, 236, 237, 2150, 851, 852, 853, 1536, 240, 854, 242, 243, 244, 245, 246, 247, 855, 4634, 249, 250, 251, 252, 253, 254, 255, 857, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 869, 870, 271, 871, 872, 272, 874, 1252, 273, 1591, 275, 1980, 276, 876, 877, 277, 278, 279, 1892, 879, 1539, 880, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 282, 1799, 283, 1626, 1374, 287, 1620, 1290, 1354, 888, 291, 1956, 889, 292, 4324, 293, 4138, 891, 2224, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1515, 1617, 1961, 304, 306, 1589, 4370, 308, 309, 894, 3646, 4059, 1431, 1331, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 897, 898, 321, 322, 899, 1958, 2134, 324, 901, 325, 902, 326, 1491, 329, 330, 905, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 2492, 1762, 4472, 1472, 1529, 4057, 1976, 4507, 1583, 338, 911, 1711, 340, 912, 2013, 341, 1594, 4440, 917, 344, 918, 919, 921, 922, 347, 349, 351, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 925, 1782, 926, 927, 3610, 357, 358, 359, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 1211, 1873, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 1359, 1734, 3650, 1910, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 4125, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 390, 391, 4406, 4341, 1480, 395, 1714, 1422, 396, 2265, 397, 3618, 4433, 1177, 3898, 398, 949, 950, 399, 951, 400, 1965, 2345, 4471, 952, 402, 2475, 403, 404, 4139, 1482, 3602, 4434, 3721, 1592, 1519, 1352, 4202, 4409, 1977, 1917, 407, 408, 1631, 1684, 409, 3889, 958, 959, 412, 960, 414, 415, 961, 1905, 416, 963, 417, 3675, 1833, 3974, 420, 421, 965, 966, 969, 970, 422, 1897, 4754, 423, 4133, 3830, 972, 424, 973, 427, 1708, 4141, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 434, 1606, 979, 2604, 2895, 436, 3448, 1692, 983, 3862, 4055, 4358, 984, 985, 1664, 4045, 3854, 3682, 2491, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 987, 988, 450, 990, 451, 452, 991, 992, 1728, 994, 995, 454, 1696, 998, 3116, 1869, 456, 1386, 999, 3879, 2698, 1001, 461, 1447, 462, 464, 4425, 1645, 1231, 1468, 472, 473, 4725, 476, 1273, 1007, 1744, 1488, 1659, 477, 1604, 481, 4313, 482, 483, 1499, 484, 2513, 1016, 4073, 1777, 1458, 4274, 4539, 4528, 487, 1775, 4205, 1526, 1697, 1017, 2000, 489, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 491, 1948, 3699, 1735, 3792, 4290, 495, 4090, 2247, 496, 1019, 2012, 1803, 3642, 1322, 498, 1021, 501, 1022, 502, 1333, 503, 1023, 1890, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1029, 1366, 2112, 2124, 2376, 1261, 4027, 3478, 3763, 2959, 517, 3197, 1595, 3413, 1448, 518, 2057, 1675, 1797, 2148, 2420, 520, 2315, 523, 1999, 3759, 1215, 4122, 1730, 524, 526, 3966, 3911, 529, 3289, 1821, 530, 531, 1874, 1038, 536, 537, 3767, 1929, 1041, 1042, 3683, 542, 1338, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 544, 545, 546, 4240, 3580, 1046, 1047, 550, 2598, 551, 552, 3819, 1259, 4062, 2841, 1050, 3515, 4301, 557, 1052, 1053, 3738, 1567, 1270, 3857, 1055, 2198, 1257, 1238, 3662, 561, 562, 1058, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 572, 1912, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1451, 1654, 3934, 4080, 4352, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 1950, 1963, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 1559, 1250, 1555, 4114, 1818, 1075, 1076, 1077, 1704, 4448, 1078, 1079, 1786, 585, 3354, 1832, 3432, 2891, 2505, 1903, 1081, 1082, 4459, 1083, 1563, 590, 591, 1085, 594, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 600, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1087, 1088, 3888, 2324, 605, 1368, 3827, 4103, 606, 4549, 1090, 1571, 1091, 1438, 1092, 1093, 612, 1094, 3701, 4389, 613, 1603, 616, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1099, 1100, 1702, 2239, 1101, 1667, 1384, 623, 3700, 1788, 1600, 624, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4818, 4860, 2557, 2795, 2906, 3118, 4657, 4646, 4875, 4627, 4747, 1614, 1947, 4618, 4479, 3766, 632, 1104, 1105, 633, 635, 1813, 636, 2213, 3706, 1110, 640, 1111, 641, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 1114, 1766, 3221, 2643, 2739, 3920, 644, 1116, 645, 646, 2307, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2369, 2695, 3293, 650, 651, 1120, 652, 1121, 4909, 1122, 3264, 655, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3994, 1319, 4467, 1802, 1227, 1623, 661, 2364, 662, 663, 664, 1124, 1125, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 1135, 672, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 679, 1142, 1143, 681, 1145, 682, 685, 688, 3822, 689, 690, 691, 1147, 1601, 3905, 694, 695, 1414, 4793, 4575, 1150, 1795, 1372, 1695, 1866, 4115, 1719, 698, 2217, 1920, 699, 700, 1544, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1854, 1902, 1510, 2340, 4182, 706, 707, 708, 4476, 1245, 714, 1841, 4234, 1314, 4096, 717, 1155, 2249, 4217, 1156, 723, 1157, 1627, 725, 1159, 1953, 1160, 1201, 727, 3787, 4568, 3747, 730, 1846, 3815, 2005, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 734, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1628, 3705, 1195, 3859, 1164, 2394, 1165, 1166, 1745, 1973, 1168, 3807, 4307, 2303, 1454, or 1781. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 4884, 738, 4177, 1289, 740, 14, 743, 744, 17, 3477, 1548, 3051, 2982, 2877, 746, 19, 3036, 3426, 3073, 3169, 747, 3362, 2784, 4889, 21, 3192, 4942, 22, 1638, 748, 24, 749, 27, 1703, 1836, 28, 3660, 29, 750, 1640, 33, 35, 36, 2450, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 44, 45, 756, 47, 48, 1952, 3122, 2551, 3718, 3484, 3577, 759, 50, 1308, 3960, 1378, 2994, 3080, 2589, 3681, 51, 760, 2389, 762, 3925, 3654, 763, 4626, 59, 60, 4086, 1740, 1660, 62, 1966, 63, 2438, 768, 66, 67, 2197, 68, 3816, 2599, 2706, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 1312, 4501, 76, 1413, 775, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 1356, 2132, 4065, 1294, 1484, 85, 86, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 780, 1180, 92, 781, 782, 783, 2356, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 1936, 1590, 98, 99, 789, 790, 1298, 101, 1688, 791, 792, 2007, 102, 103, 104, 105, 107, 108, 1579, 110, 1906, 111, 798, 112, 799, 800, 2461, 1444, 801, 114, 115, 1344, 116, 802, 117, 118, 119, 121, 803, 1463, 1760, 124, 806, 126, 128, 807, 129, 131, 808, 2281, 133, 1978, 811, 812, 135, 136, 137, 138, 814, 140, 1326, 141, 142, 143, 2344, 816, 1634, 1302, 817, 818, 147, 148, 149, 150, 151, 154, 155, 819, 820, 156, 157, 2295, 158, 161, 162, 165, 822, 168, 169, 170, 823, 172, 1651, 173, 1483, 174, 825, 176, 178, 180, 827, 181, 828, 4911, 184, 185, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 197, 198, 199, 200, 201, 202, 203, 4775, 205, 832, 206, 834, 207, 208, 209, 210, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 2206, 215, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 225, 4751, 228, 229, 230, 231, 2448, 842, 232, 233, 4782, 234, 235, 238, 847, 239, 850, 851, 853, 1536, 240, 241, 242, 243, 244, 245, 246, 247, 4923, 4696, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 4966, 864, 263, 4970, 2318, 865, 2326, 264, 1241, 266, 1477, 867, 268, 868, 269, 270, 869, 870, 271, 871, 872, 272, 873, 4655, 4972, 1252, 1591, 875, 274, 275, 1980, 276, 876, 877, 2066, 277, 278, 280, 2323, 1892, 1539, 2214, 881, 882, 3601, 3877, 1930, 1460, 282, 1799, 284, 4553, 4772, 1626, 286, 1374, 1620, 1290, 1354, 887, 1956, 889, 4765, 292, 4324, 4138, 891, 296, 3903, 297, 3829, 3809, 4271, 3844, 1436, 300, 1617, 1961, 5010, 302, 304, 305, 2147, 1589, 4370, 307, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 318, 319, 322, 1958, 2454, 323, 324, 901, 1491, 328, 329, 330, 4820, 4484, 1756, 907, 4584, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 3804, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 4222, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 343, 344, 920, 921, 348, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 354, 1782, 927, 3610, 356, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 364, 1279, 365, 1543, 366, 367, 4049, 1633, 1722, 369, 1495, 1566, 373, 1211, 2494, 1726, 1442, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 4149, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 3902, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 2348, 377, 1395, 1584, 4093, 4453, 3778, 4210, 4009, 4264, 4339, 1738, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1336, 3894, 1554, 3576, 4314, 3695, 1850, 4362, 1815, 3656, 3638, 4454, 1443, 1661, 4504, 1359, 3650, 1305, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 1283, 3861, 3644, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 3992, 4423, 4253, 3748, 4119, 1297, 1299, 1954, 4450, 3990, 4029, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 4492, 4365, 4118, 3655, 3886, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 4470, 3941, 4348, 3587, 3818, 3814, 4350, 3821, 3929, 3824, 4465, 4494, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 3634, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 3627, 3777, 1371, 3685, 4482, 4258, 3812, 1581, 4124, 4508, 4500, 3652, 3972, 1309, 1528, 3717, 1217, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4329, 4410, 3703, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 4302, 3758, 4510, 3742, 1710, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1997, 1701, 4280, 4006, 1984, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 1380, 4185, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 1810, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3743, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 3826, 1992, 1656, 1837, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1562, 1847, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1410, 1823, 1498, 1329, 386, 940, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1859, 4183, 1403, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 3591, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1542, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 392, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 953, 401, 403, 955, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4409, 1977, 405, 1631, 1684, 409, 3889, 2117, 411, 413, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 1272, 971, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 978, 4400, 433, 1606, 980, 2604, 2895, 436, 3448, 2188, 438, 1692, 982, 2243, 439, 442, 3862, 4055, 4358, 2276, 985, 1664, 443, 4309, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3985, 3535, 1306, 4084, 3282, 1353, 1780, 448, 2031, 990, 991, 1485, 992, 1728, 993, 4703, 994, 1696, 997, 998, 3116, 1869, 456, 1386, 4778, 2040, 1000, 4981, 3879, 2698, 460, 1001, 461, 1447, 1002, 1003, 463, 464, 4425, 465, 1004, 466, 469, 1231, 1468, 470, 2496, 1005, 476, 1273, 1744, 1488, 1659, 4598, 1604, 479, 1013, 1014, 481, 4313, 1499, 1016, 4073, 1777, 2172, 485, 4274, 4599, 4796, 487, 4710, 1775, 4205, 1526, 1697, 2000, 488, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 3783, 3765, 1538, 3870, 491, 3699, 3792, 4290, 2074, 492, 494, 2421, 4090, 2012, 1803, 3642, 1322, 1020, 502, 1333, 504, 4805, 1890, 507, 3608, 1732, 511, 2397, 1864, 1816, 1531, 513, 3636, 514, 1699, 1027, 4987, 1366, 4664, 4950, 4027, 3478, 2959, 1293, 3197, 1595, 3413, 518, 4698, 1032, 1033, 1675, 1797, 4578, 4854, 2315, 521, 1999, 3759, 1215, 4122, 1730, 3966, 1035, 4973, 528, 3911, 3289, 1821, 530, 2426, 532, 1874, 533, 1038, 538, 539, 3767, 1929, 3683, 2100, 4853, 1338, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 548, 549, 2598, 552, 553, 3819, 1259, 4062, 554, 2841, 3515, 1433, 1323, 4301, 555, 558, 3738, 1567, 559, 1054, 1270, 3857, 2175, 1257, 1238, 3662, 561, 1058, 563, 4872, 2097, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 570, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 1912, 573, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 1409, 4195, 4223, 1540, 4455, 4512, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1071, 1814, 4443, 3761, 1346, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1705, 1861, 4120, 4417, 1292, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1712, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 4583, 1903, 1080, 4459, 589, 1563, 1084, 591, 592, 594, 595, 1858, 596, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 1412, 601, 4017, 4477, 1794, 602, 4263, 3072, 2009, 1754, 1088, 3888, 603, 604, 1368, 3827, 4103, 1571, 1438, 2069, 611, 1093, 612, 1094, 3701, 4389, 614, 5000, 615, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2473, 1423, 2771, 1339, 3875, 3070, 2015, 2557, 2795, 2906, 2103, 3299, 3118, 4838, 4965, 4605, 4576, 1103, 1614, 1947, 631, 4479, 3766, 1107, 635, 1813, 636, 2431, 637, 1109, 4577, 639, 3706, 1110, 640, 1111, 4581, 4644, 4734, 642, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1585, 1568, 1766, 3221, 2643, 2739, 4629, 3920, 4603, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4590, 648, 1117, 4800, 4724, 4674, 1119, 2965, 2695, 3293, 4722, 1121, 4784, 653, 1122, 3264, 655, 656, 657, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3537, 3994, 1319, 4467, 1623, 660, 4714, 4812, 1123, 664, 2138, 1126, 1128, 1129, 1130, 670, 1527, 671, 1772, 1133, 2196, 1136, 1137, 5005, 1933, 1731, 1793, 3342, 1140, 1141, 4525, 687, 3822, 1601, 1148, 693, 3905, 694, 1414, 1149, 4756, 4859, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2194, 1920, 4999, 1544, 703, 4031, 4305, 1636, 1393, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 4715, 704, 1493, 1902, 1152, 4824, 4182, 707, 708, 709, 4732, 4476, 1375, 713, 714, 715, 1841, 4234, 1154, 1314, 4096, 4895, 718, 719, 720, 2063, 1311, 721, 4903, 4885, 4217, 1627, 2116, 1158, 724, 5013, 4894, 1953, 1201, 3787, 729, 2485, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4976, 4294, 1582, 4587, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1805, 3705, 1195, 3859, 1164, 1165, 2351, 4835, 4571, 2423, 1745, 1973, 1168, 3807, 4307, 1169, 1454, or 1781. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 4177, 1289, 740, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 35, 36, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 45, 756, 48, 1952, 3122, 2551, 3718, 3484, 3577, 759, 3960, 1378, 2994, 3080, 2589, 3681, 760, 762, 3925, 3654, 60, 4086, 1740, 1660, 62, 1966, 63, 768, 66, 67, 68, 3816, 2599, 2706, 74, 3865, 1549, 1361, 2453, 3882, 3713, 1942, 1312, 4501, 76, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 4065, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 1180, 92, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 99, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 104, 105, 108, 1579, 110, 1906, 1444, 1344, 116, 802, 117, 118, 121, 803, 1463, 124, 807, 133, 1978, 812, 135, 136, 137, 138, 140, 1326, 141, 142, 143, 1634, 1302, 817, 818, 147, 148, 149, 151, 154, 155, 819, 820, 157, 165, 822, 168, 169, 170, 823, 1651, 173, 1483, 174, 825, 176, 180, 827, 181, 828, 184, 185, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 197, 200, 201, 202, 203, 205, 832, 206, 834, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 215, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 230, 231, 842, 232, 233, 235, 851, 853, 1536, 240, 242, 243, 244, 245, 246, 247, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 2326, 264, 1241, 266, 1477, 867, 869, 870, 271, 871, 872, 272, 1252, 1591, 275, 1980, 276, 876, 877, 277, 278, 1892, 1539, 3601, 3877, 1930, 1460, 282, 1799, 1626, 1374, 1620, 1290, 1354, 1956, 889, 292, 4324, 4138, 891, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1617, 1961, 304, 1589, 4370, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 322, 1958, 324, 901, 1491, 329, 330, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 4222, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 344, 921, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 1782, 927, 3610, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 367, 4049, 1633, 1722, 369, 1495, 1566, 1211, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4093, 4453, 3778, 4210, 4009, 4264, 4339, 1738, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1336, 3894, 1554, 3576, 4314, 3695, 4362, 1815, 3656, 3638, 4454, 1443, 1661, 1359, 3650, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 3748, 4119, 1297, 1299, 4450, 3990, 4029, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 4492, 4365, 4118, 3655, 3886, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 4470, 3941, 4348, 3587, 3818, 3814, 4350, 3821, 3929, 3824, 4465, 4494, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 3634, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 4124, 4508, 4500, 3652, 3972, 1309, 1528, 3717, 1217, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4329, 4410, 3703, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 4302, 3758, 4510, 3742, 1710, 1335, 1997, 1701, 4280, 4006, 1984, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 1380, 4185, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 1810, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 4125, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3743, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 1837, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1562, 1847, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 3591, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1542, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 403, 1482, 3602, 4434, 3721, 1592, 1519, 1352, 4409, 1977, 1631, 1684, 409, 3889, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 1606, 2604, 2895, 436, 3448, 1692, 3862, 4055, 4358, 985, 1664, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 990, 991, 992, 1728, 994, 1696, 998, 3116, 1869, 456, 1386, 3879, 2698, 1001, 461, 1447, 464, 4425, 1231, 1468, 476, 1273, 1744, 1488, 1659, 1604, 481, 4313, 1499, 1016, 4073, 1777, 4274, 487, 1775, 4205, 1526, 1697, 2000, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 3783, 3765, 491, 3699, 3792, 4290, 4090, 2012, 1803, 3642, 1322, 502, 1333, 1890, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1366, 4027, 3478, 2959, 3197, 1595, 3413, 518, 1675, 1797, 2315, 1999, 3759, 1215, 4122, 1730, 3966, 3911, 3289, 1821, 530, 1874, 1038, 3767, 1929, 3683, 1338, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 2598, 552, 3819, 1259, 4062, 2841, 3515, 4301, 3738, 1567, 1270, 3857, 1257, 1238, 3662, 561, 1058, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 1912, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 1409, 4195, 4223, 1540, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1814, 4443, 3761, 1346, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1705, 1861, 4120, 4417, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 1903, 4459, 1563, 591, 594, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1088, 3888, 1368, 3827, 4103, 1571, 1438, 1093, 612, 1094, 3701, 4389, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2771, 1339, 3875, 3070, 2557, 2795, 2906, 3118, 1614, 1947, 4479, 3766, 635, 1813, 636, 3706, 1110, 640, 1111, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1585, 1766, 3221, 2643, 2739, 3920, 2307, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2695, 3293, 1121, 1122, 3264, 655, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3994, 1319, 4467, 1623, 664, 1128, 1129, 1130, 670, 1527, 671, 1772, 5005, 1933, 1731, 1793, 3342, 3822, 1601, 3905, 694, 1414, 1795, 1372, 1695, 1866, 4115, 1719, 1920, 1544, 703, 4031, 4305, 1636, 1393, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1902, 4182, 707, 708, 4476, 714, 1841, 4234, 1314, 4096, 4217, 1627, 1953, 1201, 3787, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 3705, 1195, 3859, 1164, 1165, 1745, 1973, 1168, 3807, 4307, 1454, or 1781.

In some aspects, the basic residue is selected from the group consisting of K, R, and H.

In some aspects, X³ of SEQ ID NO: 5014 is K or R. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 4177, 1289, 740, 741, 18, 745, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 23, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 34, 35, 36, 37, 38, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 45, 756, 46, 48, 1952, 758, 49, 3122, 2551, 3718, 3484, 3577, 759, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 760, 53, 3925, 55, 3654, 56, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 63, 64, 768, 771, 65, 66, 67, 68, 3816, 2599, 2706, 74, 3865, 1549, 1361, 3882, 3713, 1942, 1312, 4501, 76, 77, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 82, 4065, 83, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 90, 91, 779, 1180, 92, 785, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 794, 795, 104, 105, 106, 1849, 108, 1579, 110, 1906, 113, 1444, 1344, 116, 802, 117, 118, 121, 803, 804, 1463, 805, 122, 124, 125, 127, 807, 132, 809, 810, 133, 1978, 812, 135, 136, 137, 138, 813, 140, 815, 1326, 141, 142, 143, 144, 145, 1634, 1302, 817, 146, 818, 147, 148, 149, 151, 152, 153, 154, 155, 819, 820, 157, 159, 160, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 826, 827, 181, 828, 182, 829, 184, 185, 186, 187, 188, 189, 830, 191, 192, 193, 194, 195, 196, 1391, 197, 200, 201, 202, 203, 204, 205, 832, 833, 206, 834, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 215, 1896, 1522, 3490, 838, 217, 218, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 226, 227, 230, 231, 842, 232, 233, 844, 236, 237, 851, 852, 853, 1536, 240, 854, 242, 243, 244, 245, 246, 247, 249, 250, 251, 252, 253, 254, 255, 857, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 264, 1241, 265, 266, 866, 1477, 267, 867, 869, 870, 271, 871, 872, 272, 1252, 273, 1591, 275, 1980, 276, 876, 877, 277, 278, 279, 1892, 1539, 880, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 282, 1799, 283, 1626, 1374, 287, 1620, 1290, 1354, 888, 291, 1956, 889, 292, 4324, 293, 4138, 891, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1515, 1617, 1961, 304, 306, 1589, 4370, 308, 309, 894, 3646, 4059, 1431, 1331, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 898, 321, 322, 899, 1958, 901, 325, 902, 326, 1491, 329, 330, 905, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 1762, 4472, 1472, 1529, 4057, 1976, 4507, 1583, 338, 911, 1711, 340, 912, 2013, 341, 4440, 917, 344, 918, 919, 921, 922, 347, 351, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 925, 1782, 926, 927, 3610, 357, 359, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 1211, 1873, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 1359, 1734, 3650, 1910, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 390, 391, 4406, 4341, 1480, 395, 1714, 1422, 396, 397, 3618, 4433, 1177, 3898, 398, 949, 950, 399, 951, 400, 1965, 4471, 952, 402, 2475, 403, 404, 4139, 1482, 3602, 4434, 3721, 1592, 1519, 1352, 4202, 4409, 1977, 1917, 407, 408, 1631, 1684, 409, 3889, 958, 959, 412, 960, 414, 415, 961, 1905, 416, 963, 417, 3675, 1833, 3974, 420, 421, 965, 966, 969, 970, 422, 1897, 423, 4133, 3830, 972, 424, 973, 427, 1708, 4141, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 434, 1606, 979, 2604, 2895, 436, 3448, 1692, 983, 3862, 4055, 4358, 984, 985, 1664, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 987, 988, 990, 451, 452, 991, 992, 1728, 994, 995, 454, 1696, 3116, 1869, 456, 1386, 999, 3879, 2698, 1001, 461, 1447, 462, 464, 4425, 1645, 1231, 1468, 472, 473, 476, 1273, 1007, 1744, 1488, 1659, 477, 1604, 481, 4313, 482, 483, 1499, 484, 1016, 4073, 1777, 1458, 4274, 487, 1775, 4205, 1526, 1697, 1017, 2000, 489, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 491, 1948, 3699, 1735, 3792, 4290, 495, 4090, 496, 2012, 1803, 3642, 1322, 498, 1021, 1022, 502, 1333, 503, 1023, 1890, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1029, 1366, 2112, 1261, 4027, 3478, 3763, 2959, 517, 3197, 1595, 3413, 1448, 518, 1675, 1797, 520, 1999, 3759, 1215, 4122, 1730, 524, 526, 3966, 3911, 529, 3289, 1821, 530, 531, 1874, 1038, 536, 537, 3767, 1929, 1041, 1042, 3683, 542, 1338, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 546, 4240, 3580, 1046, 1047, 550, 2598, 551, 552, 3819, 1259, 4062, 2841, 1050, 3515, 4301, 1052, 1053, 3738, 1567, 1270, 3857, 1055, 1257, 1238, 3662, 561, 562, 1058, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 572, 1912, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1451, 1654, 3934, 4080, 4352, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 1950, 1963, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 1559, 1250, 1555, 4114, 1818, 1075, 1076, 1077, 1704, 4448, 1078, 1079, 1786, 585, 3354, 1832, 3432, 2891, 2505, 1903, 1081, 1082, 4459, 1083, 1563, 590, 591, 1085, 594, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 600, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1087, 1088, 3888, 1368, 3827, 4103, 606, 1090, 1571, 1091, 1438, 1092, 1093, 612, 1094, 3701, 4389, 613, 1603, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1100, 1702, 1101, 1667, 1384, 623, 3700, 1788, 1600, 624, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4860, 2557, 2795, 2906, 3118, 1614, 1947, 4479, 3766, 632, 1104, 1105, 633, 1813, 636, 3706, 1110, 640, 1111, 641, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 1114, 1766, 3221, 2643, 2739, 3920, 644, 1116, 645, 646, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2369, 2695, 3293, 650, 651, 1120, 652, 1121, 3264, 655, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3994, 1319, 4467, 1802, 1227, 1623, 662, 663, 664, 1124, 1125, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 1135, 672, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 679, 1142, 1143, 681, 1145, 682, 685, 3822, 689, 690, 691, 1147, 1601, 3905, 694, 695, 1414, 1150, 1795, 1372, 1695, 1866, 4115, 1719, 698, 1920, 699, 700, 1544, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1854, 1902, 1510, 4182, 706, 707, 708, 4476, 1245, 714, 1841, 4234, 1314, 4096, 717, 1155, 4217, 1156, 723, 1157, 1627, 725, 1159, 1953, 1160, 1201, 727, 3787, 3747, 730, 1846, 3815, 2005, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 734, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1628, 3705, 1195, 3859, 1164, 1165, 1166, 1745, 1973, 1168, 3807, 4307, 1454, or 1781.

In some aspects, X⁶ of SEQ ID NO: 5014 is K or R. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 738, 4177, 1289, 740, 14, 743, 744, 17, 3477, 1548, 3051, 2982, 2877, 746, 19, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 22, 1638, 748, 24, 749, 27, 1703, 1836, 28, 3660, 29, 750, 1640, 33, 35, 36, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 44, 45, 756, 47, 48, 1952, 3122, 2551, 3718, 3484, 3577, 1308, 3960, 1378, 2994, 3080, 2589, 3681, 51, 760, 762, 3925, 3654, 763, 59, 60, 4086, 1740, 1660, 62, 1966, 63, 2438, 768, 66, 67, 68, 3816, 2599, 2706, 72, 73, 74, 3865, 1549, 1361, 3882, 773, 3713, 1942, 1312, 4501, 76, 1413, 775, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 1356, 4065, 1294, 1484, 85, 86, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 780, 1180, 92, 781, 782, 783, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 1936, 1590, 98, 99, 789, 790, 1298, 1688, 791, 792, 2007, 102, 103, 104, 105, 107, 108, 1579, 1906, 111, 798, 112, 799, 800, 1444, 801, 114, 115, 1344, 116, 802, 117, 118, 119, 121, 803, 1463, 1760, 806, 126, 128, 807, 129, 131, 808, 133, 1978, 811, 812, 135, 136, 137, 138, 814, 140, 1326, 141, 142, 143, 2344, 816, 1634, 1302, 817, 818, 147, 148, 149, 150, 151, 154, 155, 819, 820, 156, 157, 158, 161, 162, 165, 822, 168, 169, 170, 823, 172, 1651, 173, 1483, 174, 825, 176, 178, 180, 827, 181, 828, 4911, 184, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 198, 199, 200, 201, 202, 203, 205, 832, 206, 834, 207, 208, 209, 210, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 225, 228, 229, 230, 231, 842, 232, 233, 234, 238, 847, 239, 850, 851, 853, 1536, 240, 241, 242, 243, 244, 245, 247, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 864, 263, 2318, 865, 2326, 264, 1241, 266, 1477, 867, 268, 868, 269, 270, 869, 870, 271, 871, 872, 272, 873, 1252, 1591, 875, 274, 275, 276, 876, 877, 277, 278, 280, 1892, 1539, 881, 3601, 3877, 1460, 282, 1799, 284, 1626, 286, 1374, 1620, 1290, 1354, 887, 1956, 889, 292, 4324, 4138, 891, 296, 3903, 297, 3829, 3809, 4271, 3844, 1436, 300, 1617, 1961, 302, 304, 305, 2147, 1589, 4370, 307, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 318, 319, 322, 1958, 323, 324, 901, 1491, 328, 329, 4484, 907, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 3804, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 3548, 3179, 3407, 3841, 3347, 3142, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 344, 920, 921, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 354, 1782, 927, 3610, 356, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 364, 1279, 365, 1543, 366, 367, 4049, 1633, 1722, 369, 1495, 1566, 373, 1211, 1726, 1442, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 4149, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 3902, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3687, 4318, 4243, 3866, 3704, 4172, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 1584, 4093, 4453, 4210, 4009, 4264, 4339, 1738, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1336, 3894, 3576, 4314, 3695, 1850, 4362, 1815, 3638, 4454, 1661, 4504, 1359, 3650, 1305, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 1283, 3861, 3644, 4259, 1418, 1176, 4216, 1421, 3992, 4423, 4253, 3748, 4119, 1297, 1954, 4450, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 4275, 4492, 4365, 4118, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 4470, 3941, 4348, 3587, 3818, 4350, 3821, 3929, 3824, 4465, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 3627, 3777, 1371, 3685, 4258, 3812, 1581, 4124, 4508, 4500, 3652, 3972, 1528, 3717, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 3758, 4510, 3742, 1710, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1997, 1701, 4280, 4006, 1984, 3833, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1324, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 3826, 1992, 1656, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1410, 1823, 1498, 1329, 386, 940, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1859, 4183, 1403, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 3937, 3801, 1787, 1214, 4483, 4201, 1845, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 953, 401, 403, 955, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4409, 1977, 405, 1631, 1684, 409, 3889, 2117, 411, 413, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 1272, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 978, 4400, 1606, 980, 2604, 2895, 436, 3448, 2188, 438, 1692, 442, 3862, 4055, 4358, 2276, 985, 1664, 443, 4309, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3985, 3535, 1306, 4084, 3282, 1780, 448, 990, 991, 1485, 992, 1728, 993, 994, 1696, 997, 3116, 1869, 456, 1386, 1000, 3879, 2698, 460, 1001, 461, 1447, 1002, 1003, 463, 464, 4425, 465, 1004, 466, 469, 1231, 1468, 470, 1005, 476, 1273, 1744, 1488, 1659, 1604, 479, 1013, 1014, 481, 4313, 1499, 1016, 4073, 1777, 485, 4274, 487, 1775, 4205, 1526, 1697, 2000, 488, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 4473, 4085, 4401, 3783, 3765, 1538, 3870, 491, 3699, 3792, 4290, 494, 2421, 4090, 2012, 1803, 3642, 1322, 1020, 502, 1333, 504, 1890, 507, 3608, 1732, 1864, 1816, 1531, 513, 3636, 514, 1699, 1027, 1366, 4950, 4027, 3478, 2959, 1293, 3197, 1595, 3413, 518, 1032, 1033, 1675, 1797, 2315, 521, 1999, 3759, 1215, 4122, 1730, 3966, 1035, 4973, 528, 3911, 3289, 1821, 530, 532, 1874, 533, 1038, 538, 539, 3767, 1929, 3683, 1338, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 548, 549, 2598, 552, 553, 3819, 1259, 4062, 554, 2841, 3515, 1433, 1323, 4301, 555, 558, 3738, 1567, 559, 1054, 1270, 3857, 2175, 1257, 1238, 3662, 561, 1058, 563, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 1912, 573, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 4195, 4223, 1540, 4455, 4512, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1814, 4443, 3761, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 1287, 1713, 1556, 1736, 1995, 1705, 1861, 4120, 4417, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1712, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 1903, 4459, 589, 1563, 1084, 591, 592, 594, 595, 1858, 596, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 1412, 4017, 4477, 1794, 602, 4263, 3072, 2009, 1754, 3888, 603, 604, 1368, 3827, 4103, 1571, 1438, 611, 1093, 612, 1094, 3701, 4389, 614, 615, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2473, 1423, 2771, 1339, 3875, 3070, 2015, 2557, 2795, 2906, 2103, 3299, 3118, 4576, 1103, 1614, 1947, 631, 4479, 3766, 1107, 635, 1813, 636, 2431, 637, 1109, 639, 3706, 1110, 640, 642, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1568, 1766, 3221, 2643, 2739, 3920, 647, 1801, 4279, 3762, 1637, 1509, 648, 1117, 1119, 2965, 2695, 3293, 4722, 1121, 653, 1122, 3264, 655, 656, 657, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3537, 3994, 1319, 4467, 1623, 660, 1123, 664, 1126, 1128, 1129, 1130, 670, 1527, 671, 1772, 1137, 5005, 1933, 1731, 1793, 3342, 1140, 1141, 687, 3822, 1601, 1148, 693, 3905, 694, 1414, 1149, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 1920, 4999, 1544, 703, 4031, 4305, 1636, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 4028, 3989, 704, 1493, 1902, 1152, 4182, 707, 708, 709, 4476, 1375, 713, 714, 1841, 4234, 1154, 1314, 4096, 718, 719, 720, 2063, 1311, 721, 4217, 1627, 1158, 1953, 1201, 3787, 729, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1805, 3705, 1195, 3859, 1164, 1165, 2351, 2423, 1745, 1973, 3807, 4307, 1169, 1454, or 1781.

In some aspects, (a) X³ of SEQ ID NO: 5014 is not D, (b) X⁶ of SEQ ID NO: 5014 is not D, or (c) X³ of SEQ ID NO: 5014 is not D and X⁶ of SEQ ID NO: 5014 is not D. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 2144, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 2167, 52, 760, 53, 2389, 4755, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2379, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 5009, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 4817, 2260, 1626, 2082, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2338, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 4937, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2345, 4471, 952, 953, 401, 402, 2475, 403, 404, 4758, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 4919, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 2055, 1692, 982, 2388, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 4874, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 1697, 1017, 2000, 4692, 4795, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4699, 4608, 4781, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2067, 1031, 2228, 1448, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2225, 4240, 3580, 4680, 1046, 548, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4603, 4762, 4819, 2221, 4636, 4992, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 4628, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 2275, 1166, 4968, 4912, 2423, 737, 1167, 4989, 4684, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 2167, 52, 760, 53, 2389, 4934, 4951, 4755, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4691, 107, 2440, 1849, 108, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 5009, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 4596, 2020, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 4914, 4947, 196, 1391, 197, 4534, 4726, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 268, 868, 269, 4668, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 2260, 285, 1626, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 2408, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 1635, 4820, 905, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2338, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 4057, 4937, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2343, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 401, 2475, 403, 404, 4758, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 2055, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 442, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 2142, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2210, 2247, 2478, 2047, 496, 4620, 4978, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 4699, 4608, 4781, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4805, 2065, 1890, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 2067, 1031, 2228, 1448, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2084, 2225, 4240, 3580, 4680, 1046, 548, 2062, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4577, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4603, 4762, 4819, 2221, 4636, 4992, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4541, 2200, 4580, 4858, 648, 649, 1117, 4780, 4800, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 653, 654, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4606, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 4879, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4642, 722, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 2024, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4628, 4294, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4835, 2259, 4571, 2275, 1166, 4968, 2250, 2423, 737, 1167, 4989, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 2167, 52, 760, 53, 2389, 4755, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 2356, 784, 785, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4691, 107, 2440, 1849, 108, 797, 4736, 2509, 2018, 2227, 4787, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 5009, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 4914, 4947, 196, 1391, 197, 4534, 4726, 198, 199, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2448, 841, 842, 232, 233, 4782, 234, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 268, 868, 269, 4668, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 2260, 1626, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 311, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 1635, 4820, 905, 331, 4706, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4561, 333, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2338, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 4057, 4937, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2345, 4471, 952, 953, 401, 2475, 403, 404, 4758, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 2055, 1692, 982, 2388, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 1697, 1017, 2000, 4692, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2210, 2247, 2478, 2047, 496, 4620, 4978, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4699, 4608, 4781, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4805, 2065, 1890, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2067, 1031, 2228, 1448, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2225, 4240, 3580, 4680, 1046, 548, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 595, 4931, 2407, 1858, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4607, 4719, 1116, 645, 646, 4611, 2353, 4603, 4762, 4819, 2221, 4636, 4992, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4541, 2200, 4580, 4858, 648, 649, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 653, 654, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4738, 4811, 4570, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 4628, 4294, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4835, 2259, 2275, 1166, 4968, 2423, 737, 1167, 4989, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

In some aspects, (a) X³ of SEQ ID NO: 5014 is not E, (b) X⁶ of SEQ ID NO: 5014 is not E, or (c) X³ of SEQ ID NO: 5014 is not E and X⁶ of SEQ ID NO: 5014 is not E. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 52, 760, 53, 2389, 4934, 4951, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 2379, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 5009, 144, 145, 816, 4654, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 4911, 182, 4582, 4873, 4596, 2020, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4553, 4772, 4817, 2260, 285, 1626, 2082, 885, 286, 1374, 886, 2119, 2468, 287, 2408, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 303, 304, 305, 2452, 2147, 306, 2293, 1589, 893, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 2338, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 4937, 2048, 1976, 4507, 1583, 338, 2078, 2372, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2343, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 402, 2475, 403, 404, 4758, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 427, 1708, 4676, 428, 4141, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 442, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 2142, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 4795, 2480, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 1031, 2228, 1448, 518, 2057, 2305, 2133, 2061, 4526, 4617, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2084, 4240, 3580, 4680, 1046, 548, 2062, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4747, 1614, 1947, 2237, 630, 631, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4577, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 1117, 4780, 4800, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4606, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 4879, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4642, 722, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 730, 731, 2024, 1846, 2507, 2368, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 4571, 2275, 1166, 4968, 2250, 4912, 2423, 737, 1167, 4989, 4684, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 2144, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 2167, 52, 760, 53, 2389, 4934, 4951, 4755, 761, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 2379, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 4596, 2020, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 4817, 2260, 285, 1626, 2082, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 1620, 1290, 2425, 2482, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 890, 294, 295, 4138, 891, 2297, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 375, 2343, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 401, 402, 2475, 403, 404, 4758, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 421, 965, 966, 967, 4919, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 2188, 437, 438, 2055, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 2474, 442, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 453, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 4874, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4846, 4650, 4595, 2195, 4681, 2142, 487, 4710, 1775, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 4795, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 4699, 4608, 4781, 499, 2049, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 2067, 1031, 2228, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 4240, 3580, 4680, 1046, 548, 2062, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 1086, 601, 4017, 4477, 1794, 2483, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4577, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4603, 4762, 4819, 2221, 4636, 4992, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 1117, 4780, 4800, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 2456, 4606, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 677, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 718, 1155, 719, 720, 2063, 1311, 721, 4642, 722, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 2024, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4628, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 4571, 1166, 4968, 2250, 4912, 2423, 737, 1167, 4989, 4684, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781. In some aspects, the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 52, 760, 53, 2389, 4934, 4951, 761, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 2379, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 144, 145, 816, 4654, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 4911, 182, 4582, 4873, 4596, 2020, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4689, 281, 878, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4553, 4772, 4817, 2260, 285, 1626, 2082, 885, 286, 1374, 886, 2119, 2468, 287, 1620, 1290, 2425, 2482, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 890, 294, 295, 4138, 891, 2297, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 303, 304, 305, 2452, 2147, 306, 2293, 1589, 893, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 2048, 1976, 4507, 1583, 338, 2078, 2372, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 375, 2343, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 402, 2475, 403, 404, 4758, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 3675, 1833, 3974, 419, 964, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 427, 1708, 4676, 428, 4141, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 2188, 437, 438, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 2474, 442, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 453, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4846, 4650, 4595, 2195, 4681, 2142, 487, 4710, 1775, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 4795, 2480, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 499, 2049, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 1031, 2228, 518, 2057, 2305, 2133, 2061, 4526, 4617, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1042, 3683, 2100, 4853, 2300, 2165, 540, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 4240, 3580, 4680, 1046, 548, 2062, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 1086, 601, 4017, 4477, 1794, 2483, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 4818, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4850, 1103, 4747, 1614, 1947, 2237, 630, 631, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4577, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 1117, 4780, 4800, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 2456, 4606, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 677, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 718, 1155, 719, 720, 2063, 1311, 721, 4642, 722, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 730, 731, 2024, 1846, 2507, 2368, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 4571, 1166, 4968, 2250, 4912, 2423, 737, 1167, 4989, 4684, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

In some aspects, X³, X⁶, and X¹ of SEQ ID NO: 5014 are basic amino acid residues. In some aspects, X³, X⁶, and X⁴ of SEQ ID NO: 5014 are basic amino acid residues. In some aspects, X³, X⁶, X¹, and X⁴ of SEQ ID NO: 5014 are basic amino acid residues.

In various aspects, the present disclosure provides a viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region of the VP capsid polypeptide comprises at least two basic amino acid residues and no more than one acidic amino acid residue.

In some aspects, the VP capsid polypeptide comprises one or more features selected from the group consisting of: (a) the 581 to 589 region comprises two or more basic amino acid residues, (b) X³, X⁶, X¹, or X⁴ of SEQ ID NO: 5014, or any combination thereof are basic amino acid residues, and (c) the 581 to 589 region comprises no more than one acidic amino acid residue.

In some aspects, the VP capsid polypeptide comprises two or more of the features. In some aspects, the VP capsid polypeptide comprises three of the features. In some aspects, the acidic amino acid residue is D or E. In some aspects, the basic amino acid residues are K, R, or H.

In various aspects, the present disclosure provides a viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013.

In some aspects, the 581 to 589 region comprises a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013.

In various aspects, the present disclosure provides a viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 2514-SEQ ID NO: 4513.

In some aspects, the 581 to 589 region comprises a sequence of any one of SEQ ID NO: 2514-SEQ ID NO: 4513. In some aspects, the 581 to 589 region confers increased retina tissue tropism compared to a wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1. In some aspects, the retina tissue tropism is at least 1.5-fold, at least 2-fold, at least 2.5-fold, at least 3-fold, at least 3.5-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 75-fold, at least 100-fold, at least 200-fold, or at least 500-fold higher than the wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1.

In some aspects, the 581 to 589 region further confers increased retinal pigment epithelium tissue tropism compared to a wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1. In some aspects, the 581 to 589 region confers decreased photoreceptor tissue-tropism compared to a wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1. In some aspects, the photoreceptor tissue comprises rod photoreceptor cells, cone photoreceptor cells, or a combination thereof. In some aspects, the VP capsid polypeptide comprises an amino acid sequence at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 98.5%, at least 99%, or at least 99.5% identical to SEQ ID NO: 1.

In some aspects, the VP capsid polypeptide has a sequence of SEQ ID NO: 2, wherein residues 581 to 589 of SEQ ID NO: 2 (X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹) correspond to the 581 to 589 region. In some aspects, the VP capsid polypeptide is capable of assembling into a recombinant viral capsid. In some aspects, the VP capsid polypeptide comprises at least one amino acid substitution as compared to each of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, and SEQ ID NO: 8. In some aspects, the 581 to 589 region comprises a net positive charge at pH 7.4.

In some aspects, the VP capsid polypeptide further comprises one or more mutations outside of the 581 to 589 region relative to a wild type VP capsid polypeptide of SEQ ID NO: 1. In some aspects, the 581 to 589 region confers on a recombinant viral capsid assembled from the VP capsid polypeptide improved stability compared to a wild type AAV capsid comprising a peptide of SEQ ID NO: 1. In some aspects, the 581 to 589 region confers lower toxicity upon administration to a subject compared to a wild type VP capsid polypeptide of SEQ ID NO: 1. In some aspects, the VP capsid polypeptide further comprises one or more mutations outside of the 581 to 589 region that contributes to reduced production of neutralizing antibodies relative to a wild type VP capsid polypeptide of SEQ ID NO: 1. In some aspects, the VP capsid polypeptide further comprises one or more mutations outside of the 581 to 589 region that improves manufacturability relative to a wild type VP capsid polypeptide of SEQ ID NO: 1.

In various aspects, the present disclosure provides a recombinant viral adeno-associated virus (rAAV) capsid comprising a VP capsid polypeptide as described herein, wherein the rAAV capsid preferentially targets retina tissue.

In some aspects, the rAAv further comprises a VP2 polypeptide comprising the 581 to 589 region and a VP3 polypeptide comprising the 581 to 589 region.

In various aspects, the present disclosure provides a recombinant adeno-associated virus (rAAV), comprising a VP capsid polypeptide as described herein assembled into a recombinant viral capsid and a payload encapsidated by the recombinant viral capsid.

In some aspects, the rAAV preferentially targets retina tissue. In some aspects, the rAAV further comprises a VP2 polypeptide comprising the 581 to 589 region and a VP3 polypeptide comprising the 581 to 589 region. In some aspects, the payload encodes a therapeutic polynucleotide or a therapeutic peptide. In some aspects, the payload encodes a guide RNA, a tRNA, a suppressor tRNA, a siRNA, a miRNA, an mRNA, a shRNA, a circular RNA, or an antisense oligonucleotide (ASO), a ribozyme, a DNAzyme, an aptamer, or any combination thereof. In some aspects, the guide RNA is a CRISPR/Cas guide RNA or an ADAR guide RNA. In some aspects, the payload encodes a component of a CRISPR/Cas system, an adenosine deaminase acting on RNA (ADAR) enzyme, a transcriptional activator, or a transcriptional repressor.

In various aspects, the present disclosure provides a pharmaceutical composition comprising a VP capsid polypeptide as described herein, a rAAV capsid as described herein, or a rAAV as described herein.

In various aspects, the present disclosure provides a method of delivering a payload to a retina tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region comprising at least one substitution relative to SEQ ID NO: 9, and wherein the 581 to 589 region comprises one or more basic amino acid residues.

In various aspects, the present disclosure provides a method of delivering a payload to a retina tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513.

In various aspects, the present disclosure provides a method of delivering a payload to a retina tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide as described herein.

In various aspects, the present disclosure provides a method of delivering a payload to a retina tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region comprising at least one substitution relative to SEQ ID NO: 9, and wherein the 581 to 589 region comprises one or more basic amino acid residues; and (ii) delivering the payload to the retina tissue.

In various aspects, the present disclosure provides a method of delivering a payload to a retina tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513; and (ii) delivering the payload to the retina tissue.

In various aspects, the present disclosure provides a method of delivering a payload to a retina tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide as described herein; and (ii) delivering the payload to the retina tissue.

In some aspects, the method comprises administering the rAAV via intravitreal administration. In some aspects, the method comprises administering the rAAV via subretinal injection, topical mucosal administration, or systemic administration. In some aspects, the method further comprises expressing a therapeutic polypeptide or a therapeutic polynucleotide encoded by the payload. In some aspects, the method further comprises producing a therapeutic effect upon expression of the payload. In some aspects, the therapeutic effect is produced upon administration of from 1×10⁵ to 5×10¹⁴ rAAVs. In some aspects, the method comprises administering an amount of the rAAV sufficient to produce the therapeutic effect without producing a toxicity in the subject.

In various aspects, the present disclosure provides a method of treating a condition in a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region comprising at least one substitution relative to SEQ ID NO: 9, and wherein the 581 to 589 region comprises one or more basic amino acid residues.

In various aspects, the present disclosure provides a method of treating a condition in a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513.

In various aspects, the present disclosure provides a method of treating a condition in a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide as described herein.

In some aspects, the method further comprises expressing the payload in a retina tissue of the subject. In some aspects, the method further comprises producing a therapeutic effect in the subject.

In various aspects, the present disclosure provides a method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region comprising at least one substitution relative to SEQ ID NO: 9, and wherein the 581 to 589 region comprises one or more basic amino acid residues; and (ii) expressing the payload in a retina tissue of the subject, thereby treating the condition in the subject.

In various aspects, the present disclosure provides a method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513; and (ii) expressing the payload in a retina tissue of the subject, thereby treating the condition in the subject.

In various aspects, the present disclosure provides a method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide as described herein; and (ii) expressing the payload in a retina tissue of the subject, thereby treating the condition in the subject.

In various aspects, the present disclosure provides a method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide as described herein; (ii) delivering the payload to a retina tissue of the subject; and (iii) producing a therapeutic effect in the retina tissue, thereby treating the condition.

In some aspects, the method comprises administering the rAAV via intravitreal administration. In some aspects, the method comprises administering the rAAV via subretinal injection, topical mucosal administration, or systemic administration. In some aspects, the condition is an ocular condition. In some aspects, the ocular condition is achromatopsia, macular degeneration, cataracts, choroideremia, glaucoma, optical neuropathy, Marfan syndrome, myopia, polypoidal choroidal vasculopathy, retinitis pigmentosa, Stargardt disease, Usher syndrome, Leber congenital amaurosis, Leber hereditary optical neuropathy, Uveal melanoma, or X-linked retinoschisis. In some aspects, the ocular condition is Stargardt disease.

In some aspects, the method further comprises delivering the rAAV to a retina tissue with higher tissue tropism than a wild type AAV5 capsid comprising a peptide of SEQ ID NO: 1. In some aspects, the method further comprises delivering the rAAV to a retina tissue with higher tissue tropism than for photoreceptor tissue. In some aspects, the method comprises delivering the rAAV to a retina tissue with at least 2.5-fold, at least 3-fold, at least 3.5-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 75-fold, at least 100-fold, at least 200-fold, at least 500-fold higher, or at least 1000-fold higher tissue tropism than a wild type AAV5 capsid comprising a peptide of SEQ ID NO: 1. In some aspects, the method comprises administering from 1×10⁵ to 5×10¹⁴ rAAVs.

In some aspects, the payload encodes a therapeutic protein, therapeutic polynucleotide, a guide RNA, a tRNA, a suppressor tRNA, a siRNA, a miRNA, an mRNA, a shRNA, a circular RNA, an antisense oligonucleotide (ASO), a ribozyme, a DNAzyme, an aptamer, or any combination thereof. In some aspects, the guide RNA is a CRISPR/Cas guide RNA or an ADAR guide RNA. In some aspects, the therapeutic protein is selected from the group consisting of CNGB3, NOS2A, CFH, CF, C2, C3, CFB, HTRA1/LOC, MMP-9, TIMP-3, SLC16A8, GEMIN4, CYP51A1, RIC1, TAPT1, TAF1A, WDR87, APE1, MIP, Cx50, GJA3, GJA8, CRYAA, CRYBB2, PRX, POLR3B, XRCC1, ZNF350, EPHA2, REP1, CALM2, MPP-7, Optineurin, LOX1, CYP1B1, CAV1/2, MYOC, PITX2, FOXC1, PAX6, LTBP2, Complex I, ND, OPA1, RPE65, FBN1, TGFBR2, MTHFR, MTR, MTRR, HGF, C-MET, UMODL1, MMP-1/2, CBS, IGF-1, UHRF1BP1L, PTPRR, PPFIA2, P4HA2, SERPING1, PEDF, ARMS2-HTRA1, FGD6, ABCG1, LOC387715, CETP, NRL, RDH12, PRPH2 (RDS), RHO, RPGR, SNRNP200, NR2E3, IMPDH1, CRX, HK1, IMPDH2, PRPF3, AGBL5, ABCA1, ABCA4, CRB1, USH2A, NRP1, ND4, RLBP1, PTEN, BAP1, GNAQ, GNA11, DDEF1, SF3B1, EIF1AX, CDKN2A, p14ARF, HERC2/OCA2, VEGF, and RS1. In some aspects, the therapeutic polynucleotide targets an mRNA encoding a protein selected from the group consisting of CNGB3, NOS2A, CFH, CF, C2, C3, CFB, HTRA1/LOC, MMP-9, TIMP-3, SLC16A8, GEMIN4, CYP51A1, RIC1, TAPT1, TAF1A, WDR87, APE1, MIP, Cx50, GJA3, GJA8, CRYAA, CRYBB2, PRX, POLR3B, XRCC1, ZNF350, EPHA2, REP1, CALM2, MPP-7, Optineurin, LOX1, CYP1B1, CAV1/2, MYOC, PITX2, FOXC1, PAX6, LTBP2, Complex I, ND, OPA1, RPE65, FBN1, TGFBR2, MTHFR, MTR, MTRR, HGF, C-MET, UMODL1, MMP-1/2, CBS, IGF-1, UHRF1BP1L, PTPRR, PPFIA2, P4HA2, SERPING1, PEDF, ARMS2-HTRA1, FGD6, ABCG1, LOC387715, CETP, NRL, RDH12, PRPH2 (RDS), RHO, RPGR, SNRNP200, NR2E3, IMPDH1, CRX, HK1, IMPDH2, PRPF3, AGBL5, ABCA1, ABCA4, CRB1, USH2A, NRP1, ND4, RLBP1, PTEN, BAP1, GNAQ, GNA11, DDEF1, SF3B1, EIF1AX, CDKN2A, p14ARF, HERC2/OCA2, VEGF, or RS1. In some aspects, the payload encodes a therapeutic polynucleotide targeting ABCA1, ABCA4, or CRB1 or a transgene encoding ABCA1, ABCA4, or CRB1. In some aspects, the payload encodes a component of a CRISPR/Cas system, an adenosine deaminase acting on RNA (ADAR) enzyme, a transcriptional activator, or a transcriptional repressor. In some aspects, the component of the CRISPR/Cas system comprises a Cas3, a Cas8, a Cas10, a Cas9, a Cas4, a Cas12, a Cas13, a guide RNA, or a combination thereof. In some aspects, the ADAR enzyme is ADAR1 or ADAR2. In some aspects, the transcriptional activator is VP64. In some aspects, the transcriptional repressor is KRAB.

In some aspects, the method further comprises expressing a therapeutic polypeptide or a therapeutic polynucleotide encoded by the payload. In some aspects, the method comprises expressing the therapeutic polypeptide or the therapeutic polynucleotide at a higher level in a retina tissue compared to a wild type AAV5 capsid comprising a peptide of SEQ ID NO: 1. In some aspects, the method comprises expressing the therapeutic polypeptide or the therapeutic polynucleotide in a retina tissue at a level that is at least 3-fold, at least 3.5-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 75-fold, at least 100-fold, at least 200-fold, at least 500-fold higher, or at least 1000-fold higher compared to the wild type AAV5 capsid. In some aspects, the method comprises producing a toxicity in the subject that is lower than a toxicity produced upon administration of a comparable number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1. In some aspects, the method comprises producing a toxicity in the subject that is lower than a toxicity produced upon administration of a number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1 sufficient to deliver a comparable number of payloads to a retina tissue. In some aspects, the method comprises producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1. In some aspects, the method comprises producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV2 capsids. In some aspects, the method comprises producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV8 capsids. In some aspects, the method comprises producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV9 capsids. In some aspects, the method comprises producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1 sufficient to deliver a comparable number of payloads to a retina tissue.

In various aspects, the present disclosure provides a rAAV capsid as described herein, a rAAV as described herein, or a pharmaceutical composition as described herein for use as a medicament.

In various aspects, the present disclosure provides a rAAV capsid as described herein, a rAAV as described herein, or a pharmaceutical composition as described herein for use in a method of treating an ocular condition.

In some aspects, the ocular condition is achromatopsia, macular degeneration, cataracts, choroideremia, glaucoma, optical neuropathy, Marfan syndrome, myopia, polypoidal choroidal vasculopathy, retinitis pigmentosa, Stargardt disease, Usher syndrome, Leber congenital amaurosis, Leber hereditary optical neuropathy, Uveal melanoma, or X-linked retinoschisis. In some aspects, the ocular condition is Stargardt disease.

In various aspects, the present disclosure provides a viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513.

In some aspects, the 581 to 589 region comprises a sequence of any one of SEQ ID NO: 2014-SEQ ID NO: 2513.

In various aspects, the present disclosure provides a viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 4514-SEQ ID NO: 5013.

In some aspects, the 581 to 589 region comprises a sequence of any one of SEQ ID NO: 4514-SEQ ID NO: 5013.

In various aspects, the present disclosure provides a recombinant viral adeno-associated virus (rAAV) capsid comprising a VP capsid polypeptide as described herein, wherein the rAAV capsid preferentially targets retinal pigment epithelium tissue.

In various aspects, the present disclosure provides a recombinant viral adeno-associated virus (rAAV) capsid comprising a VP capsid polypeptide as described herein, wherein the rAAV capsid preferentially targets choroid tissue.

In various aspects, the present disclosure provides a method of delivering a payload to a retinal pigment epithelium tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013.

In various aspects, the present disclosure provides a method of delivering a payload to a retinal pigment epithelium tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013.

In various aspects, the present disclosure provides a method of delivering a payload to a choroid tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013; and (ii) delivering the payload to the choroid tissue.

In various aspects, the present disclosure provides a method of delivering a payload to a retinal pigment epithelium tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013; and (ii) delivering the payload to the retinal pigment epithelium tissue.

In various aspects, the present disclosure provides a method of treating a condition in a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013.

In various aspects, the present disclosure provides a method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013; and (ii) expressing the payload in a retinal pigment epithelium tissue of the subject, thereby treating the condition in the subject.

INCORPORATION BY REFERENCE

All references cited herein are incorporated by reference to the same extent as if each individual publication, database entry (e.g., Genbank sequences or GeneID entries), patent application, or patent, was specifically and individually indicated incorporated by reference in its entirety, for all purposes. This statement of incorporation by reference is intended by Applicants, pursuant to 37 C.F.R. § 1.57(b)(1), to relate to each and every individual publication, database entry (e.g., Genbank sequences or GeneID entries), patent application, or patent, each of which is clearly identified in compliance with 37 C.F.R. § 1.57(b)(2), even if such citation is not immediately adjacent to a dedicated statement of incorporation by reference. The inclusion of dedicated statements of incorporation by reference, if any, within the specification does not in any way weaken this general statement of incorporation by reference. Citation of the references herein is not intended as an admission that the reference is pertinent prior art, nor does it constitute any admission as to the contents or date of these publications or documents.

BRIEF DESCRIPTION OF THE DRAWINGS

These and other features, aspects, and advantages of the present invention will become better understood with regard to the following description, and accompanying drawings where:

FIG. 1 is a schematic of the high throughput AAV capsid engineering system for identification of tissue-tropic sequences for intravitreal administration. A capsid library, selected for the ability to assemble into viral capsids, is administered to a non-human primate (NHP) by intravitreal administration. Tissues, including eye tissues such as retina, optic nerve, choroid, aqueous humor, and vitreous humor, are recovered, and the capsids accumulated in each tissue are sequenced. The resulting sequencing data are fed into a machine learning-powered bioinformatics pipeline to identify viral capsid polypeptide sequences and biophysical properties that promote tissue-specific transduction/infection.

FIG. 2A provides a side view (top panel) and top view (bottom panel) of key residues of known AAV capsids that have been shown to interact with target cells.

FIG. 2B illustrates salient features of the AAV capsid library described in EXAMPLE 1, showing the region of introduced diversity, with residue numbering corresponding to the numbering of amino acids in AAV5 VP1.

FIG. 3 is a bar graph showing viral genomes per milligram of tissue recovered from various eye tissues following NHP capsid library screening performed as illustrated in FIG. 1. Screening was performed independently in two non-human primates (“NHP1” and “NHP2”).

FIG. 4 is a bar graph showing the number of unique variant capsid polypeptide sequences (“#of varAA”) identified within various tissues from two NHPs (“NHP #1” and “NHP #2”) administered a recombinant AAV library via intravitreal injection.

FIG. 5A-FIG. 5D are sequence logo plots depicting relative amino acid enrichment and depletion at each amino acid position of the 581 to 589 region in the retina from two NHPs administered a recombinant AAV library via intravitreal injection. FIG. 5A illustrates enrichment in retina versus other remaining eye tissues (“other”) in example NHP1. FIG. 5B illustrates enrichment in retina versus other remaining eye tissues (“other”) in a second example NHP2. FIG. 5C illustrates enrichment in retina versus vitreous/aqueous humor (“humor”) in a first NHP. FIG. 5D illustrates enrichment in retina versus vitreous/aqueous humor (“humor”) in a second NHP.

FIG. 6A and FIG. 6B are heatmaps showing relative amino acid enrichment in retina at each amino acid position of the 581 to 589 region (corresponding to positions 581-589 in the VP1 sequence) for a first (FIG. 6A) and second (FIG. 6B) NHP, administered a recombinant AAV library via intravitreal injection. The enrichment shown is relative to “ST2”, the diversity of the assembled capsid library pre-infusion.

FIG. 7 is a bar graph showing numbers of AAV capsid polypeptide variants observed in a primary screen of an engineered AAV capsid library. Counts are provided for the total number of variants found in either retina or RPE tissue (“total”), the number of variants found in only that tissue (“tissue_unique”), the number of tissue-unique variants found in more than one non-human primate (“multiple_nhps”), and the number of tissue-unique variants found in more than one replicate (“multiple_reps,” includes variants found in multiple NHPs).

FIG. 8 is a violin plot comparing the predictive probability (“retina_score”) of having retina-specific tropism for retina tissue-unique variants separated based on numbers of observations, either a single observation (“n”) or multiple observations (“y”), within non-human primates (“multiple_nhps”) or within all replicates (“multiple_reps”).

FIG. 9 is a box and whisker plot showing the predictive probability (“Average ML Score”) of having retina-specific tropism for all retina tissue-unique variants identified from the primary screen (“observed”) or generated through machine learning models (“synthetic”). Subsets of observed retina variants found in multiple NHPs (“Multiple NHPs”) or multiple replicates (“Multiple Replicates”) are noted, along with synthetic variants generated using three distinct modeling strategies (“Input optimization”, “Sample PWM”, and “Sample uniform”).

FIG. 10 is plot showing the predictive probability (“Average ML Score”) of having retina-specific tropism for retina tissue-unique variants selected for inclusion in the secondary screen that were identified from the primary screen (“observed”) or through machine learning models (“synthetic”).

DETAILED DESCRIPTION OF THE INVENTION

Unless described otherwise, all technical and scientific terms used herein have the meaning commonly understood by one of ordinary skill in the art to which the invention pertains.

Unless otherwise stated, whenever a range is recited, the range is inclusive of the recited endpoints. For example, the region from amino acid residue 581 to amino acid residue 589 of SEQ ID NO: 1 includes amino acid residues 581 and 589.

“Homology” or “identity” or “similarity” can refer to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence which can be aligned for purposes of comparison. When a position in the compared sequence can be occupied by the same base or amino acid, then the molecules can be homologous at that position. A degree of homology between sequences can be a function of the number of matching or homologous positions shared by the sequences. An “unrelated” or “non-homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences of the disclosure. Sequence homology can refer to a % identity of a sequence to a reference sequence. As a practical matter, whether any particular sequence can be at least 50%, 60%, 70%, 77.7%, 80%, 88.8%, 85%, 90%, 92%, 95%, 96%, 97%, 98% or 99% identical to any sequence described herein (which can correspond with a particular nucleic acid sequence described herein), such particular polypeptide sequence can be determined conventionally using known computer programs such the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711). When using Bestfit or any other sequence alignment program to determine whether a particular sequence is, for instance, 95% identical to a reference sequence, the parameters can be set such that the percentage of identity can be calculated over the full length of the reference sequence and that gaps in sequence homology of up to 5% of the total reference sequence can be allowed. The term percent “identity” or percent “homology,” in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that have a specified percentage of nucleotides or amino acid residues that are the same, when compared and aligned for maximum correspondence, as measured using one of the sequence comparison algorithms described below (e.g., BLASTP and BLASTN or other algorithms available to persons of skill) or by visual inspection. Depending on the application, the percent “identity” can exist over a region of the sequence being compared, e.g., over a functional domain, or, alternatively, exist over the full length of the two sequences to be compared. For sequence comparison, typically one sequence acts as a reference sequence to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters. For purposes herein, determination of percent identity and sequence similarity is performed using the BLAST algorithm, which is described in Altschul et al., J. Mol. Biol. 215:403-410 (1990). Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (www.ncbi.nlm.nih.gov/). For example, where an amino acid sequence consisting of 9 residues is compared with another 9 residue amino acid sequence, if 8 residues match then the sequences have 88.8% identity, if 7 residues match then the sequences have 77.7% identity.

In some cases, the identity between a reference sequence (query sequence, e.g., a sequence of the disclosure) and a subject sequence, also referred to as a global sequence alignment, can be determined using the FASTDB computer program. In some embodiments, parameters for a particular embodiment in which identity can be narrowly construed, used in a FASTDB amino acid alignment, can include: Scoring Scheme=PAM (Percent Accepted Mutations) 0, k-tuple=2, Mismatch Penalty=1, Joining Penalty=20, Randomization Group Length=0, Cutoff Score=1, Window Size=sequence length, Gap Penalty=5, Gap Size Penalty=0.05, Window Size=500 or the length of the subject sequence, whichever can be shorter. According to this embodiment, if the subject sequence can be shorter than the query sequence due to N- or C-terminal deletions, not because of internal deletions, a manual correction can be made to the results to take into consideration the fact that the FASTDB program does not account for N- and C-terminal truncations of the subject sequence when calculating global percent identity. For subject sequences truncated at the N- and C-termini, relative to the query sequence, the percent identity can be corrected by calculating the number of residues of the query sequence that can be lateral to the N- and C-terminal of the subject sequence, which can be not matched/aligned with a corresponding subject residue, as a percent of the total bases of the query sequence. A determination of whether a residue can be matched/aligned can be determined by results of the FASTDB sequence alignment. This percentage can be then subtracted from the percent identity, calculated by the FASTDB program using the specified parameters, to arrive at a final percent identity score. This final percent identity score can be used for the purposes of this embodiment. In some cases, only residues to the N- and C-termini of the subject sequence, which can be not matched/aligned with the query sequence, can be considered for the purposes of manually adjusting the percent identity score. That is, only query residue positions outside the farthest N- and C-terminal residues of the subject sequence can be considered for this manual correction. For example, a 90-residue subject sequence can be aligned with a 100-residue query sequence to determine percent identity. The deletion occurs at the N-terminus of the subject sequence, and therefore, the FASTDB alignment does not show a matching/alignment of the first 10 residues at the N-terminus. The 10 unpaired residues represent 10% of the sequence (number of residues at the N- and C-termini not matched/total number of residues in the query sequence) so 10% can be subtracted from the percent identity score calculated by the FASTDB program. If the remaining 90 residues were perfectly matched, the final percent identity can be 90%. In another example, a 90-residue subject sequence can be compared with a 100-residue query sequence. This time the deletions can be internal deletions, so there can be no residues at the N- or C-termini of the subject sequence which can be not matched/aligned with the query. In this case, the percent identity calculated by FASTDB can be not manually corrected. Once again, only residue positions outside the N- and C-terminal ends of the subject sequence, as displayed in the FASTDB alignment, which can be not matched/aligned with the query sequence can be manually corrected for.

Peptide sequences for use in the present invention may comprises one or more substitutions, i.e. amino acid substitutions. The substitutions may be conservative amino acid substitutions. Therefore, peptide sequences for use in the present invention may include one or more conservative amino acid substitutions, such that the resulting sequence has a similar amino acid sequence and/or retains the same function. The skilled person is aware that various amino acids have similar biochemical properties and thus are “conservative”. One or more such amino acids of a protein, polypeptide or peptide can often be substituted by one or more other such amino acids without eliminating a desired activity of that protein, polypeptide or peptide. Thus, the amino acids glycine, alanine, valine, leucine and isoleucine can often be substituted for one another (amino acids having aliphatic side chains). Of these possible substitutions it is preferred that glycine and alanine are used to substitute for one another (since they have relatively short side chains) and that valine, leucine and isoleucine are used to substitute for one another (since they have larger aliphatic side chains which are hydrophobic). Other amino acids which can often be substituted for one another include: phenylalanine, tyrosine and tryptophan (amino acids having aromatic side chains); lysine, arginine and histidine (amino acids having basic side chains); aspartate and glutamate (amino acids having acidic side chains); asparagine and glutamine (amino acids having amide side chains); and cysteine and methionine (amino acids having sulfur containing side chains). It should be appreciated that amino acid substitutions within the scope of the present invention can be made using naturally occurring or non-naturally occurring amino acids. For example, the methyl group on an alanine may be replaced with an ethyl group, and/or minor changes may be made to the peptide backbone. Whether or not natural or synthetic amino acids are used, it is preferred that only L-amino acids are present. Substitutions of this nature are often referred to as “conservative substitutions”.

As used herein, “tropism” of a rAAV for a tissue may refer to the ability of a given rAAV to preferentially infect a given cell type or tissue. A degree of tropism may be determined by a ratio of an infection rate in a targeted tissue to an infection rate in a different, non-targeted tissue. As used herein, increased tropism for a given cell type or tissue, such as increased tropism conferred by a 581 to 589 region, is determined relative to a wild type AAV5 capsid. As used herein, “detargeting” of a rAAV to a tissue may refer to the ability of a given rAAV to avoid infecting a detargeted tissue or cell type while infecting one or more other tissues or cell types. A degree of detargeting may be determined by a ratio of an infection rate in a detargeted tissue to an infection rate of a different, non-detargeted tissue. As used herein, increased detargeting for a given cell type or tissue, such as increased detargeting conferred by a 581 to 589 region, is determined relative to a wild type AAV5 capsid.

As used herein, “tissue tropism” refers to a preference of a virus having an engineered VP capsid polypeptide of the present disclosure to infect a given tissue or be enriched in or accumulate in a given tissue. A “tissue-tropic” rAAV may specifically target or infect a first tissue or set of tissues and may not target or infect a second tissue or set of tissues. For example, a “retinal tissue-tropic” rAAV may specifically target or infect retinal tissue and may not target or infect vitreous humor, aqueous humor, or other tissues. A “tissue-detargeted” rAAV may specifically avoid targeting or avoid infection of the detargeted tissue or set of tissues while infecting a second tissue or set of tissues. For example, a “liver-detargeted” rAAV may not target or infect liver tissue but may infect one or more other tissues, such as ocular, nervous, muscle, skin, bone, and/or other tissue. In another example, a “photoreceptor-detargeted” rAAV may not target or infect photoreceptor cells but may infect one or more other cell or tissue types, such as aqueous humor, retina, retinal pigment epithelium, optic nerve, vitreous humor, and/or other tissue or cells. In another example, a “choroid-detargeted” rAAV may not target or infect choroid tissue but may infect one or more other tissue or cell types, such as aqueous humor, retina, retinal pigment epithelium, optic nerve, vitreous humor, and/or other tissue or cells. Tissue tropism or tissue detargeting, when used as a relative term and depending on the context in which it is described herein, refers to an increase or decrease in tissue tropism of a given rAAV virion having a first capsid polypeptide in a first tissue as compared to a second tissue and/or refers to an increase or decrease in tissue tropism of a given rAAV virion having a first capsid polypeptide to an rAAV virion having a second capsid polypeptide. In some embodiments, the first tissue can be a group of tissues. In some embodiments, the second tissue can be a group of tissues. For example, the first tissue may be retinal tissue and the second tissue may be a different eye tissue (e.g., aqueous humor, choroid, optic nerve, vitreous humor, or remaining eye tissue). In another example, tissue tropism can refer to cellular homing, such as targeting a retinal pigment epithelial cell, a photoreceptor cell (e.g., rod cells, cone cells, or a combination thereof), or both.

In some embodiments, the rAAV virions of the present disclosure may also be referred to as preferentially targeting a given tissue or having tissue selectivity for a given tissue. For example, an rAAV virion that preferentially targets retinal tissue may specifically target or infect retinal tissue and may not target or infect vitreous humor, aqueous humor, or other tissues. As another example, an rAAV virion that has retinal tissue selectivity may specifically target or infect retinal tissue and may not target or infect vitreous humor, aqueous humor, or other tissues.

For simplicity throughout this disclosure, viral capsid protein is generally referred to as “VP.” Viral capsid protein is referred to as VP1 when referencing AAV5 VP1 positional notation. In all cases, viral capsid sequences and mutations disclosed herein should be understood as pertaining to all isoforms of the capsid protein (VP1, VP2, and VP3), as a mixture of these isoforms assemble to form virions. The positional amino acid residue designations “581 to 589” are relative to the translational start of the VP1 polypeptide and should be adjusted accordingly to the relative start sites of VP2 and VP3. It should be understood that the present disclosure, when describing any particular VP1 sequence with mutations at particular amino acid residue positions, necessarily also encompasses corresponding mutations in VP2 and VP3. For example, any consensus sequence or specific sequence of a VP1 capsid protein having one or more mutations in the 581 to 589 region, corresponding to amino acid residues 581 to 589 of VP1, also encompasses VP2 and VP3 capsid proteins having said one or more mutations in an amino acid residue region in VP2 and VP3 corresponding to the amino acid residues of the VP1 581 to 589 region. For example, the amino acid residues of the 581 to 589 region of VP1 (SEQ ID NO: 1; MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLVLPGYNYLGPGNG LDRGEPVNRADEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLADDTSFGGNLG KAVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPS GSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRV VTKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRD WQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVV GNGTEGCLPAFPPQVFTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFT YNFEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKN WFPGPMGRTQGWNLGSGVNRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSN TYALENTMIFNSQPANPGTTATYLEGNMLITSESETQPVNRVAYNVGGQMATNNQSST TAPATGTYNLQEIVPGSVWMERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLKHPPPM MLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEMEWELKKENSKRWNPEIQYTNNYN DPQFVDFAPDSTGEYRTTRPIGTRYLTRPL) correspond to the amino acid residues of the 445 to 453 region of VP2 (SEQ ID NO: 10; TAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPSGSQQLQIPAQPASSLGADTMSAG GGGPLGDNNQGADGVGNASGDWHCDSTWMGDRVVTKSTRTWVLPSYNNHQYREIKS GSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRDWQRLINNYWGFRPRSLRVKIFNIQ VKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVVGNGTEGCLPAFPPQVFTLPQYGY ATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFTYNFEEVPFHSSFAPSQNLFKLAN PLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKNWFPGPMGRTQGWNLGSGVNRA SVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSNTYALENTMIFNSQPANPGTTATY LEGNMLITSESETQPVNRVAYNVGGQMATNNQSSTTAPATGTYNLQEIVPGSVWMERD VYLQGPIWAKIPETGAHFHPSPAMGGFGLKHPPPMMLIKNTPVPGNITSFSDVPVSSFITQ YSTGQVTVEMEWELKKENSKRWNPEIQYTNNYNDPQFVDFAPDSTGEYRTTRPIGTRY LTRPL) and to the amino acid residues of 389 to 397 region of VP3 (SEQ ID NO: 11; MSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRVVTKSTRTWVLPSYNNHQY REIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRDWQRLINNYWGFRPRSLRVK IFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVVGNGTEGCLPAFPPQVFTLPQ YGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFTYNFEEVPFHSSFAPSQNLFK LANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKNWFPGPMGRTQGWNLGSGV NRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSNTYALENTMIFNSQPANPGTT ATYLEGNMLITSESETQPVNRVAYNVGGQMATNNQSSTTAPATGTYNLQEIVPGSVWM ERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLKHPPPMMLIKNTPVPGNITSFSDVPVSS FITQYSTGQVTVEMEWELKKENSKRWNPEIQYTNNYNDPQFVDFAPDSTGEYRTTRPIG TRYLTRPL). As used herein, “wild type 581 to 589 region” refers to a 581 to 589 region of VP1 having a sequence of ATGTYNLQE (SEQ ID NO: 9).

As used herein, “581 to 589 region” refers to a region or fragment of VP1 corresponding to amino acid residues 581 to 589 relative to the translational start of the VP1 polypeptide. The 581 to 589 region corresponds to amino acid residues 445 to 453 of VP2 and to amino acid residues 389 to 397 of VP3. The 581 to 589 region may confer tissue tropism or tissue preference to an AAV, and region variants may be engineered to confer tissue tropism or tissue preference to an rAAV formed from viral capsid polypeptides (VP1, VP2, and VP3) comprising the assembled variant. The VP1 with a generalized 581 to 589 region is provided in SEQ ID NO: 2 (MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLVLPGYNYLGPGNG LDRGEPVNRADEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLADDTSFGGNLG KAVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPS GSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRV VTKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRD WQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVV GNGTEGCLPAFPPQVFTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFT YNFEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKN WFPGPMGRTQGWNLGSGVNRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSN TYALENTMIFNSQPANPGTTATYLEGNMLITSESETQPVNRVAYNVGGQMATNNQSST TAPX¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹IVPGSVWMERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLK HPPPMMLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEMEWELKKENSKRWNPEIQYT NNYNDPQFVDFAPDSTGEYRTTRPIGTRYLTRPL), in which the 581 to 589 region has a sequence of X¹X₂X³X⁴X₅X⁶X⁷X⁸X⁹ (SEQ ID NO: 5014); wherein X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X₈, and X⁹ are each independently selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, and V.

It should be understood that the present disclosure includes polynucleotide sequences encoding for any sequence disclosed herein. For example, if an amino acid sequence is provided, the present disclosure also encompasses a polynucleotide sequence encoding for said amino acid sequence.

It should be understood that further embodiments include mutations in VP1, VP2, VP3, or any combination thereof that do not alter the desired properties (e.g., a particular tissue tropism) or affect viral assembly, as described herein.

An AAV virion is made of a capsid that may include the AAV5 VP capsid polypeptides disclosed herein (e.g., VP1, VP2, and VP3 capsid polypeptides).

Engineered Capsids and Capsid Polypeptides for Tissue Tropism

Described herein are engineered capsids, engineered capsid polypeptides, and 581 to 589 regions of capsid polypeptides that confer tissue tropism or preference (e.g., tissue-specific accumulation, tissue-specific infection, or both) to a viral capsid. In some embodiments, an engineered capsid may comprise one or more engineered capsid polypeptides assembled into a recombinant adeno-associated virus (rAAV) viral capsid. In some embodiments, an engineered capsid polypeptide may comprise a 581 to 589 region. The 581 to 589 region of viral capsid polypeptides, corresponding to amino acid residues 581 to 589 of the VP1 polypeptide, amino acid residues 445 to 453 of the VP2 polypeptide, and amino acid residues 389 to 397 of the VP3 polypeptide, is located at an AAV interface that likely interacts with host cells and tissues.

In some embodiments, an engineered capsid polypeptide may comprise a 581 to 589 region that confers increased tropism or preference for retina tissue relative to other ocular tissues as compared to a wild type AAV capsid polypeptide (e.g., a wild type AAV5 capsid polypeptide of SEQ ID NO: 1). For example, a retina tissue-tropic capsid polypeptide may have increased tropism for retina tissue and may be de-targeted to photoreceptor tissue, as compared to a wild type AAV5 capsid polypeptide. In some embodiments, an engineered capsid polypeptide may comprise a 581 to 589 region that confers increased tropism or preference for retinal pigment epithelium (RPE) tissue relative to other ocular tissues as compared to a wild type AAV capsid polypeptide (e.g., a wild type AAV5 capsid polypeptide of SEQ ID NO: 1). For example, a RPE tissue-tropic capsid polypeptide may have increased tropism for RPE tissue and may be de-targeted to photoreceptor tissue, as compared to a wild type AAV5 capsid polypeptide. In some embodiments, an engineered capsid polypeptide may comprise a 581 to 589 region that confers increased tropism or preference for choroid tissue relative to other ocular tissues as compared to a wild type AAV capsid polypeptide (e.g., a wild type AAV5 capsid polypeptide of SEQ ID NO: 1). For example, a choroid tissue-tropic capsid polypeptide may have increased tropism for choroid tissue and may be de-targeted to photoreceptor tissue, as compared to a wild type AAV5 capsid polypeptide. In some embodiments, an engineered capsid polypeptide may comprise a 581 to 589 region that confers increased tropism or preference for RPE tissue and choroid tissue relative to other ocular tissues as compared to a wild type AAV capsid polypeptide (e.g., a wild type AAV5 capsid polypeptide of SEQ ID NO: 1).

Also described herein are methods of using engineered capsids comprising engineered capsid polypeptides with 581 to 589 regions for tissue-specific delivery of a payload (e.g., a polynucleotide, such as a transgene) encapsidated by the engineered capsid. Recombinant AAVs comprising VP capsid polypeptides with 581 to 589 regions engineered for tissue specificity may be used to specifically infect a target tissue. Using tissue-tropic rAAV viral capsids for payload delivery provides numerous advantages over using adeno-associated virus (AAV) viral capsids that lack tissue tropism including reduced toxicity, lower dose needed to produce a therapeutic effect, wider therapeutic window, and reduced immune response. Furthermore, tissue-specific payload delivery may improve tissue-specificity of therapies following local administration. For example, an ocular tissue-tropic rAAV viral capsid may be intravitreally administered to specifically deliver a payload to the eye for treatment of an ocular disease. Alternatively or in addition, an ocular tissue-tropic rAAV viral capsid may be administered by sub-retinal injection or topical mucosal administration (e.g., via eye drops) to deliver a payload to the eye for treatment of an ocular disease. In some embodiments, an ocular tissue-tropic rAAV viral capsid may be administered systemically.

Ocular tissue tropism of the rAAV may reduce systemic effects (e.g., liver toxicity) from the therapy that may otherwise occur despite local administration. For example, an ocular tissue-tropic rAAV viral capsid may be engineered to target a specific ocular tissue (e.g., retinal tissue) while detargeting other ocular tissues (e.g., choroid, vitreous humor, or aqueous humor). Ocular tissue-tropic rAAV viral capsids may target a specific ocular cell type, such as retinal pigment epithelial cells or photoreceptor cells (e.g., rod cells, cone cells, or both). In some embodiments, an ocular tissue-tropic rAAV viral capsids may target a specific ocular cell type (e.g., retinal pigment epithelial cells) while detargeting one or more other ocular tissue or cell types (e.g., photoreceptor cells, choroid, vitreous humor, or aqueous humor). Such ocular tissue-specific rAAVs may enable specific targeting of regions within the eye for treatment of tissue-specific conditions, such as conditions of the retina, optic nerve, or choroid. In yet another example, an ocular tissue-tropic rAAV may accumulate in specific ocular tissue (e.g., retina) following intravitreal administration, sub-retinal injection, topical mucosal administration, or systemic administration. An ocular tissue-tropic rAAV may target a specific ocular cell type (e.g., retinal pigment epithelial cells, photoreceptor cells, or both) following intravitreal administration, sub-retinal injection, topical mucosal administration, or systemic administration. For example, a retina tissue-tropic rAAV may specifically accumulate in retina tissue and may be de-targeted from photoreceptor tissue. In another example, a RPE tissue-tropic rAAV may specifically accumulate in RPE tissue and may be de-targeted from photoreceptor tissue. In another example, a choroid tissue-tropic rAAV may specifically accumulate in choroid tissue and may be de-targeted from photoreceptor tissue. In another example, a choroid and RPE tissue-tropic rAAV may specifically accumulate in choroid and RPE tissue and may be de-targeted from photoreceptor tissue.

In some embodiments, a tissue-tropic capsid of the present disclosure may be ocular tissue-tropic. For example, an ocular tissue-tropic capsid polypeptide may confer increased tropism or preference for one or more ocular tissues (e.g., retinal tissue) as compared to a wild type VP capsid polypeptide (e.g., SEQ ID NO: 1). An ocular tissue-tropic capsid polypeptide may confer cellular homing to one or more ocular cell types (e.g., retinal pigment epithelial cells, photoreceptor cells, rod photoreceptor cells, cone photoreceptor cells, or combinations thereof).

An engineered capsid polypeptide of the present disclosure may comprise one or more amino acid substitutions relative to an AAV5 viral protein (VP) polypeptide (e.g., a VP1 polypeptide of SEQ ID NO: 1, a VP2 polypeptide of SEQ ID NO: 10, or a VP3 polypeptide of SEQ ID NO: 11). The engineered capsid polypeptide may comprise one or more amino acid substitutions relative to a VP1 polypeptide of any or all of SEQ ID NO: 3-SEQ ID NO: 8. In some embodiments, the engineered capsid polypeptide may comprise a 581 to 589 region comprising one or more amino acid substitutions in a region of a VP polypeptide (e.g., a 581 to 589 region of VP1, VP2, VP3, or a combination thereof) corresponding to amino acid residues 581 to 589 of VP1 (e.g., SEQ ID NO: 1), amino acid residues 445 to 453 of VP2 (e.g., SEQ ID NO: 10), or amino acid residues 389 to 397 of VP3 (e.g., SEQ ID NO: 11). In some embodiments, the 581 to 589 region may be present in VP1, VP2, and VP3. An engineered viral capsid may be assembled from VP1, VP2, and VP3 polypeptides comprising a 581 to 589 region. In some embodiments, the 581 to 589 region may confer ocular tissue tropism or preference.

In some embodiments, an engineered capsid polypeptide of the present disclosure may comprise a 581 to 589 region that confers increased retina tissue-tropism or preference as compared to a wild type AAV capsid polypeptide (e.g., a wild type AAV5 capsid polypeptide of SEQ ID NO: 1). For example, a 581 to 589 region that confers increased retina tissue-tropism may have a sequenced of any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513. In some embodiments, an engineered capsid polypeptide of the present disclosure may comprise a 581 to 589 region that confers increased RPE tissue-tropism or preference as compared to a wild type AAV capsid polypeptide (e.g., a wild type AAV5 capsid polypeptide of SEQ ID NO: 1). For example, a 581 to 589 region that confers increased RPE tissue-tropism may have a sequenced of any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, an engineered capsid polypeptide of the present disclosure may comprise a 581 to 589 region that confers increased choroid tissue-tropism or preference as compared to a wild type AAV capsid polypeptide (e.g., a wild type AAV5 capsid polypeptide of SEQ ID NO: 1). For example, a 581 to 589 region that confers increased choroid tissue-tropism may have a sequenced of any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013.

Capsid Engineering Methods

Disclosed herein is a system for high throughput engineering of engineered AAV capsids with modified function, including increased or decreased infectivity of desired tissues, such as increased targeting of ocular tissue (e.g., retinal tissue), decreased targeting of non-eye tissue, or selective targeting of a specific ocular tissue (e.g., retinal tissue) compared to other ocular tissues (e.g., aqueous humor or vitreous humor), relative to a wild type AAV5 capsid (e.g., comprising a VP capsid polypeptide of SEQ ID NO: 1). In some embodiments, the engineered AAV capsids may exhibit cellular homing to specific ocular cell types (e.g., retinal pigment epithelial cells, photoreceptor cells, rod photoreceptor cells, cone photoreceptor cells, or combinations thereof). A general schematic of the process is shown in FIG. 1. However, it should be understood that the present disclosure also encompasses reasonable variations or extensions to the method that are understood to those of ordinary skill in the art. The method may begin with production of a capsid library with theoretical diversity of 5×10¹¹ unique sequence variants. Higher or lower theoretical diversities are also encompassed herein. For example, a capsid library may have a theoretical diversity of from about 1×10³ to about 1×10²⁰. As shown in FIG. 1, the library may first be selected for the ability to assemble into viral capsids. The library may then be cloned into plasmids and transformed into bacteria. As shown in FIG. 1, the library plasmids may be subsequently screened for productive virion assembly in a production cell line. The assembled virions may then be administered intravitreally into non-human primates (NHP). In some embodiments, the assembled virions may be administered via sub-retinal injection, topical mucosal administration, or systemic administration. After a period of time sufficient for distribution, infection, and stable transduction, the NHP may be sacrificed, organs harvested, and sequences of AAV capsids in each tissue may be determined by deep sequencing. Eye tissues, including aqueous humor, choroid, retina, optic nerve, vitreous humor, and remaining eye tissue may be harvested for sequencing.

FIG. 2A provides a side view (top panel) and top view (bottom panel) of the surface of a prototype AAV virion, identifying residues of known AAV capsids, including AAV2, AAV5, AAV6, and AAV9, that have been shown in the research literature to interact with target cells. These target-interacting residues correspond to amino acids 581 to 589 in the AAV5 VP1 capsid protein.

FIG. 2B shows the salient elements of the library plasmid, illustrating rep and cap coding sequences positioned between AAV ITRs. In the illustrated embodiment, further described in EXAMPLE 1, variation is introduced into each of residues 581 to 589 of the AAV5 cap protein (“Library 581 to 589 region”) that is present in assembled VP1, VP2, and VP3 polypeptides. Each of the 20 natural amino acids is introduced at each of the 9 positions of the 581 to 589 region, providing a theoretical library diversity of 20⁹ (20{circumflex over ( )}9; approximately 5×10¹¹) unique sequence variants.

The 581 to 589 region targeted for engineering is the most likely to interact with target cell receptors, and relatively tolerant to changes without disrupting virion assembly. Unlike earlier approaches that add unstructured peptides that protrude above the virion 3-fold axis of symmetry, the current approach introduces sequence diversity that alters the characteristics of the binding pocket. In addition, this approach may change the overall structure of the receptor-binding trimer, allowing for altered allosteric interactions outside the binding pocket (e.g., AAVR PKD1). Introduced diversity is non-random, thereby reducing missense and frameshifts of randomized libraries.

By cloning the polynucleotide encoding the capsid variants into the packaged viral genome (between the ITRs), the recombinant virions with variant capsids carry polynucleotides having their cognate mutation, so the unique variant providing the desired function can be identified by sequencing packaged virus or infected cells.

In some embodiments, the capsid is a capsid selected from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV 10, AAV11, AAV12, AAV13, AAV14, AAV15, AAV16, AAV-DJ, AAV-DJ/8, AAV-DJ/9, AAV1/2, AAV.rh8, AAV.rh10, AAV.rh20, AAV.rh39, AAV.Rh43, AAV.Rh74, AAV.v66, AAV.Oligo001, AAV.SCH9, AAV.r3.45, AAV.RHM4-1, AAV.hu37, AAV.Anc80, AAV.Anc80L65, AAV.7m8, AAV.PhP.eB, AAV.PhP.V1, AAV.PHP.B, AAV.PhB.C1, AAV.PhB.C2, AAV.PhB.C3, AAV.PhB.C6, AAV.cy5, AAV2.5, AAV2tYF, AAV3B, AAV.LK03, AAV.HSC1, AAV.HSC2, AAV.HSC3, AAV.HSC4, AAV.HSC5, AAV.HSC6, AAV.HSC7, AAV.HSC8, AAV.HSC9, AAV.HSC10, AAV.HSC11, AAV.HSC12, AAV.HSC13, AAV.HSC14, AAV.HSC15, AAV.HSC16, AAV.HSC17, or AAVhu68, (described in WO2020/033842, incorporated herein by reference in its entirety). For example, the capsid may be an AAV5 capsid. The hu68 capsid is described in WO 2018/160582, incorporated herein by reference in its entirety.

Such capsids may comprise a 581 to 589 region corresponding amino acid residues 581 to 589 of the AAV5 VP1, and as such analogous engineered VP capsids with desired tissue tropism, ability to assemble, and exhibit various other desired traits are encompassed herein. Thus, any one of the engineered AAV5 VP capsid polypeptides disclosed herein having a mutation or substitution in the 581 to 589 region corresponding to the 581 to 589 region of AAV5 VP1 may be inserted into the corresponding region in any one of the other AAV capsids described herein and the present disclosure encompasses such variants.

In some embodiments, the capsid is a derivative, modification, or pseudotype of AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV 10, AAV11, AAV12, AAV13, AAV14, AAV15, AAV16, AAV-DJ, AAV-DJ/8, AAV-DJ/9, AAV1/2, AAV.rh8, AAV.rh10, AAV.rh20, AAV.rh39, AAV.Rh43, AAV.Rh74, AAV.v66, AAV.Oligo001, AAV.SCH9, AAV.r3.45, AAV.RHM4-1, AAV.hu37, AAV.Anc80, AAV.Anc80L65, AAV.7m8, AAV.PhP.eB, AAV.PhP.V1, AAV.PHP.B, AAV.PhB.C1, AAV.PhB.C2, AAV.PhB.C3, AAV.PhB.C6, AAV.cy5, AAV2.5, AAV2tYF, AAV3B, AAV.LK03, AAV.HSC1, AAV.HSC2, AAV.HSC3, AAV.HSC4, AAV.HSC5, AAV.HSC6, AAV.HSC7, AAV.HSC8, AAV.HSC9, AAV.HSC10, AAV.HSC11, AAV.HSC12, AAV.HSC13, AAV.HSC14, AAV.HSC15, AAV.HSC16, AAV.HSC17, or AAVhu68. For example, the capsid may be a derivative of AAV5.

In some embodiments, capsid protein is a chimera of capsid proteins from two or more serotype selected from AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV 10, AAV11, AAV12, AAV13, AAV14, AAV15, AAV16, AAV-DJ, AAV-DJ/8, AAV-DJ/9, AAV1/2, AAV.rh8, AAV.rh10, AAV.rh20, AAV.rh39, AAV.Rh43, AAV.Rh74, AAV.v66, AAV.Oligo001, AAV.SCH9, AAV.r3.45, AAV.RHM4-1, AAV.hu37, AAV.Anc80, AAV.Anc80L65, AAV.7m8, AAV.PhP.eB, AAV.PhP.V1, AAV.PHP.B, AAV.PhB.C1, AAV.PhB.C2, AAV.PhB.C3, AAV.PhB.C6, AAV.cy5, AAV2.5, AAV2tYF, AAV3B, AAV.LK03, AAV.HSC1, AAV.HSC2, AAV.HSC3, AAV.HSC4, AAV.HSC5, AAV.HSC6, AAV.HSC7, AAV.HSC8, AAV.HSC9, AAV.HSC10, AAV.HSC11, AAV.HSC12, AAV.HSC13, AAV.HSC14, AAV.HSC15, AAV.HSC17, AAVhu68, and AAV.HSC16 (described in WO2020/033842, incorporated herein by reference in its entirety). In certain embodiments, the capsid is an rh32.33 capsid, described in U.S. Pat. No. 8,999,678, incorporated herein by reference in its entirety.

Such capsids may comprise a 581 to 589 region corresponding to 581 to 589 of the AAV5 VP1, and as such analogous engineered VP capsids with desired tissue tropism, ability to assemble, and exhibit various other desired traits are encompassed herein.

VP-Encoding Polynucleotides, Vectors, and Vector Libraries

Accordingly, in a first aspect, polynucleotides are provided. The polynucleotides encode an adeno-associated virus (AAV) VP1 capsid polypeptide having the amino acid sequence of SEQ ID NO: 2, wherein X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, and X⁹ are each independently selected from the 20 naturally occurring amino acids, using standard one letter codes, from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, and V. The sequence X¹X₂X³X⁴X⁵X⁶X⁷X⁸X⁹ of SEQ ID NO: 2 corresponds to the 581 to 589 region of VP1. X¹ corresponds to a position 581 of the 581 to 589 region. X² corresponds to a position 582 of the 581 to 589 region. X³ corresponds to a position 583 of the 581 to 589 region. X⁴ corresponds to a position 584 of the 581 to 589 region. X⁵ corresponds to a position 585 of the 581 to 589 region. X⁶ corresponds to a position 586 of the 581 to 589 region. X⁷ corresponds to a position 587 of the 581 to 589 region. X⁸ corresponds to a position 588 of the 581 to 589 region. X⁹ corresponds to a position 589 of the 581 to 589 region. The polynucleotide encodes a polypeptide that includes at least one mutation of the native AAV5 capsid and thus does not have the sequence of SEQ ID NO: 1. In addition, the polypeptide does not have the sequence of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8. In some embodiments, the VP1 capsid polypeptide comprises a 581 to 589 region. For example, a VP1 capsid polypeptide comprising a 581 to 589 region may comprise a sequence of SEQ ID NO: 1 in which residues 581 to residue 589 are replaced with a sequence of X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹ (SEQ ID NO: 5014), wherein X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, and X⁹ are each independently selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, and V, and wherein the VP1 capsid polypeptide does not have the sequence of any of SEQ ID NO: 1, SEQ ID NO: 3 (MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLVLPGYNYLGPGNG LDRGEPVNRADEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLADDTSFGGNLG KAVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPS GSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRV VTKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRD WQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVV GNGTEGCLPAFPPQVFTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFT YNFEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKN WFPGPMGRTQGWNLGSGVNRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSN TYALENTMIFNSQPANPGTTATYLEGNMLITSESETQPVNRVAYNVGGQMATNNQSST TAPATGTVNLQEIVPGSVWMERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLKHPPPM MLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEMEWELKKENSKRWNPEIQYTNNYN DPQFVDFAPDSTGEYRTTRPIGTRYLTRPL), SEQ ID NO: 4 (MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLVLPGYNYLGPGNG LDRGEPVNRADEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLADDTSFGGNLG KAVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPS GSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRV VTKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRD WQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVV GNGTEGCLPAFPPQVFTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFT YNFEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKN WFPGPMGRTQGWNLGSGVNRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSN TYALENTMIFNSQPANPGTTATYLEGNMLITSESETQPVNRVAYNVGGQMATNNQSST TAPATGTYNTQEIVPGSVWMERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLKHPPPM MLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEMEWELKKENSKRWNPEIQYTNNYN DPQFVDFAPDSTGEYRTTRPIGTRYLTRPL), SEQ ID NO: 5 (MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLVLPGYNYLGPGNG LDRGEPVNRADEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLADDTSFGGNLG KAVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPS GSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRV VTKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRD WQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVV GNGTEGCLPAFPPQVFTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFT YNFEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKN WFPGPMGRTQGWNLGSGVNRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSN TYALENTMIFNSQPANPGTTATYLEGNMLITSESETQPVNRVAYNVGGQMATNNQSST TAPTTGTYNLQEIVPGSVWMERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLKHPPPM MLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEMEWELKKENSKRWNPEIQYTNNYN DPQFVDFAPDSTGEYRTTRPIGTRYLTRPL), SEQ ID NO: 6 (MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLVLPGYNYLGPGNG LDRGEPVNRADEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLADDTSFGGNLG KAVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPS GSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRV VTKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRD WQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVV GNGTEGCLPAFPPQVFTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFT YNFEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKN WFPGPMGRTQGWNLGSGVNRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSN TYALENTMIFNSQPANPGTTATYLEGNMLITSESETQPVNRVAYNVGGQMATNNQSST TAPAAGTYNLQEIVPGSVWMERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLKHPPPM MLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEMEWELKKENSKRWNPEIQYTNNYN DPQFVDFAPDSTGEYRTTRPIGTRYLTRPL), SEQ ID NO: 7 (MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLVLPGYNYLGPGNG LDRGEPVNRADEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLADDTSFGGNLG KAVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPS GSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRV VTKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRD WQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVV GNGTEGCLPAFPPQVFTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFT YNFEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKN WFPGPMGRTQGWNLGSGVNRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSN TYALENTMIFNSQPANPGTTATYLEGNMLITSESETQPVNRVAYNVGGQMATNNQSST TAPATGAYNLQEIVPGSVWMERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLKHPPPM MLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEMEWELKKENSKRWNPEIQYTNNYN DPQFVDFAPDSTGEYRTTRPIGTRYLTRPL), or SEQ ID NO: 8 (MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLVLPGYNYLGPGNG LDRGEPVNRADEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLADDTSFGGNLG KAVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPSTSSDAEAGPS GSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDSTWMGDRV VTKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSHWSPRD WQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQLPYVV GNGTEGCLPAFPPQVFTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTGNNFEFT YNFEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYANTYKN WFPGPMGRTQGWNLGSGVNRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQGSN TYALENTMIFNSQPANPGTTATYLEGNMLITSESETQPVNRVAYNVGGQMATNNQSST TAPATGTVNTQEIVPGSVWMERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLKHPPPM MLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEMEWELKKENSKRWNPEIQYTNNYN DPQFVDFAPDSTGEYRTTRPIGTRYLTRPL).

In some embodiments, a polynucleotide of the present disclosure may encode an AAV VP1 capsid polypeptide having the amino acid sequence of SEQ ID NO: 2, wherein X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹ of SEQ ID NO: 2 is any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513. In some embodiments, a polynucleotide of the present disclosure may encode an AAV VP1 capsid polypeptide having the amino acid sequence of SEQ ID NO: 2, wherein X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹ of SEQ ID NO: 2 is any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013.

In some embodiments, the polynucleotide encodes an AAV VP1 capsid polypeptide that further comprises one or more mutations at an amino acid residue outside of the 581 to 589 region, with reference to SEQ ID NO: 1, wherein the resulting recombinant capsid is capable of forming an assembled virion that exhibits desired tissue targeting as compared to wild type AAV5 (SEQ ID NO: 1). The one or more mutations may confer increased tissue tropism or preference (e.g., increased retinal tissue tropism) on the assembled virion as compared to a wild type AAV capsid polypeptide (e.g., a wild type AAV5 capsid polypeptide of SEQ ID NO: 1).

In another aspect, a vector capable of replication in prokaryotic cells is provided, wherein the vector comprises the polynucleotide described immediately above. In typical embodiments, the vector is a plasmid encoding a replication competent AAV genome.

In a further aspect, a library is provided. The library comprises a plurality of vectors comprising the AAV capsid-encoding polynucleotides. In some embodiments, the vectors are plasmids, and the plurality of plasmids comprise a plurality of different AAV VP-encoding polynucleotides. The library may comprise a plurality of vectors encoding AAV VP1 capsid polypeptides having the amino acid sequence of SEQ ID NO: 2 comprising one or more amino acid variations in the 581 to 589 region.

In various embodiments, the library encodes at least 1×10⁹ different AAV VP capsid polypeptides, at least 2.5×10⁹ different AAV VP capsid polypeptides, at least 5×10⁹ different AAV VP capsid polypeptides, at least 7.5×10⁹ different AAV VP capsid polypeptides, at least 1×10¹⁰ different AAV VP capsid polypeptides, at least 2.5×10¹⁰ different AAV VP capsid polypeptides, at least 5×10¹⁰ different AAV VP capsid polypeptides, at least 7.5×10¹⁰ different AAV VP capsid polypeptides, at least 1×10¹¹ different AAV VP capsid polypeptides, at least 2.5×10¹¹ different AAV VP capsid polypeptides, or at least 5×10¹¹ different AAV VP capsid polypeptides. The library may encode VP capsid polypeptides comprising 581 to 589 region variants.

In another aspect, prokaryotic cells comprising the vectors are provided. In some embodiments, the prokaryotic cell is an E. coli cell and the vector is a plasmid.

In a related aspect, libraries are provided, the library comprising a plurality of E. coli cells, wherein the plurality of cells comprise a plurality of plasmids, wherein the plurality of plasmids comprise a plurality of different AAV VP-encoding polynucleotides.

In some embodiments, the library encodes at least 1×10⁹ different AAV VP capsid polypeptides, at least 2.5×10⁹ different AAV VP capsid polypeptides, at least 5×10⁹ different AAV VP capsid polypeptides, at least 7.5×10⁹ different AAV VP capsid polypeptides, at least 1×10¹⁰ different AAV VP capsid polypeptides, at least 5×10¹⁰ different AAV VP capsid polypeptides, at least 7.5×10¹⁰ different AAV VP capsid polypeptides, at least 1×10¹¹ different AAV VP capsid polypeptides, at least 2.5×10¹¹ different AAV VP capsid polypeptides, or at least 5×10¹¹ different AAV VP capsid polypeptides. The library may encode VP capsid polypeptides comprising 581 to 589 region variants.

VP Polypeptides, Peptide Libraries

In another aspect, AAV VP1 capsid polypeptides are provided. The polypeptide has the amino acid sequence of SEQ ID NO: 2, wherein X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, and X⁹ are each independently selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, and V. The polypeptide includes at least one mutation as compared to native AAV VP1, and thus does not have the sequence of SEQ ID NO: 1. In addition, the polypeptide does not have the sequence of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.

In some embodiments, the polypeptide further comprises one or more mutations at an amino acid residue outside of the 581 to 589 region, with reference to SEQ ID NO: 1, wherein the resulting recombinant capsid is capable of forming an assembled virion that exhibits desired tissue targeting as compared to a wild type AAV5 comprising a VP capsid polypeptide of SEQ ID NO: 1.

In a further aspect, libraries are provided, the libraries comprising a plurality of polypeptides as described immediately above, the plurality having different primary amino acid sequences. A library may comprise a plurality of polypeptides of SEQ ID NO: 2 comprising one or more amino acid variations in the 581 to 589 region.

In some embodiments, library comprises at least 1×10⁹ different AAV VP capsid polypeptides, at least 2.5×10⁹ different AAV VP capsid polypeptides, at least 5×10⁹ different AAV VP capsid polypeptides, at least 7.5×10⁹ different AAV VP capsid polypeptides, at least 1×10¹⁰ different AAV VP capsid polypeptides, at least 2.5×10¹⁰ different AAV VP capsid polypeptides, at least 5×10¹⁰ different AAV VP capsid polypeptides, at least 7.5×10¹⁰ different AAV VP capsid polypeptides, at least 1×10¹¹ different AAV VP capsid polypeptides, at least 2.5×10¹¹ different AAV VP capsid polypeptides, or at least 5×10¹¹ different AAV VP capsid polypeptides. The library may comprise VP capsid polypeptides comprising 581 to 589 region variants.

In certain embodiments, the library comprises at least from about 1×10⁵ to at least about 5×10¹¹ different AAV VP capsid polypeptides. In certain embodiments, the library comprises at least about 1×10⁵, at least about 2×10⁵, at least about 3×10⁵, at least about 4×10⁵, at least about 5×10⁵, at least about 6×10⁵, at least about 7×10⁵, at least about 8×10⁵, at least about 9×10⁵, at least about 1×10⁶, at least about 2×10⁶, at least about 3×10⁶, at least about 4×10⁶, at least about 5×10⁶, at least about 6×10⁶, at least about 7×10⁶, at least about 8×10⁶, at least about 9×10⁶, at least about 1×10⁷, at least about 2×10⁷, at least about 3×10⁷, at least about 4×10⁷, at least about 5×10⁷, at least about 6×10⁷, at least about 7×10⁷, at least about 8×10⁷, at least about 9×10⁷, at least about 1×10⁸, at least about 2×10⁸, at least about 3×10⁸, at least about 4×10⁸, at least about 5×10⁸, at least about 6×10⁸, at least about 7×10⁸, at least about 8×10⁸, at least about 9×10⁸, at least about 1×10⁹, at least about 2×10⁹, at least about 3×10⁹, at least about 4×10⁹, at least about 5×10⁹, at least about 6×10⁹, at least about 7×10⁹, at least about 8×10⁹, at least about 9×10⁹, at least about 1×10¹⁰, at least about 2×10¹⁰, at least about 3×10¹⁰, at least about 4×10¹⁰, at least about 5×10¹⁰, at least about 6×10¹⁰, at least about 7×10¹⁰, at least about 8×10¹⁰, at least about 9×10¹⁰, at least about 1×10¹¹, at least about 2×10¹¹, at least about 3×10¹¹, at least about 4×10¹¹, or at least about 5×10¹¹ AAV VP capsid polypeptides.

In certain embodiments, provided herein is a recombinant adeno-associated virus AAV VP1 capsid polypeptide having at least one mutation in a residue of region 581 to residue 589 in SEQ ID NO: 1, inclusive, wherein the mutation confers at least about 1.1-fold, at least about 1.2-fold, at least about 1.3-fold, at least about 1.4-fold, at least about 1.5-fold, at least about 1.6-fold, at least about 1.7-fold, at least about 1.8-fold, at least about 1.9-fold, at least about 2-fold, at least about 2.2-fold, at least about 2.4-fold, at least about 2.6-fold, at least about 2.8-fold, at least about 3-fold, at least about 3.5-fold, at least about 4-fold, at least about 4.5-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, or at least about 500-fold increased accumulation of an AAV virion having said AAV VP1 capsid polypeptide in a target tissue (e.g., a retinal tissue), target cell (e.g., retinal pigment epithelial cells, photoreceptor cells, rod photoreceptor cells, cone photoreceptor cells, or combinations thereof), or both as compared to a non-target tissue (e.g., vitreous humor or aqueous humor), as compared to wild type AAV virion having a wild type AAV5 VP1 capsid polypeptide, and wherein the AAVVP1 capsid polypeptide does not have the sequence of any of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8. In some embodiments, a VP1 capsid polypeptide comprises a 581 to 589 region comprising one or more amino acid mutations. For example, a VP1 capsid polypeptide may comprise a sequence of SEQ ID NO: 1 in which residues 581 to residue 589 are replaced with a sequence of X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹ (SEQ ID NO: 5014), wherein X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, and X⁹ are each independently selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, and V, and wherein the VP1 capsid polypeptide does not have the sequence of any of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.

In some embodiments, an AAV VP1 capsid polypeptide of the present disclosure may have an amino acid sequence of SEQ ID NO: 2, wherein X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹ of SEQ ID NO: 2 is any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513. In some embodiments, an AAV VP1 capsid polypeptide of the present disclosure may have an amino acid sequence of SEQ ID NO: 2, wherein X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹ of SEQ ID NO: 2 is any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013.

rAAV Virions, Virion Libraries

In another aspect, recombinant AAV virions (rAAV) are provided. The virion comprises an AAV VP capsid polypeptide as described above. In some embodiments, the rAAV has increased tropism for primate and human ocular tissue (e.g., retinal tissue), or may have increased accumulation in ocular cells (e.g., retinal pigment epithelial cells, photoreceptor cells, rod photoreceptor cells, cone photoreceptor cells, or combinations thereof), or both, as compared to a rAAV having the native AAV5 VP1 capsid polypeptide (SEQ ID NO:1). In some embodiments, the rAAV has increased ability to assemble, or exhibits greater virion stability, as compared to a rAAV having the native AAV5 VP1 capsid polypeptide (SEQ ID NO: 1).

In certain of these embodiments, the rAAV has increased ability to infect one or more ocular tissues selected from aqueous humor, choroid, retina, optic nerve, vitreous humor, and combinations thereof following intravitreal administration, sub-retinal injection, topical mucosal administration, or systemic administration as compared to a rAAV having the native AAV5 VP1 capsid polypeptide (SEQ ID NO: 1). In some embodiments, the rAAV has increased tissue tropism for retinal tissue compared to a wild type AAV5 capsid. In some embodiments, the rAAV has increased accumulation in photoreceptor cells (e.g., rod photoreceptor cells, cone photoreceptor cells, or a combination thereof), retinal pigment epithelial cells, or both, compared to a wild type AAV5 capsid.

Additionally, provided are polynucleotide sequences encoding the rAAV capsid VP proteins described herein.

In a further aspect, libraries are provided that comprise a plurality of rAAV as described above. The plurality of rAAVs comprise a plurality of VP capsid polypeptides having different primary amino acid sequences. An rAAV of the plurality of rAAVs may comprise a polypeptide of SEQ ID NO: 2 comprising one or more amino acid variations in the 581 to 589 region.

In some embodiments, the library comprises at least 1×10⁹ different AAV VP capsid polypeptides, at least 2.5×10⁹ different AAV VP capsid polypeptides, at least 5×10⁹ different AAV VP capsid polypeptides, at least 7.5×10⁹ different AAV VP capsid polypeptides, at least 1×10¹⁰ different AAV VP capsid polypeptides, at least 2.5×10¹⁰ different AAV VP capsid polypeptides, at least 5×10¹⁰ different AAV VP capsid polypeptides, at least 7.5×10¹⁰ different AAV VP capsid polypeptides, at least 1×10¹¹ different AAV VP capsid polypeptides, at least 2.5×10¹¹ different AAV VP capsid polypeptides, or at least 5×10¹¹ different AAV VP capsid polypeptides. The library may comprise AAV VP capsid polypeptides comprising 581 to 589 region variants. For example, a VP1 capsid polypeptide may comprise a sequence of SEQ ID NO: 1 in which residues 581 to residue 589 are replaced with a sequence of X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹ (SEQ ID NO: 5014), wherein X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, and X⁹ are each independently selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, and V, and wherein the VP1 capsid polypeptide does not have the sequence of any of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.

In some embodiments, an AAV virion of the present disclosure may comprise an AAV VP1 capsid polypeptide having an amino acid sequence of SEQ ID NO: 2, wherein X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹ of SEQ ID NO: 2 is any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513. In some embodiments, an AAV virion of the present disclosure may comprise an AAV VP1 capsid polypeptide having an amino acid sequence of SEQ ID NO: 2, wherein X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹ of SEQ ID NO: 2 is any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013.

Pharmaceutical Compositions

In another aspect, pharmaceutical compositions are provided. The pharmaceutical composition comprises a rAAV as described above and a pharmaceutically acceptable carrier.

A pharmaceutical composition can comprise a first active ingredient. The first active ingredient can comprise a viral vector as described herein and/or any payload as described herein. The pharmaceutical composition can be formulated in unit dose form. The pharmaceutical composition can comprise a pharmaceutically acceptable excipient, diluent, or carrier. The pharmaceutical composition can comprise a second, third, or fourth active ingredient—such as to facilitate enhanced gene replacement, RNA editing, DNA editing, or imaging.

A pharmaceutical composition described herein can compromise an excipient. An excipient can comprise a cryo-preservative, such as DMSO, glycerol, polyvinylpyrrolidone (PVP), or any combination thereof. An excipient can comprise a cryo-preservative, such as a sucrose, a trehalose, a starch, a salt of any of these, a derivative of any of these, or any combination thereof. An excipient can comprise a pH agent (to minimize oxidation or degradation of a component of the composition), a stabilizing agent (to prevent modification or degradation of a component of the composition), a buffering agent (to enhance temperature stability), a solubilizing agent (to increase protein solubility), or any combination thereof. An excipient can comprise a surfactant, a sugar, an amino acid, an antioxidant, a salt, a non-ionic surfactant, a solubilizer, a triglyceride, an alcohol, or any combination thereof. An excipient can comprise sodium carbonate, acetate, citrate, phosphate, poly-ethylene glycol (PEG), human serum albumin (HSA), sorbitol, sucrose, trehalose, polysorbate 80, sodium phosphate, sucrose, disodium phosphate, mannitol, polysorbate 20, histidine, citrate, albumin, sodium hydroxide, glycine, sodium citrate, trehalose, arginine, sodium acetate, acetate, HCl, disodium edetate, lecithin, glycerol, xanthan rubber, soy isoflavones, polysorbate 80, ethyl alcohol, water, teprenone, or any combination thereof.

Compositions and methods provided herein can utilize pharmaceutical compositions. The compositions described throughout can be formulated into a pharmaceutical and be used to treat a human or mammal, in need thereof, diagnosed with a disease. In some cases, pharmaceutical compositions can be used prophylactically.

The compositions provided herein can be utilized in methods provided herein. Any of the provided compositions provided herein can be utilized in methods provided herein. In some cases, a method comprises at least partially preventing, reducing, ameliorating, and/or treating a disease or condition, or a symptom of a disease or condition. A subject can be a human or non-human. A subject can be a mammal (e.g., rat, mouse, cow, dog, pig, sheep, horse). A subject can be a vertebrate or an invertebrate. A subject can be a laboratory animal. A subject can be a patient. A subject can be suffering from a disease. A subject can display symptoms of a disease. A subject may not display symptoms of a disease, but still have a disease. A subject can be under medical care of a caregiver (e.g., the subject is hospitalized and is treated by a physician).

Methods of Treatment or Detection

In some aspects, the present disclosure provides for methods of treatment using an rAAV virion having any one of the engineered AAV VP capsid polypeptide sequences disclosed herein. In some aspects, the present disclosure provides for methods of detection using an rAAV virion having any one of the engineered AAV VP capsid polypeptide sequences disclosed herein. A method of treatment may comprise administering to a subject an effective amount of a pharmaceutical composition comprising rAAV virions assembled from VP polypeptides comprising a 581 to 589 region that confers tissue tropism or preference (e.g., ocular tissue tropism) to the rAAV. The rAAV virions may encapsidate any payload, including those payloads disclosed herein. For example, a method of treatment may comprise administering an effective amount of a pharmaceutical composition comprising rAAV virions assembled from VP polypeptides comprising a 581 to 589 region having a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513. In another example, a method of treatment may comprise administering an effective amount of a pharmaceutical composition comprising rAAV virions assembled from VP polypeptides comprising a 581 to 589 region having a sequence of any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013.

In some embodiments, the effective amount is at least 1×10⁸ viral genomes per dose. In some embodiments, the effective amount is at least 5×10⁸ viral genomes/dose, 7.5×10⁸ viral genomes/dose, at least 1×10⁹ viral genomes/dose, at least 2.5×10⁹ viral genomes/dose, at least 5×10⁹ viral genomes/dose. In some embodiments, an effective amount of an rAAV assembled from VP polypeptides comprising a 581 to 589 region conferring ocular tissue tropism or preference (e.g., retinal tissue tropism) may be lower than an effective amount of an AAV assembled from VP1, VP2, and VP3 polypeptides of SEQ ID NO: 1, SEQ ID NO: 10, and SEQ ID NO: 11, respectively.

In some embodiments, the effective amount is at least 1×10¹¹ viral genomes, at least 5×10¹¹ viral genomes, at least 1×10¹² viral genomes, at least 5×10¹² viral genomes, at least 1×10¹³ viral genomes, at least 1×10¹⁴ viral genomes, or at least 5×10¹⁴ viral genomes. In some embodiments, an effective amount of an rAAV assembled from VP polypeptides comprising a 581 to 589 region conferring ocular tissue tropism may be lower than an effective amount of an AAV assembled from VP1, VP2, and VP3 polypeptides of SEQ ID NO: 1, SEQ ID NO: 10, and SEQ ID NO: 11, respectively.

In some embodiments, the rAAV virion is administered via an ocular administration route, such as intravitreal administration, subconjunctival administration, retrobulbar administration, sub-retinal injection, topical mucosal administration, or intracameral administration. In some embodiments, the rAAV virion is administered via a systemic administration route including enteral routes of administration and parenteral routes of administration. The rAAV virion may be administered intravenously. In some embodiments, the rAAV may be administered intramuscularly. In some embodiments, the rAAV may be administered intraperitoneally. In some embodiments, the rAAV may be administered topically. In some embodiments, the rAAV may be administered orally. In particular embodiments, the rAAV virion is administered intravenously. In some embodiments, the rAAV is administered intrathecally. In some embodiments, the rAAV is administered by intracerebral ventricular injection. In some embodiments, the rAAV is administered by intracisternal magna administration. In some embodiments, the rAAV is administered by intravitreal injection.

In various embodiments, the patient suffers from one of the conditions listed in TABLE 1, below. In particular embodiments, the patient suffers from one of the conditions listed in TABLE 1 and the rAAV includes a payload comprising the transgene product associated therewith in TABLE 1. In some embodiments, an rAAV may be selected to specifically target the primary gene delivery target (e.g., the eye). For example, an rAAV selected to target the eye may comprise VP capsid polypeptides comprising a 581 to 589 region that confers ocular tissue tropism.

In some embodiments, an rAAV virion of the present disclosure, having any of the engineered AAV VP capsid polypeptide sequences disclosed herein, comprises a vector genome, the vector genome comprising a therapeutic polynucleotide or payload. In further embodiments, said payload may be under control of regulatory sequences that direct expression in infected human cells. In some embodiments, the payload may be under control of a cell type- or tissue type-specific promoter to direct expression in a target cell type or target tissue type. For example, expression of the payload may be under control of a retinal-specific promoter to promote retinal-specific expression, a retinal pigment epithelium-specific promoter to promote retinal pigment epithelium-specific expression, a choroid-specific promoter to promote choroid-specific expression, a photoreceptor-specific promoter to promote photoreceptor-specific expression, or an optic nerve-specific promoter to promote optic nerve-specific expression. In some embodiments, the payload comprises a therapeutic polynucleotide encoding any genetically encodable payload, such as an RNA (e.g., a guide RNA), a suppressor tRNA, a transgene, or a genome modifying entity.

In some embodiments, the therapeutic polynucleotide encodes a guide RNA, a tRNA, a suppressor tRNA, a siRNA, a miRNA, an mRNA, a shRNA, a circular RNA, or an antisense oligonucleotide (ASO), a ribozyme, a DNAzyme, an aptamer, or any combination thereof. In some embodiments, the therapeutic polynucleotide encodes a linear therapeutic polynucleotide or a circular therapeutic polynucleotide.

In some embodiments, the therapeutic polynucleotide is a transgene, encoding a therapeutic protein. In some embodiments, the therapeutic protein is an antibody that binds a target molecule (e.g., an anti-VEGF antibody that binds VEGF). In particular embodiments, the transgene encodes a protein selected from the targets suitable for modification or transgene products of TABLE 1. In some embodiments, the transgene encodes a protein that binds a target provided in TABLE 1. In some embodiments, the payload encodes a polynucleotide that targets a target provided in TABLE 1. In some embodiments, an ocular payload or a transgene encoding an ocular target is encapsidated by an rAAV comprising VP capsid polypeptides comprising a 581 to 589 region that confers ocular tissue tropism or preference.

TABLE 1
Suitable Therapeutic Targets or Payloads
Condition                        Payload or Target
3-Methylglutaconic Aciduria, Type Iii AFG3L2, MECR, OPA1
Abetalipoproteinemia             MTTP
Abnormal Threshold of Rods       HBA2, PROC
Aceruloplasminemia               CP
Achromatopsia                    ATF6, CABP4, CNGA3, CNGB3, PDE6C
Achromatopsia 3                  CNGB3
Achromatopsia 4                  GNAT2
ad Retinitis Pigmentosa          NRL, RDH12, PRPH2 (RDS), RHO, RPGR,
                                 SNRNP200, NR2E3, IMPDH1, CRX, HK1,
                                 IMPDH2, SNRNP200, PRPF3, AGBL5
Age-related macular degeneration NOS2A, CFH, CF, C2, C3, C5A, CFB,
(AMD), e.g., wet AMD, or dry AMD HTRA1/LOC, MMP-9, TIMP-3, SLC16A8,
                                 VEGFA, VEGFC, CD59, RHO
Aland Island Eye Disease         CACNA1F
Albinism                         TYRP1
Albinism, Ocular, Type I         GPR143
Albinism, Oculocutaneous, Type Ia TYR
Albinism, Oculocutaneous, Type Ii MC1R, OCA2
Alport Syndrome                  COL4A3, COL4A4, COL4A5
Alzheimer Disease, Familial, 1   APP, GRN, PSEN1
Amblyopia                        CACNA1F
Amyotrophic Lateral Sclerosis 2, ALS2
Juvenile
Anterior Segment Dysgenesis 2    FOXE3
Auditory Neuropathy and Optic    FDXR
Atrophy
Autosomal Dominant Cerebellar    KAT6B
Ataxia
Autosomal Dominant Congenital    SNRNP200
Stationary Night Blindness
Bardet-Biedl Syndrome            ARL6, BBS1, BBS10, BBS12, BBS2, BBS4, BBS5,
                                 BBS7, BBS9, CEP290, IFT172, MKKS, MKS1,
                                 SDCCAG8, TRIM32, TTC8, WDPCP
Bardet-Biedl Syndrome 1          BBIP1, BBS1, BBS10, LZTFL1
Bardet-Biedl Syndrome 13         MKS1
Bardet-Biedl Syndrome 17         LZTFL1
Bardet-Biedl Syndrome 2          BBS2, MKKS
Bardet-Biedl Syndrome 3          ARL6
Bardet-Biedl Syndrome 5          BBS5
Bardet-Biedl Syndrome 8          TTC8
Bardet-Biedl Syndrome 9          BBS9
Bartter Syndrome, Type 3         CLCNKB
Basal Laminar Drusen             CFH
Bestrophinopathy, Autosomal      BEST1
Recessive
Bietti Crystalline Corneoretinal CYP4V2
Dystrophy
Blau Syndrome                    NOD2
Blue Cone Monochromacy           OPN1LW
Bohring-Opitz Syndrome           ASXL1
Bosma Arhinia Microphthalmia     SMCHD1
Syndrome
Boucher-Neuhauser Syndrome       PNPLA6
Branchiooculofacial Syndrome     EYA1, TFAP2A
Butterfly-Shaped Pigment Dystrophy CTNNA1, PRPH2
Cafe-Au-Lait Spots, Multiple     NF1
Cataracts                        GEMIN4, CYP51A1, RIC1, TAPT1, TAF1A,
                                 WDR87, APE1, MIP, Cx50/GJA3 and 8, CRYAA,
                                 CRYBB2, PRX, POLR3B, XRCC1, ZNF350,
                                 EPHA2, CRYGC
Cerebral Cavernous Malformation, KRIT1, PDCD10
Familial
Cerebral Cavernous Malformations CCM2, KRIT1
Cerebral Cavernous Malformations 2 CCM2
Cerebral Cavernous Malformations 3 KRIT1, PDCD10
Cerebral Creatine Deficiency     GAMT
Syndrome 2
Cerebroretinal Microangiopathy with CTC1
Calcifications and Cysts 1
Ceroid Lipofuscinosis, Neuronal, 11 GRN
Ceroid Lipofuscinosis, Neuronal, 3 CLN3
Ceroid Lipofuscinosis, Neuronal, 4 CLN6
Ceroid Lipofuscinosis, Neuronal, 6a CLN5, CLN6, SMPD1, TPP1
Ceroid Lipofuscinosis, Neuronal, 8, CLN8
Northern Epilepsy Variant
Charge Syndrome                  CHD7, PUF60
Chorioretinal Scar               CHD7
Choroidal Dystrophy,             PRPH2
Central Areolar 2
Choroidal Dystrophy,             GUCY2D, PRPH2
Central Areolar, 1
Choroideraemia                   REP1
Choroideremia                    CHM, Rab escort protein
Cohen Syndrome                   VPS13B
Coloboma of Iris                 PRR12, TMEM67
Coloboma of Macula               CDON, YAP1
Coloboma, Ocular, Autosomal      SERPINA1
Dominant
Coloboma, Ocular, Autosomal      SALL2
Recessive
Colorblindness, Partial, Protan Series OPN1LW
Cone Dystrophy                   UPF1
Cone Dystrophy 4                 PDE6C
Cone-Rod Dystrophy 15            CDHR1
Cone-Rod Dystrophy 2             CABP4, CEP290, CERKL, CRB1, CRX, DRAM2,
                                 FAM161A, GUCY2D, PROM1, PRPH2, RPGR,
                                 TTLL5, USH2A
Cone-Rod Dystrophy 22            TLCD3B
Cone-Rod Dystrophy 3             ABCA4
Cone-Rod Dystrophy 6             ABCA4, ABHD12, CABP4, CERKL, CNGA3,
                                 GUCY2D, KCNV2, NMNAT1, SAG, SRD5A3,
                                 WDR19
Cone-Rod Dystrophy 9             ADAM9
Congenital Dyserythropoietic Anemia PNPLA1, TGM1
Congenital Ptosis                FBN1
Congenital Retinal Arteriovenous MITF, MYO15A, USH2A
Communication
Congenital Stationary Night Blindness ABCA4, CABP4, CACNA1F, GRK1, NYX,
                                 PDE6B, TRPM1
Contractural Arachnodactyly,     FBN2
Congenital
Corpus Callosum, Agenesis of     ARID1B, CDH2, CREBBP, DCC
D-Bifunctional Protein Deficiency HSD17B4
Deafness, Autosomal Recessive 18a USH1C
Deafness, Autosomal Recessive 2  MYO7A
Deafness, Autosomal Recessive 31 WHRN
Diabetes and Deafness, Maternally MT-TE, MT-TL1
Inherited
Donnai-Barrow Syndrome           LRP2
Duchenne and Becker Muscular     DMD
Dystrophy
Dyskeratosis Congenita           CTC1, RTEL1, TERC, TERT, TINF2
Ectopia Lentis 2, Isolated, Autosomal ADAMTSL4
Recessive
Enhanced S-Cone Syndrome         NR2E3, NRL
Exudative Vitreoretinopathy      FZD4, LRP5, RCBTB1, ZNF408
Exudative Vitreoretinopathy 4    LRP5
Exudative Vitreoretinopathy 5    TSPAN12
Exudative Vitreoretinopathy 7    CTNNB1
Familial Retinoblastoma          RB1
Focal Dermal Hypoplasia          PORCN
Fundus Albipunctatus             PRPH2, RDH5, RHO, RLBP1
Fundus Dystrophy                 ABCA4, ABHD12, ADGRV1, AHI1, AIPL1,
                                 ALMS1, ARL2BP, BBS1, BBS10, BBS12, BBS2,
                                 BBS9, BEST1, C1QTNF5, CABP4, CACNA1F,
                                 CC2D2A, CDH23, CDH3, CDHR1, CDKL5; RS1,
                                 CEP290, CEP78, CERKL, CFAP410, CHM, CLN3,
                                 CLRN1, CNGA1, CNGA3, CNGB1, CNGB3,
                                 COL18A1, COL2A1, CRB1, CRX, CYP4V2,
                                 DRAM2, EYS, FAM161A, FLVCR1, FRMD7,
                                 GRM6, GUCY2D, HGSNAT, HK1, IFT140,
                                 IFT172, IMPG1, IMPG2, INPP5E, IQCB1, KCNV2,
                                 KIF11, KIZ, LCA5, LRAT, LRP5, MERTK, MFRP,
                                 MYO7A, NMNAT1, NPHP4, NR2E3, NRL, OAT,
                                 OPA1, PCARE, PCDH15, PDE6A, PDE6B, PDE6C,
                                 PEX1, PRCD, PROM1, PRPF31, PRPF8, PRPH2,
                                 RBP3, RDH12, RDH5, RHO, RLBP1, RP1, RP1L1,
                                 RP2, RPE65, RPGR, RPGRIP1, RS1, SAG,
                                 SLC24A1, SNRNP200, SPATA7, TOPORS,
                                 TTLL5, TULP1, USH2A
Glaucoma                         CALM2, MPP-7, Optineurin, LOX1, CYP1B1,
                                 CAV1/2, MYOC, PITX2, FOXC1, PAX6, CYP1B1,
                                 LTBP2
Glaucoma 1, Open Angle, F        ASB10, OPTN
Glaucoma 3, Primary Congenital, a CYP1B1
Glaucoma, Primary Open Angle     LTBP2, MYOC, OPTN
Glucocorticoid Deficiency 4 with or NNT
Without Mineralocorticoid Deficiency
Glycogen Storage Disease Iv      GBE1
Gm1 Gangliosidosis               GLB1
Gyrate Atrophy of Choroid and Retina OAT, RIMS1
Hemophagocytic                   UNC13D
Lymphohistiocytosis, Familial, 3
Hereditary Spastic Paraplegia    ALDH18A1, AP4B1, AP4M1, AP5Z1, ATL1,
                                 CYP2U1, CYP7B1, DDHD2, FA2H, GBA2, KIF1C,
                                 NIPA1, PNPLA6, POLG, REEP1, SACS, SPAST,
                                 SPG11, SPG21, SPG7, ZFYVE26
Hermansky-Pudlak Syndrome        BLOC1S6, HPS1, HPS3, HPS4, HPS5, HPS6,
                                 RUNX1
Hermansky-Pudlak Syndrome 8      BLOC1S3
Heterochromia Iridis             MITF
Hyperornithinemia-               SLC25A15
Hyperammonemia-Homocitrullinuria
Syndrome
Iminoglycinuria                  SLC36A2
Incontinentia Pigmenti           IKBKG
Inherited Retinal Disorder       VPS13B
Intraocular Pressure Quantitative Trait ZEB1
Locus
Isolated Ectopia Lentis          FBN1
Jalili Syndrome                  CNNM4
Joubert Syndrome 3               AHI1
Juvenile Retinoschisis           ATP1A3
Kearns-Sayre Syndrome            MT-TL1, MT-TY
Keratitis, Neurotrophic          NGF
Keratoconjunctivitis, Atopic
Keratoconjunctivitis, Vernal
Keratomalacia                    CEP290
Knobloch Syndrome                COL18A1
Kufor-Rakeb Syndrome             ATP13A2
Late-Onset Retinal Degeneration  C1QTNF5
Leber congenital amaurosis (LCA) RPE65, GUCY2D, KIR7.1
Leber Congenital Amaurosis 1     CRB1, GUCY2D, LCA5, RPGRIP1, TULP1
Leber Congenital Amaurosis 10    CEP290
Leber Congenital Amaurosis 12    RD3
Leber Congenital Amaurosis 13    RDH12
Leber Congenital Amaurosis 14    LRAT
Leber Congenital Amaurosis 15    TULP1
Leber Congenital Amaurosis 16    KCNJ13
Leber Congenital Amaurosis 17    GDF6
Leber Congenital Amaurosis 19    USP45
Leber Congenital Amaurosis 2     RPE65
Leber Congenital Amaurosis 3     SPATA7
Leber Congenital Amaurosis 4     AIPL1
Leber Congenital Amaurosis 5     LCA5
Leber Congenital Amaurosis 6     RPGRIP1
Leber Congenital Amaurosis 7     CRX
Leber Congenital Amaurosis 8     CRB1
Leber Congenital Amaurosis 9     NMNAT1
Leber hereditary optic neuropathy ND4, MT-ND1
(LHON)
Leber Hereditary Optic Neuropathy, MT-ATP6, MT-ND1, MT-ND2, MT-ND4, MT-
Modifier of                      ND4L, MT-ND5, MT-ND6, NDUFS2
Leber Plus Disease               ABCA4, AHI1, AIPL1, ALMS1, CEP290, CRB1,
                                 GRM6, GUCY2D, INPP5E, IQCB1, LCA5, LRAT,
                                 NDUFAF5, NMNAT1, PDE6B, PEX1, RDH12,
                                 RP2, RPE65, RPGRIP1, SLC38A8, SPATA7,
                                 TULP1, USH2A
Liberfarb Syndrome               PISD
Long-Chain 3-Hydroxyacyl-Coa     HADHA, HADHB, HMGCL
Dehydrogenase Deficiency
Macular Degeneration, Age-Related, CFI
13
Macular Degeneration, Age-Related, ABCA4, MT-TL1
2
Macular Degeneration, diabetic   VEGFA, VEGFC
Macular Degeneration, Oedema     VEGFA, VEGFC
Macular Dystrophy, Patterned, 1  PRPH2
Macular Dystrophy, Vitelliform, 2 BEST1, IMPG2, PRPH2
Macular Dystrophy, Vitelliform, 3 PRPH2
Macular Dystrophy, Vitelliform, 4 IMPG1
Macular Dystrophy, Vitelliform, 5 IMPG2
Marfan Syndrome                  FBN1, TGFBR2, MTHFR, MTR, MTRR
Maturity-Onset Diabetes of the Young APPL1, GCK, HNF1A, HNF1B, KCNJ11, MLKL
Melanoma, Uveal                  SF3B1
Mental Retardation, Truncal Obesity, INPP5E
Retinal Dystrophy, and Micropenis
Syndrome
Methylmalonic Acidemia with      MMACHC
Homocystinuria
Microcephaly and Chorioretinopathy, TUBGCP6
Autosomal Recessive, 1
Microcephaly and Chorioretinopathy, TUBGCP4
Autosomal Recessive, 3
Microcephaly with or Without     KIF11
Chorioretinopathy, Lymphedema, or
Mental Retardation
Microphthalmia                   ALDH1A3
Microphthalmia, Isolated 2       VSX2
Microphthalmia, Isolated 3       RAX
Microphthalmia, Isolated 5       MFRP
Microphthalmia, Isolated 7       GDF3
Microphthalmia, Isolated, with   RBP4
Coloboma 10
Microphthalmia, Isolated, with   SHH
Coloboma 5
Microphthalmia, Isolated, with   GDF6
Coloboma 6
Microphthalmia, Isolated, with   ABCB6
Coloboma 7
Microphthalmia, Isolated, with   TENM3
Coloboma 9
Microphthalmia, Syndromic 9      STRA6, WNT7B
Mrcs Syndrome                    BEST1
Mucolipidosis Iv                 MCOLN1
Multiple Congenital Anomalies-   PIGT
Hypotonia-Seizures Syndrome 3
Muscular Dystrophy, Becker Type  DMD
Muscular Dystrophy-              POMGNT1
Dystroglycanopathy, Type a, 3
Muscular Dystrophy-              POMGNT1
Dystroglycanopathy, Type B, 3
Muscular Dystrophy-              POMGNT1
Dystroglycanopathy, Type C, 3
Myeloperoxidase Deficiency       MPO
Myopia                           HGF, C-MET, UMODL1, MMP-1/2, PAX6, CBS,
                                 MTHFR, IGF-1, UHRF1BPIL, PTPRR, PPFIA2,
                                 P4HA2
Myopia 2, Autosomal Dominant     CNP
Myopia 21, Autosomal Dominant    ZNF644
Myopia 24, Autosomal Dominant    SLC39A5
Myopia 25, Autosomal Dominant    P4HA2
Myopia 26, X-Linked, Female-     ARR3
Limited
Myopia 27, Autosomal Dominant    CPSF1
Myopia 6                         NCAPH2; SCO2; TYMP, TYMP; NCAPH2; SCO2
Myotonia Congenita, Autosomal    CLCN1
Recessive
Neonatal Adrenoleukodystrophy    PEX1
Neurofibromatosis, Type Ii       NF2
Neuronal Ceroid Lipofuscinosis   CLN3, CLN5, CLN6, CLN8, CTSD, PPT1, TPP1
Neuronal Ceroid-Lipofuscinoses   PPT1
Neuroocular Syndrome             PRR12
Neuropathy, Ataxia, and Retinitis MT-ATP6
Pigmentosa
Neuropathy, Ischaemic Optic
Nevus of Ota                     HRAS
Newfoundland Rod-Cone Dystrophy  RLBP1
Night Blindness, Congenital      RHO
Stationary, Autosomal Dominant 1
Night Blindness, Congenital      GPR179
Stationary, Type 1e
Night Blindness, Congenital      CACNA1F
Stationary, Type 2a
Nonsyndromic Hearing Loss        GJB2, GJB3, GJB6, SOHLH1
Noonan Syndrome with Multiple    PTPN11, RAF1
Lentigines
Norrie Disease                   NDP
Oculocutaneous Albinism          SLC24A5, TYR
Oculocutaneous Albinism, Type Viii DCT
Oguchi Disease 1                 SAG
Oliver-Mcfarlane Syndrome        PNPLA6
Opitz Gbbb Syndrome              MID1, SPECC1L
Optic Atrophy 1                  MT-ATP8
Optic Atrophy 10 with or Without RTN4IP1
Ataxia, Mental Retardation, and
Seizures
Optic Atrophy 12                 AFG3L2
Optic Atrophy 13 with Retinal and SSBP1
Foveal Abnormalities
Optic Atrophy 3, Autosomal       DNAJC19, MT-ND1, OPA3
Dominant
Optic Atrophy 7 with or Without  TMEM126A
Auditory Neuropathy
Optic Atrophy 9                  ACO2
Optic Atrophy with or Without    OPA1
Deafness, Ophthalmoplegia,
Myopathy, Ataxia, and Neuropathy
Optic Nerve Glioma               NF1
Optic Nerve Hypoplasia, Bilateral ATOH7, COL4A1, PAX6
Optical Neuropathy               Complex I or ND genes, OPA1, RPE65
Osteopetrosis, Autosomal Recessive 3 CA2
Osteoporosis-Pseudoglioma        LRP5
Syndrome
Papillorenal Syndrome            PAX2
Pathologic Nystagmus             CEP290
Pendred Syndrome                 FOXI1, SLC26A4
Peroxisomal Disease              PEX1
Persistent Hyperplastic Primary  ATOH7
Vitreous, Autosomal Recessive
Pigmented Paravenous Chorioretinal CRB1, MT-TH, PRPH2
Atrophy
Polypoidal Choroidal Vasculopathy C2, C3, CFH, SERPING1, PEDF, ARMS2-HTRA1,
                                 FGD6, ABCG1, LOC387715, CETP
Posterior Column Ataxia with     FLVCR1
Retinitis Pigmentosa
Primary Congenital Glaucoma      CYP1B1
Primary Hyperoxaluria            AGXT, GRHPR
Progressive External Ophthalmoplegia MT-TL1, POLG
with Mitochondrial Dna Deletions,
Autosomal Dominant 1
Progressive External Ophthalmoplegia SLC25A4
with Mitochondrial Dna Deletions,
Autosomal Dominant 2
Progressive External Ophthalmoplegia TWNK
with Mitochondrial Dna Deletions,
Autosomal Dominant 3
Progressive External Ophthalmoplegia POLG2
with Mitochondrial Dna Deletions,
Autosomal Dominant 4
Progressive External Ophthalmoplegia POLG, TWNK
with Mitochondrial Dna Deletions,
Autosomal Recessive 1
Progressive Myoclonus Epilepsy   CSTB, EPM2A, GOSR2, SCARB2
Proliferative Vasculopathy and   FLVCR2
Hydranencephaly-Hydrocephaly
Syndrome
Prolonged Electroretinal Response F2, KCNH2
Suppression
Pseudoxanthoma Elasticum         ABCC2, ABCC6
Pyruvate Carboxylase Deficiency  PC
Rare Genetic Deafness            ACTG1, ADGRV1, ATP6V1B1, CDC14A, CDH23,
                                 CLRN1, COL4A5, DIAPH1, EDNRB, ESRRB,
                                 EYA1, GIPC3, GJB2, GPSM2, GRXCR1, KCNQ4,
                                 LOXHD1, LRTOMT, MARVELD2, MITF,
                                 MSRB3, MT-RNR1, MT-TS1, MYO15A, MYO6,
                                 MYO7A, OTOA, OTOF, OTOG, OTOGL, PAX3,
                                 PCDH15, PJVK, POU3F4, SERPINB6, SLC26A4,
                                 SOX10, STRC, SYNE4, TECTA, TMC1,
                                 TMPRSS3, USH1C, USH2A, WFS1, WHRN
Refsum Disease, Classic          PEX7, PHYH
Retinal Arterial Macroaneurysm with IGFBP7
Supravalvular Pulmonic Stenosis
Retinal Arteries, Tortuosity of  COL4A1
Retinal Cone Dystrophy 3b        KCNV2
Retinal Dystrophy and Obesity    TUB
Retinal Dystrophy, Iris Coloboma, RBP4
and Comedogenic Acne Syndrome
Retinal Vascular Occlusion       BBS9
Retinitis                        RLBP1
Retinitis Pigmentosa             ABCA4, ADGRV1, AHI1, ALMS1, BBS1,
                                 BBS1; ZDHHC24, BBS2, BBS7, CACNA1F, CDH3,
                                 CDHR1, CEP290, CERKL, CHM, CLRN1, CNGA1,
                                 CNGB1, CRB1, EYS, FAM161A, FLVCR1,
                                 GUCY2D, HGSNAT, IFT140, IFT172, IMPG2,
                                 LCA5, MAK, MERTK, MYO7A, NR2E3, NRL,
                                 P3H2, PANK2, PCARE, PDE6A, PDE6B, PPT1,
                                 PRCD, PROM1, PRPF31, PRPF8, PRPH2,
                                 RCBTB1, RDH12, RHO, RLBP1, RP1, RP1L1,
                                 RP2, RPE65, RPGR, RPGRIP1, SLC24A1,
                                 SNRNP200, SPATA7, TTLL5, TULP1, USH2A,
                                 VPS13B, VSX2
Retinitis Pigmentosa (RP, including RLBP1
RLBP1)
Retinitis Pigmentosa 1           RP1
Retinitis Pigmentosa 10          IMPDH1
Retinitis Pigmentosa 11          PRPF31
Retinitis Pigmentosa 12          CRB1
Retinitis Pigmentosa 13          PRPF8
Retinitis Pigmentosa 14          TULP1
Retinitis Pigmentosa 19          ABCA4
Retinitis Pigmentosa 2           RP2
Retinitis Pigmentosa 20          RPE65
Retinitis Pigmentosa 23          OFD1
Retinitis Pigmentosa 25          EYS
Retinitis Pigmentosa 26          CERKL
Retinitis Pigmentosa 27          NRL
Retinitis Pigmentosa 28          FAM161A
Retinitis Pigmentosa 3           RP2, RPGR
Retinitis Pigmentosa 33          SNRNP200
Retinitis Pigmentosa 36          CYGB; PRCD, PRCD
Retinitis Pigmentosa 37          NR2E3
Retinitis Pigmentosa 38          MERTK
Retinitis Pigmentosa 39          USH2A
Retinitis Pigmentosa 4           CFAP418, RHO
Retinitis Pigmentosa 40          PDE6B, PDE6B; PDE6B-AS1
Retinitis Pigmentosa 41          PROM1
Retinitis Pigmentosa 42          KLHL7
Retinitis Pigmentosa 43          PDE6A
Retinitis Pigmentosa 45          CNGB1
Retinitis Pigmentosa 47          SAG
Retinitis Pigmentosa 49          CNGA1
Retinitis Pigmentosa 54          PCARE
Retinitis Pigmentosa 55          ARL6
Retinitis Pigmentosa 56          IMPG2
Retinitis Pigmentosa 59          DHDDS
Retinitis Pigmentosa 6           RPGR
Retinitis Pigmentosa 62          MAK
Retinitis Pigmentosa 66          RBP3
Retinitis Pigmentosa 69          KIZ
Retinitis Pigmentosa 7           PRPH2
Retinitis Pigmentosa 76          POMGNT1
Retinitis Pigmentosa 77          REEP6
Retinitis Pigmentosa 85          AHR
Retinitis Pigmentosa 88          RP1L1
Retinitis Pigmentosa 90          IDH3 A
Retinitis Pigmentosa 91          ABCA4, CRX, IMPG1
Retinitis Pigmentosa-Deafness    MT-TS2
Syndrome
Retinopathy (e.g., diabetic)
Retinoschisis 1, X-Linked, Juvenile CDKL5; RS1, RS1
Revesz Syndrome                  TINF2
Rhizomelic Chondrodysplasia      GNPAT
Punctata, Type 2
Saul-Wilson Syndrome             COG4
Senior-Loken Syndrome 1          IQCB1, NPHP1, SDCCAG8, TRAF3IP1, WDR19
Severe Early-Childhood-Onset Retinal ABCA4, ALMS1
Dystrophy
Short Stature, Optic Nerve Atrophy, NBAS
and Pelger-Huet Anomaly
Short-Rib Thoracic Dysplasia 5 with WDR19
or Without Polydactyly
Short-Rib Thoracic Dysplasia 9 with IFT140
or Without Polydactyly
Sjogren-Larsson Syndrome         ALDH3A2
Spastic Ataxia, Charlevoix-Saguenay SACS
Type
Spastic Paraplegia 15, Autosomal ZFYVE26
Recessive
Spondylometaphyseal Dysplasia,   CFAP410
Axial
Stargardt disease                ABCA1, ABCA4, CRB1
Stargardt Disease                ABCA4, BEST1, COL2A1, CRB1, CRX, PRPH2,
                                 TULP1
Stargardt Disease 3              ELOVL4
Stickler Syndrome                COL9A2
Stickler Syndrome, Type I,       COL2A1
Nonsyndromic Ocular
Sveinsson Chorioretinal Atrophy  SEMA4A
Syndromic Rod-Cone Dystrophy     EPG5, KIF11
Tay-Sachs Disease                HEXA
Temtamy Syndrome                 C12orf57
Tetrahydrobiopterin Deficiency   ATP1A3
Tietz Albinism-Deafness Syndrome MITF
Tumoral Calcinosis,              FGF23
Hyperphosphatemic, Familial, 1
Usher Syndrome                   ADGRV1, CEP250, CLRN1, MYO7A, PROM1,
                                 USH1C, USH1G, USH2A
Usher Syndrome 2A                USH2A
Usher Syndrome Type 2            ADGRV1, CDH23, USH2A
Usher Syndrome, Type I           CDH23, MYO7A, PCDH15, USH1C
Usher Syndrome, Type I (USH1)    MYO7A
Usher Syndrome, Type Ic          USH1C
Usher Syndrome, Type Id          CDH23, PCDH15
Usher Syndrome, Type if          PCDH15
Usher Syndrome, Type Ig          PCDH15, USH1G
Usher Syndrome, Type Iia         USH2A
Usher Syndrome, Type lic         ADGRV1
Usher Syndrome, Type Iid         WHRN
Usher Syndrome, Type Iiia        CLRN1
Usher Syndrome, Type Iv          ARSG
Uveal Melanoma                   PTEN, BAP1, GNAQ, GNA11, DDEF1, SF3B1,
                                 EIF1AX, CDKN2A, p14ARF, HERC2/OCA2
Uveitis
Vascular Dementia                HTRA1, NOTCH3
Vasculopathy, Retinal, with Cerebral TREX1
Leukoencephalopathy and Systemic
Manifestations
Von Hippel-Lindau Syndrome       VHL
Wagner Vitreoretinopathy         VCAN
Walker-Warburg Syndrome          FKRP, FKTN, POMT1
Weaver Syndrome                  EZH2
Wet AMD                          Anti-VEGF antibody
Wet AMD, Dry AMD                 NRP1
X-linked retinitis pigmentosa (X- RPGR
linked RP)
X-linked Retinoschisis           RS1

In some embodiments, the therapeutic polynucleotide encodes a therapeutic RNA. In some embodiments the therapeutic polynucleotide encodes an RNA, such as a guide RNA (including an engineered or synthetic guide RNA) for genome editing or for RNA editing. The guide RNA may target a gene, such as those provided in TABLE 1 or encoding a protein nucleotide provided in TABLE 1, to promote editing of the target gene. In some embodiments, editing of the target gene may treat a condition in a subject, such as a condition provided in TABLE 1.

In some embodiments, the therapeutic polynucleotide encodes a tRNA or a modified tRNA (engineered or synthetic tRNA). For example, the tRNA or modified tRNA can be a suppressor tRNA. The suppressor tRNA can be engineered to have an anticodon region that recognizes a stop codon, such as any premature stop codon (opal, ochre, or amber stop codons). A suppressor tRNA may target a premature stop codon in a gene, such as those provided in TABLE 1 or encoding a protein nucleotide provided in TABLE 1, to promote readthrough of the gene. In some embodiments, suppressing the premature stop codon may treat a condition in a subject, such as a condition provided in TABLE 1.

In some embodiments, the therapeutic polynucleotide (e.g., a therapeutic RNA, a tRNA, or a genome modifying entity) can target a gene listed in TABLE 1 or any gene associated with an ocular disease, such as achromatopsia, macular degeneration (e.g., wet AMD or dry AMD), cataracts, choroideremia, glaucoma, optical neuropathy, Marfan syndrome, myopia, polypoidal choroidal vasculopathy, retinitis pigmentosa, Stargardt disease, Usher syndrome, Leber congenital amaurosis, Leber hereditary optical neuropathy, Uveal melanoma, or X-linked retinoschisis, or any genetic disease affecting an ocular tissue. In some embodiments, the targeted gene may be CNGB3, NOS2A, CFH, CF, C2, C3, CFB, HTRA1/LOC, MMP-9, TIMP-3, SLC16A8, GEMIN4, CYP51A1, RIC1, TAPT1, TAF1A, WDR87, APE1, MIP, Cx50/GJA3 and 8, CRYAA, CRYBB2, PRX, POLR3B, XRCC1, ZNF350, EPHA2, REP1, CALM2, MPP-7, Optineurin, LOX1, CYP1B1, CAV1/2, MYOC, PITX2, FOXC1, PAX6, LTBP2, Complex I or ND genes, OPA1, RPE65, FBN1, TGFBR2, MTHFR, MTR, MTRR, HGF, C-MET, UMODL1, MMP-1/2, CBS, IGF-1, UHRF1BP1L, PTPRR, PPFIA2, P4HA2, SERPING1, PEDF, ARMS2-HTRA1, FGD6, ABCG1, LOC387715, CETP, NRL, RDH12, PRPH2 (RDS), RHO, RPGR, NR2E3, IMPDH1, CRX, HK1, IMPDH2, SNRNP200, PRPF3, AGBL5, ABCA1, ABCA4, CRB1, USH2A, NRP1, ND4, RLBP1, PTEN, BAP1, GNAQ, GNA11, DDEF1, SF3B1, EIF1AX, CDKN2A, p14ARF, HERC2/OCA2, VEGF, RS1, a fragment any of these, or any combination thereof. In some embodiments, the therapeutic polynucleotide is a gene therapy payload (e.g., a transgene) and, thus, may itself be one of the genes listed in TABLE 1 or any gene associated with an ocular disease, such as achromatopsia, macular degeneration (e.g., wet AMD or dry AMD), cataracts, choroideremia, glaucoma, optical neuropathy, Marfan syndrome, myopia, polypoidal choroidal vasculopathy, retinitis pigmentosa, Stargardt disease, Usher syndrome, Leber congenital amaurosis, Leber hereditary optical neuropathy, Uveal melanoma, or X-linked retinoschisis, or any genetic disease. In some embodiments, the transgene may be CNGB3, NOS2A, CFH, CF, C2, C3, CFB, HTRA1/LOC, MMP-9, TIMP-3, SLC16A8, GEMIN4, CYP51A1, RIC1, TAPT1, TAF1A, WDR87, APE1, MIP, Cx50/GJA3 and 8, CRYAA, CRYBB2, PRX, POLR3B, XRCC1, ZNF350, EPHA2, REP1, CALM2, MPP-7, Optineurin, LOX1, CYP1B1, CAV1/2, MYOC, PITX2, FOXC1, PAX6, LTBP2, Complex I or ND genes, OPA1, RPE65, FBN1, TGFBR2, MTHFR, MTR, MTRR, HGF, C-MET, UMODL1, MMP-1/2, CBS, IGF-1, UHRF1BP1L, PTPRR, PPFIA2, P4HA2, SERPING1, PEDF, ARMS2-HTRA1, FGD6, ABCG1, LOC387715, CETP, NRL, RDH12, PRPH2 (RDS), RHO, RPGR, NR2E3, IMPDH1, CRX, HK1, IMPDH2, SNRNP200, PRPF3, AGBL5, ABCA1, ABCA4, CRB1, USH2A, NRP1, ND4, RLBP1, PTEN, BAP1, GNAQ, GNA11, DDEF1, SF3B1, EIF1AX, CDKN2A, p14ARF, HERC2/OCA2, VEGF, RS1, a fragment any of these, or any combination thereof. In some embodiments, the transgene may encode a protein that targets a gene, a protein, or a protein encoded by a gene provided in TABLE 1, a fragment any of these, or any combination thereof.

An engineered AAV comprising a VP capsid polypeptide comprising an ocular tissue-tropic 581 to 589 region may be used to deliver a payload to treat an ocular condition, or a condition of the eye. For example, an engineered AAV comprising a VP capsid polypeptide comprising a 581 to 589 region conferring ocular tissue tropism may be used to treat an ocular condition (e.g., achromatopsia, macular degeneration (e.g., wet AMD or dry AMD), cataracts, choroideremia, glaucoma, optical neuropathy, Marfan syndrome, myopia, polypoidal choroidal vasculopathy, retinitis pigmentosa, Stargardt disease, Usher syndrome, Leber congenital amaurosis, Leber hereditary optical neuropathy, Uveal melanoma, or X-linked retinoschisis). The 581 to 589 region of the VP capsid polypeptide may have a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, the engineered AAV comprising a VP capsid polypeptide comprising an ocular tissue-tropic 581 to 589 region may be used to deliver a transgene encoding a protein associated with an ocular condition or that targets a protein associated with an ocular condition (e.g., a protein encoded by CNGB3, NOS2A, CFH, CF, C2, C3, CFB, HTRA1/LOC, MMP-9, TIMP-3, SLC16A8, GEMIN4, CYP51A1, RIC1, TAPT1, TAF1A, WDR87, APE1, MIP, Cx50/GJA3 and 8, CRYAA, CRYBB2, PRX, POLR3B, XRCC1, ZNF350, EPHA2, REP1, CALM2, MPP-7, Optineurin, LOX1, CYP1B1, CAV1/2, MYOC, PITX2, FOXC1, PAX6, LTBP2, Complex I or ND genes, OPA1, RPE65, FBN1, TGFBR2, MTHFR, MTR, MTRR, HGF, C-MET, UMODL1, MMP-1/2, CBS, IGF-1, UHRF1BP1L, PTPRR, PPFIA2, P4HA2, SERPING1, PEDF, ARMS2-HTRA1, FGD6, ABCG1, LOC387715, CETP, NRL, RDH12, PRPH2 (RDS), RHO, RPGR, NR2E3, IMPDH1, CRX, HK1, IMPDH2, SNRNP200, PRPF3, AGBL5, ABCA1, ABCA4, CRB1, USH2A, NRP1, ND4, RLBP1, PTEN, BAP1, GNAQ, GNA11, DDEF1, SF3B1, EIF1AX, CDKN2A, p14ARF, HERC2/OCA2, VEGF, RS1). For example, an engineered AAV comprising a VP capsid polypeptide comprising a retina tissue-tropic 581 to 589 region (e.g., any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513) may be used to deliver a payload encoding a therapeutic protein associated with retinitis pigmentosa (e.g., NRL, RDH12, PRPH2 (RDS), RHO, RPGR, SNRNP200, NR2E3, IMPDH1, CRX, HK1, IMPDH2, SNRNP200, PRPF3, or AGBL5) to retina tissue to treat retinitis pigmentosa. In another example, an engineered AAV comprising a VP capsid polypeptide comprising an RPE tissue-tropic 581 to 589 region (e.g., any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013) may be used to deliver a payload encoding a therapeutic protein associated with dry age-related macular degeneration to RPE tissue to treat dry age-related macular degeneration.

In some embodiments, the therapeutic polynucleotide encodes genome modifying entities. For example, a genome modifying entity may be a DNA editing enzyme, an RNA editing enzyme, a transcriptional activator, or a transcriptional repressor. The DNA editing enzyme may be any DNA editing enzyme, including any CRISPR/Cas systems, meganucleases, zinc-finger nucleases, (ZFNs), TALE Nucleases (TALENs and megaTALENS). The CRISPR/Cas system can be a Cas3, Cas8, Cas10, Cas9, Cas4, Cas12, or Cas13. The RNA editing enzyme may be ADAR. In some embodiments, the ADAR is a human ADAR1 or human ADAR2. The transcriptional activator may be VP64. A transcriptional repressor may be KRAB. Such genome modifying entities may target any gene listed in TABLE 1 for editing.

In some embodiments, the present disclosure provides for rAAV virions having an engineered AAV VP capsid polypeptide (e.g., comprising a 581 to 589 region variant), where the virion encapsidates any one of or any combination of the therapeutic payloads disclosed herein. In some embodiments, multiple copies of the therapeutic payload are encapsidated. The 581 to 589 region of the engineered AAV VP capsid polypeptide may have a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013.

In some embodiments, the therapeutic polynucleotide is a polynucleotide capable of serving as a homology template for homology-directed repair. In some embodiments, the therapeutic polynucleotide may be a guide polynucleotide for a CRISPR/Cas system or an ADAR enzyme. For example, the therapeutic polynucleotide may be a CRISPR/Cas guide RNA or an ADAR guide RNA.

In some embodiments, an rAAV virion of the present disclosure, having any of the engineered AAV VP capsid polypeptide sequences disclosed herein, comprises a vector genome, the vector genome comprising a detectable polynucleotide or payload. In further embodiments, said payload may be under control of regulatory sequences that direct expression in infected human cells. In some embodiments, the payload may be under control of a cell type- or tissue type-specific promoter to direct expression in a target cell type or target tissue type. For example, expression of the payload may be under control of a retinal-specific promoter to promote retinal-specific expression, a retinal pigment epithelium-specific promoter to promote retinal pigment epithelium-specific expression, a choroid-specific promoter to promote choroid-specific expression, a photoreceptor-specific promoter to promote photoreceptor-specific expression, or an optic nerve-specific promoter to promote optic nerve-specific expression. Examples of detectable polynucleotides include, but are not limited to, any genetically encodable detectable moiety. For example, a genetically encodable detectable moiety may be a fluorescent protein such as EGFP, GFP, YFP, RFP, CFP, or any variants thereof. In some embodiments, the present disclosure provides for rAAV virions having an engineered AAV VP capsid polypeptide, where the virion encapsidates any one of or any combination of the detectable payloads disclosed herein. In some embodiments, multiple copies of the detectable payload are encapsidated.

In some embodiments, the present disclosure provides for rAAV virions having an engineered AAV VP capsid polypeptide, where the virion encapsidates any one of or any combination of the therapeutic payloads and detectable payloads disclosed herein. For example, an rAAV of the present disclosure having an engineered AAV VP capsid polypeptide may encapsidate a transgene and a fluorescent protein. As another example, an rAAV of the present disclosure having an engineered AAV VP capsid polypeptide may encapsidate a therapeutic RNA (e.g., a guide RNA) and a fluorescent protein.

Delivering a payload (e.g., a payload encoding a therapeutic polypeptide or a therapeutic polynucleotide) using the ocular tissue specific AAVs described herein may produce lower toxicity in a subject compared to non-specific AAVs (e.g., AAVs comprising a VP1 polypeptide of SEQ ID NO: 1). Tissue specific AAVs (e.g., ocular tissue specific AAVs) may be effective at lower doses compared to non-specific AAVs since a larger fraction of the administered AAVs infect the relevant tissue (e.g., ocular tissue). As a result, a therapeutically effective dose of tissue specific AAVs may be lower than a therapeutically effective dose of non-specific AAVs, leading to lower toxicity due administering a lower dose. For example, administration of a therapeutically effective dose of tissue specific AAVs may result in lower liver toxicity than administration of a therapeutically effective dose of non-specific AAVs. Administration of a lower dose may also lead to lower production of neutralizing antibodies in the subject. Neutralizing antibodies may decrease the efficacy of the AAV therapy by inhibiting infection of the target tissue or may cause severe side effects in the subject due to the immune response. Additionally, tissue specific AAVs (e.g., ocular tissue specific) may produce fewer off-target effects compared to non-specific AAVs when administered at the same dose since fewer of the AAVs infect off target tissues (e.g., non-targeted ocular tissues such as aqueous humor or vitreous humor). Off-target effects may include increased gene expression in an off-target tissue, decreased gene expression in an off-target tissue, gene editing in an off-target tissue, immune response, or liver toxicity.

In Vivo Selected VP Polypeptides

In a further aspect, engineered (synonymously, recombinant) adeno-associated virus (AAV) VP capsid polypeptides identified using the methods described herein are provided.

In some embodiments, the engineered adeno-associated virus (AAV) viral protein (VP) capsid polypeptide has an amino acid sequence at least 70% identical to SEQ ID NO: 1, wherein the engineered AAV VP capsid polypeptide has at least one substitution as compared to SEQ ID NO: 1 in the 581 to 589 region, corresponding to residue 581 to residue 589 of SEQ ID NO: 1, inclusive, wherein the capsid polypeptide is capable of assembling into a recombinant AAV virion (rAAV), and wherein the VP capsid polypeptide does not have the sequence of any of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8. In some embodiments, the VP capsid polypeptide comprises one or more amino acid substitutions relative to SEQ ID NO: 1 in the region from residue 581 to residue 589, inclusive. The VP capsid polypeptide may comprise a sequence of SEQ ID NO: 2, wherein the 581 to 589 region has a sequence conferring ocular tissue tropism or preference.

In some embodiments, the engineered adeno-associated virus (AAV) viral protein (VP) capsid polypeptide is ocular tissue-tropic and has an amino acid sequence at least 70% identical to SEQ ID NO: 1, wherein the engineered AAV VP capsid polypeptide has at least one substitution as compared to SEQ ID NO: 1 in the 581 to 589 region, corresponding to residue 581 to residue 589 of SEQ ID NO: 1, inclusive, wherein the capsid polypeptide is capable of assembling into a recombinant AAV virion (rAAV), wherein the at least one substitution confers higher tropism for an ocular tissue on the rAAV as compared to an rAAV virion having an AAV5 VP capsid polypeptide of SEQ ID NO: 1, and wherein the VP capsid polypeptide does not have the sequence of any of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8. In some embodiments, the ocular tissue-tropic VP capsid polypeptide comprises one or more amino acid substitutions relative to SEQ ID NO: 1 in the region from residue 581 to residue 589, inclusive.

In particular embodiments, the engineered adeno-associated virus (AAV) viral protein (VP) capsid polypeptide (e.g., an ocular tissue-tropic VP capsid polypeptide) has an amino acid sequence at least 75%, 77.7%, 80%, 85%, 88.8%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% identical to the sequence of SEQ ID NO: 1.

In some embodiments, the AAV VP capsid polypeptide is an ocular tissue-tropic capsid polypeptide and has an amino acid sequence of SEQ ID NO: 2, wherein X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, and X⁹ are each independently selected from any amino acid, wherein the capsid polypeptide is capable of assembling into a recombinant AAV virion (rAAV), wherein the at least one substitution confers higher tropism for an ocular tissue on the rAAV as compared to an rAAV virion having an AAV5 VP capsid polypeptide of SEQ ID NO: 1, and wherein the VP capsid polypeptide does not have the sequence of any of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8, optionally with further mutations elsewhere in the VP capsid polypeptide. In some embodiments, X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹ (SEQ ID NO: 5014) of the ocular tissue-tropic VP capsid polypeptide correspond to a 581 to 589 region conferring ocular tissue tropism or preference.

In some embodiments, the engineered adeno-associated virus (AAV) viral protein (VP) capsid polypeptide (e.g., an ocular tissue-tropic VP capsid polypeptide) has an amino acid sequence of SEQ ID NO: 2, wherein amino acid residues X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, and X⁹ are each independently selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, and V; wherein the engineered AAV VP capsid polypeptide is capable of assembling into a recombinant AAV virion (rAAV); and wherein the rAAV VP capsid polypeptide does not have the sequence of any of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.

In some embodiments, the 581 to 589 region of the engineered VP capsid polypeptide, corresponding to residues 581 to 589, inclusive, with reference to SEQ ID NO: 1, has a sequence that is at least 70%, at least 75%, at least 77.7%, at least 80%, at least 85%, at least 88.8%,at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to a 581 to 589 region described herein. In some embodiments, the 581 to 589 region of the engineered VP capsid polypeptide comprises 1 amino acid substitution relative to a 581 to 589 region described herein. In some embodiments, the 581 to 589 region of the engineered VP capsid polypeptide comprises 2 amino acid substitutions relative to a 581 to 589 region described herein. In particular embodiments, the 581 to 589 region of the engineered VP capsid polypeptide has a sequence that is identical to a 581 to 589 region described herein.

In some embodiments, the engineered adeno-associated virus (AAV) viral protein (VP) capsid polypeptide is an engineered AAV5 viral capsid protein, wherein the engineered AAV VP5 capsid polypeptide has at least one substitution as compared to SEQ ID NO: 1 in the 581 to 589 region, corresponding to residues 581 to 589, inclusive, of SEQ ID NO: 1, inclusive; wherein the capsid polypeptide is capable of assembling into a recombinant AAV virion (rAAV); wherein the at least one substitution confers higher tropism for an ocular tissue on the rAAV as compared to an rAAV virion having an AAV5 VP capsid polypeptide of SEQ ID NO: 1, and wherein the VP capsid polypeptide does not have the sequence of any of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8, optionally with further mutations elsewhere in the VP protein.

In some embodiments, the AAV VP capsid polypeptides have an amino acid sequence of SEQ ID NO: 2, wherein X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, and X⁹ are each independently selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, and V; and wherein the polypeptide does not have the sequence of any of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8.

In some embodiments, the engineered AAV VP capsid polypeptide comprises a polypeptide sequence represented by the formula: (A)-(X)-(B) wherein: (A) is the polypeptide sequence of SEQ ID NO: 12 (VAYNVGGQMATNNQSSTTAP, corresponding to residues 561 to 580 of SEQ ID NO: 2); (X) is a 581 to 589 region that confers ocular tissue tropism on a recombinant AAV virion (rAAV); and (B) is the polypeptide sequence of SEQ ID NO: 13 (IVPGSVWMERDVYLQGPIWA, corresponding to residues 590 to 609 of SEQ ID NO: 2); and wherein the capsid polypeptide is capable of assembling into the rAAV and, the capsid does not have the sequence of any of SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, or SEQ ID NO: 8. Also encompassed herein are rAAVs composed of engineered AAV5 VP2 capsid polypeptides and engineered AAV5 VP3 capsid polypeptides comprising a 581 to 589 region that confers ocular tissue tropism at the region corresponding to amino acid residues 445 to 453 in AAV5 VP2 or the region corresponding to amino acid residues 389 to 397 in AAV5 VP3.

In some embodiments, the engineered AAV VP capsid polypeptide confers ocular tissue tropism or preference, wherein the ocular tissue is selected from the group consisting of aqueous humor, choroid, retina, optic nerve, vitreous humor, remaining eye tissue, and any combination thereof.

Described below are engineered mutated AAV5 VP1 polypeptide sequences that confer stable or improved virion assembly, tissue tropism, or both. In some embodiments, the present disclosure provides an AAV5 VP1 capsid polypeptide having a sequence homology of no more than 98.7% to SEQ ID NO: 1, wherein the AAV5 capsid polypeptide sequence has at least one mutation in a region from a position corresponding to 581 to a position corresponding to 589 of SEQ ID NO: 1. In some embodiments, an engineered AAV5 polypeptide comprises at least one amino acid substitution relative to residues 561 to 580 of SEQ ID NO: 1.

Also encompassed herein are rAAVs composed of engineered AAV5 VP2 capsid polypeptides and engineered AAV5 VP3 capsid polypeptides comprising a 581 to 589 region that confers ocular tissue tropism at the region corresponding to amino acid residues 445 to 453 in AAV5 VP2 or the region corresponding to amino acid residues 389 to 397 in AAV5 VP3.

Engineered VP Polypeptides Competent for rAAV Assembly

In various preferred embodiments, the mutated (engineered, recombinant) VP capsid polypeptides of the present disclosure are capable of forming an assembled virion, and in some instances that exhibit similar or improved stability when compared to a virion that comprises the AAV5 VP1 capsid polypeptide of SEQ ID NO: 1.

The frequency of a given amino acid residue occurring in assembled, purified viruses at a specified position within the 581 to 589 region, corresponding to position 581 to position 589 of SEQ ID NO: 1, or corresponding to X¹ to X⁹ as generalized in SEQ ID NO: 2, over the frequency of that given amino acid residue occurring at the specified position in the entire plasmid library was analyzed to identify sequence rules for capsid polypeptide sequences that favor viral capsid assembly. Based on the determined amino acid residue frequency, the contribution of each amino acid at each position of the 581 to 589 region to capsid assembly was determined, and sequences of the 581 to 589 region (X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹ of SEQ ID NO: 2) that favor capsid assembly, and rules for selecting sequences that favor capsid assembly, were identified.

Disclosed herein are engineered AAV5 VP capsid polypeptides capable of forming an assembled viral capsid that may exhibit similar or improved stability as compared to wild type AAV5 VP capsid polypeptide, wherein the engineered variant AAV5 VP capsid polypeptide sequence has one or more mutations, wherein the VP1 polypeptide sequence has said one or more mutations in a 581 to 589 region (corresponding to position 581 to position 589 in SEQ ID NO: 2), and wherein X¹ is selected from A, D, E, G, L, M, N, Q, S, T, or V, or X¹ is selected from A, D, E, M, or T. In some embodiments, X¹ is E; or X² is selected from A, C, D, E, G, H, I, N, P, Q, S, T, or V, or X² is selected from A, S, T, or V, or X² is A; or wherein X³ is selected from A, D, E, G, H, M, N, Q, S, T, or V, or X³ is selected from D, E, N, Q or T, or X³ is D or T; or wherein X⁴ is selected from A, D, E, G, H, N, P, Q, S, or T, or X⁴ is selected from D, E, P, or Q, or X⁴ is E; or wherein X⁵ is selected from A, C, D, E, G, H, N, Q, S, T, or Y, or X⁵ is selected from D, E, N, Q or T, or X⁵ is N; or wherein X⁶ is selected from A, D, E, G, H, N, P, Q, S, or T, or X⁶ is selected from D, N, or Q, or X⁶ is D; or wherein X⁷ is selected from A, C, D, E, G, H, N, Q, S, or T, or X⁷ is selected from A, D, E or G, or X⁷ is A; or wherein X⁸ is selected from A, C, D, E, G, H, N, Q, S, or T, or X⁸ comprises A, D, G, or S, or X⁸ is G; or wherein X⁹ is selected from A, D, E, G, H, N, P, Q, S, or T, or X⁹ is selected from A, D, G, or P, or X⁹ is G.

In various embodiments, the VP polypeptide is capable of forming an assembled viral capsid, and in some instances exhibits similar or improved stability when compared to a virion that comprises the AAV5 VP1 capsid polypeptide of SEQ ID NO:1.

Examples of amino acid substitutions within a 581 to 589 region that may favor viral capsid assembly are provided in TABLE 2. In some embodiments, the following amino acids can be independently mutated, in any combination, at any one or more positions X¹-X⁹, with reference to SEQ ID NO: 2, to provide an AAV VP1 capsid that is capable of assembling. Additionally, one or more mutations outside of the X¹-X⁹ region can be allowed, as long as the capsid is still capable of assembling.

TABLE 2
581 to 589 Region Amino Acid Variations for Viral Assembly
Viral Assembly Options
X1 is A, D, E, G, L, M, N, Q, S, T, or V
X1 is A, D, E, M, or T
X1 is E
X2 is A, C, D, E, G, H, I, N, P, Q, S, T, or V
X2 is A, S, T, or V
X2 is A
X3 is A, D, E, G, H, M, N, Q, S, T, or V
X3 is D, E, N, Q or T
X3 is D or T
X4 is A, D, E, G, H, N, P, Q, S, or T
X4 is D, E, P, or Q
X4 is E
X5 is A, C, D, E, G, H, N, Q, S, T, or Y
X5 is D, E, N, Q or T
X5 is N.
X6 is A, D, E, G, H, N, P, Q, S, or T;
X6 is D, N, or Q; or
X6 is D.
X7 is s A, C, D, E, G, H, N, Q, S, or T;
X7 is A, D, E or G; or
X7 is A.
X8 is A, C, D, E, G, H, N, Q, S, or T;
X8 is A, D, G, or S; or
X8 is G.
X9 is A, D, E, G, H, N, P, Q, S, or T;
X9 is A, D, G, or P; or
X9 is G.

581 to 589 Regions for Ocular Tissue Tropism

The present disclosure provides AAV5 virions with a VP capsid polypeptide having at least one mutation in a region with residues that interact with target cells (e.g., a target eye cell in a target ocular tissue of interest), where the at least one mutation confers increased ocular tissue tropism or preference as compared to a wild type VP capsid polypeptide (e.g., a wild type AAV5 capsid polypeptide of SEQ ID NO: 1). In some embodiments, provided herein are AAV5 VP1 capsid polypeptide having a sequence homology of at least 80% to SEQ ID NO: 1, wherein the AAV5 VP1 capsid polypeptide has at least one mutation in a 581 to 589 region, corresponding to residues 581 to 589 of SEQ ID NO: 1, and wherein said at least one mutation drives increased ocular tissue tropism as compared to the wild type VP capsid polypeptide (SEQ ID NO: 1). The following sequences rules and sequences also apply to the 581 to 589 region in AAV5 VP2 (amino acid residues 445 to 453; VP2 sequence shown in SEQ ID NO: 10) and in AAV5 VP3 (amino acid residues 389 to 397; VP3 sequences shown in SEQ ID NO: 11). Thus, the present disclosure encompasses AAV5 VP2 capsid polypeptides and AAV5 VP3 capsid polypeptides having one or more amino acid substitutions in the 581 to 589 regions of VP2 and VP3, corresponding to the AAV5 VP1 amino acid residues of the 581 to 589, where the one or more mutations comport to the rules or sequences in the following section.

VP capsid polypeptides (e.g., V1, VP2, or VP3 capsid polypeptides, or combinations thereof) comprising an ocular tissue-tropic 581 to 589 region, or any 581 to 589 region adhering to the rules identified herein) may assemble to form an rAAV with altered surface properties compared to a wild type AAV (e.g., comprising a VP1 polypeptide of SEQ ID NO: 1). The surface may form an interface that forms interactions with a target tissue, and the altered surface properties of the rAAV may promote tissue specific interactions (e.g., ocular tissue-specific interactions) between the rAAV and the target tissue. In some embodiments, the altered surface properties may be an altered charge distribution, increased or decreased hydrophobicity, altered availability or distribution of hydrogen bond donors or acceptors, or formation or reshaping of binding pockets. Such altered surface properties may favor interactions between the rAAV and ocular tissue while disfavoring interactions between the rAAV and non-ocular tissue. In some embodiments, the altered surface properties may favor interactions between the rAAV and a specific ocular tissue or ocular cells (e.g., retina, optic nerve, choroid, photoreceptor cells, aqueous humor, or vitreous humor) while disfavoring interactions between the rAAV and other ocular tissues or cells or non-ocular tissues.

An ocular tissue-tropic rAAV assembled from VP capsid polypeptides (e.g., V1, VP2, or VP3 capsid polypeptides, or combinations thereof) comprising a 581 to 589 region, or any 581 to 589 region adhering to the rules identified herein) may preferentially infect an ocular tissue (e.g., retinal tissue), ocular cells (e.g., retinal pigment epithelial cells, photoreceptor cells, rod photoreceptor cells, cone photoreceptor cells, or combinations thereof), or both, as compared to other ocular tissue (e.g., choroid, aqueous humor, or vitreous humor) or other ocular cells (e.g., photoreceptor cells) at a higher level as compared to wild type AAV5. The ocular tissue-tropic AAV may infect the ocular tissue at a rate that is at least about 1.1-fold, at least about 1.2-fold, at least about 1.3-fold, at least about 1.4-fold, at least about 1.5-fold, at least about 1.6-fold, at least about 1.7-fold, at least about 1.8-fold, at least about 1.9-fold, at least about 2-fold, at least about 2.2-fold, at least about 2.4-fold, at least about 2.6-fold, at least about 2.8-fold, at least about 3-fold, at least about 3.5-fold, at least about 4-fold, at least about 4.5-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, or at least about 500-fold an infection rate for the other ocular tissue, as compared to wild type AAV5.

In some embodiments, the ocular tissue-tropic rAAV assembled from VP capsid polypeptides (e.g., V1, VP2, or VP3 capsid polypeptides, or combinations thereof) comprising a 581 to 589 region (e.g., any 581 to 589 region adhering to the rules identified herein) may deliver a payload to the tissue infected by the rAAV. The payload (e.g., a payload encoding a therapeutic peptide or a therapeutic polynucleotide) may be expressed in the tissue. In some embodiments, an expression level of the payload in an ocular tissue (e.g., retinal tissue), ocular cell (e.g., retinal pigment epithelial cell, photoreceptor cell, rod photoreceptor cell, cone photoreceptor cell, or combinations thereof), or both may have at least about 2.5-fold, at least about 2.8-fold, at least about 3-fold, at least about 3.2-fold, at least about 3.5-fold, at least about 4-fold, at least about 4.5-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 20-fold, at least about 50-fold, at least about 75-fold, at least about 100-fold, at least about 200-fold, at least about 500-fold higher, or at least about 1000-fold an expression level in a different ocular tissue (e.g., choroid, vitreous humor, or aqueous humor) or ocular cell (e.g., photoreceptor cells). In some embodiments, the payload may be under control of a cell type- or tissue type-specific promoter to direct expression in a target cell type or target tissue type. For example, expression of the payload may be under control of a retinal-specific promoter to promote retinal-specific expression, a retinal pigment epithelium-specific promoter to promote retinal pigment epithelium-specific expression, a choroid-specific promoter to promote choroid-specific expression, a photoreceptor-specific promoter to promote photoreceptor-specific expression, or an optic nerve-specific promoter to promote optic nerve-specific expression.

In some embodiments, payload delivery to the ocular tissue using an ocular tissue-tropic AAV may have at least about 1.1-fold, at least about 1.2-fold, at least about 1.3-fold, at least about 1.4-fold, at least about 1.5-fold, at least about 1.6-fold, at least about 1.7-fold, at least about 1.8-fold, at least about 1.9-fold, at least about 2-fold, at least about 2.2-fold, at least about 2.4-fold, at least about 2.6-fold, at least about 2.8-fold, at least about 3-fold, at least about 3.5-fold, at least about 4-fold, at least about 4.5-fold, at least about 5-fold, at least about 6-fold, at least about 7-fold, at least about 8-fold, at least about 9-fold, at least about 10-fold, at least about 20-fold, at least about 30-fold, at least about 40-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, or at least about 500-fold higher specificity for the ocular tissue as compared to a wild type AAV (e.g., a wild type AAV5).

Ocular Tissue-Tropic Sequences

Recombinant AAV viral capsids with specificity for ocular tissues (ocular tissue-tropic rAAVs) may be identified by screening rAAV libraries comprising VP capsid polypeptides with 581 to 589 regions, as described herein. The libraries may be screened in non-human primates (NHPs) by intravitreally administering the rAAV library and identifying sequences of 581 to 589 regions in VP capsid polypeptides that conferred tissue-tropic accumulation in or infection of ocular tissues (e.g., retina) to the rAAVs.

Disclosed herein are engineered AAV5 VP capsid polypeptides capable of forming an assembled virion that exhibits increased ocular tissue tropism or preference as compared to a wild type AAV VP capsid polypeptide (e.g., a VP1 of SEQ ID NO: 1, a VP2 of SEQ ID NO: 10, or aVP3 of SEQ ID NO: 11), wherein the engineered variant AAV5 VP capsid polypeptide sequence has one or more amino acid substitutions in a 581 to 589 region of the VP capsid polypeptide, corresponding to positions 581 to 589 in SEQ ID NO: 2 (X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹). In some embodiments, X¹ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X² is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X³ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁴ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁵ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁶ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁷ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁸ is selected A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁹ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V.

An ocular tissue-tropic 581 to 589 region may comprise one or more positively charged or basic amino acid residues. The positively charged or basic amino acid residues may be independently selected from K, R, or H. In some embodiments, at least one of X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, or X⁹ of the 581 to 589 region is K, R, or H. In some embodiments at least two of X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, or X⁹ of the 581 to 589 region are independently selected from K, R, or H. In some embodiments, at least three of X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, or X⁹ of the 581 to 589 region are independently selected from K, R, or H.

An ocular tissue-tropic 581 to 589 region may comprise fewer negatively charged or acidic amino acid residues than the 581 to 589 region of a wild type VP polypeptide (e.g., SEQ ID NO: 1). The negatively charged or acidic amino acid residues may be D or E. In some embodiments, no more than one of X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, or X⁹ of the 581 to 589 region is E or E. In some embodiments, none of X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, or X⁹ of the 581 to 589 region are D or E.

In some embodiments, provided herein are AAV5 VP capsid polypeptide having at least one mutation in a 581 to 589 region, corresponding to residues 581 to 589 of AAV5 VP1 (e.g., SEQ ID NO: 1), wherein said at least one mutation drives increased ocular tissue tropism.

Retina Tissue-Tropic AAV VP Capsid Polypeptides. Described herein are engineered AAV VP capsid polypeptides comprising a variant 581 to 589 region predicted to confer increased retina tissue tropism, and predicted to confer increased retina tissue tropism compared to a wild type AAV VP capsid polypeptide (e.g., an AAV5 VP capsid polypeptide), based on a primary screen of a recombinant AAV5 capsid library. TABLE 3 provides 581 to 589 region sequences predicted to confer retina tissue tropism or preference.

TABLE 3
Exemplary 581 to 589 Region
Sequences for Retinal Targeting
SEQ ID
NO   581 to 589 Region
14   AALHSRMYQ
15   AAMRWQRES
16   AAVLKYWQQ
17   ACCQKRRSQ
18   ACKGKQKWA
19   ACVSLRQGC
20   ADCPLYCQP
21   AEKGCRKYG
22   AFISTRRAG
23   AFKFKSDWG
24   AFLTIRRHY
25   AFMRPQQFP
26   AFVDNLMDP
27   AGALARKMM
28   AGVSKRTGS
29   AHKYSRTMQ
30   AHVKPVQTM
31   AHWPKQYDP
32   AICRKDRHQ
33   AIKATRFRN
34   AIKCREQMR
35   AIKELRLWP
36   AIKMSRRYE
37   AIKTRGCSY
38   AIRLAGPIG
39   AIYHDLRAM
40   ALKITRLME
41   ALKNVPLYG
42   ALKSRGKGD
43   ALKTTSKWP
44   AMCAKKKWC
45   AMKLHKSAG
46   AMKQKQAYQ
47   ANIQYRHGM
48   ANKASKRAC
49   APKPATKHP
50   AQYPMHRHQ
51   ARSRLKNQT
52   ASHGMGRQA
53   ASRQKYKCV
54   ATHMLGRHG
55   ATKQKTCLG
56   ATRGCCHSW
57   ATWKEELSE
58   AVAGWLRAE
59   AVGQSKHVP
60   AVHFKKCHL
61   AVKMKSTPP
62   AVRTSRHCF
63   AWKLKKSYM
64   AYKQKQKYN
65   CAKPKVAIC
66   CAKVHRNWD
67   CARFERHMY
68   CCKCRKYMS
69   CCQPKPWKW
70   CDYKRVKKY
71   CEMFWARVI
72   CFGTIRRGC
73   CFILLKARS
74   CFKEYRHHS
75   CIHPKSKYL
76   CIKQKKSSN
77   CIRSLFHAG
78   CKHTCNQCI
79   CKKHQGYMP
80   CKMPISKTD
81   CLNCKERRT
82   CMKIRQAMR
83   CMKTKGHMP
84   CMQRKCRMV
85   CQGAIRRHC
86   CQYHPRKWP
87   CRCKRTREQ
88   CSHGYSRVG
89   CSKMIRSLE
90   CSKTKNNVR
91   CSKVANVMH
92   CSRLRRWQF
93   CTFLYDEQY
94   CTKQKKRGN
95   CTRDGRKWG
96   CVLTSRMGS
97   CVRNVKNCM
98   DAFKYKRNA
99   DAHSYRTHF
100  DAKCRWKYC
101  DAKKLHKIE
102  DALVYRRNQ
103  DARINRTCY
104  DARQKKCYQ
105  DARQLRQYH
106  DARWRSITG
107  DAVRARYMQ
108  DCRQVRKVA
109  DFDGTFDFV
110  DFKSRHKTC
111  DFNRFRYHG
112  DGNKARVKN
113  DGRKYMRGC
114  DIARQRKFQ
115  DIIRMRRTT
116  DIKLKKKCD
117  DIKNIRSHH
118  DIRTSRVHV
119  DITKAKRAH
120  DKAKRGHSS
121  DKKDKKGWY
122  DKKRSQWSC
123  DKVRRERCH
124  DMKKRHGSC
125  DMRKAGQTY
126  DMSRQRAQF
127  DPKKKGTWS
128  DQAKFRRSY
129  DQYRMRQQQ
130  DRCKKQSGA
131  DRIGFKKQQ
132  DRKLKANWY
133  DSKYGRKGL
134  DSNKRTRYS
135  DSRHSRVME
136  DSRIMRSAE
137  DSRIVRTSS
138  DSRLIRCFH
139  DSSRKGQMN
140  DTKAWRNPS
141  DTKSRKEMD
142  DTKVKRHVA
143  DTKWSRMRA
144  DTRRCVHRS
145  DTRSKGRFT
146  DVKNRSMAW
147  DVKPSRGGY
148  DVKQRRAPH
149  DVKTRRIFS
150  DVNRKREYS
151  DVRAVRFWP
152  DVRRMAKAA
153  DVRSKALMC
154  DVRTERRIS
155  DVRTNRIEH
156  DVTSRKWLN
157  DWKPKRCMP
158  DYQPPRKSA
159  DYRQNDVAE
160  DYRRSLKAM
161  DYTRFRSHQ
162  EAGKGRKYW
163  EAKAKQMPG
164  EAKGRVIGP
165  EAKGTRCPF
166  EAKIRNFTM
167  EAKMFVRHH
168  EAKNIRCKA
169  EAKTKRFCR
170  EAKVQRGYN
171  EAKWSGRKN
172  EAMWWRHGG
173  EARLTRCCL
174  EARSCRCGL
175  EARTRAHIG
176  EARVIRSNV
177  EARYKGTQY
178  EASIKKQAM
179  EASKRMIVK
180  ECHKIKKGY
181  ECRFNRKKG
182  EERPRIITR
183  EFHRKTRAS
184  EFKPRKSGA
185  EFKRKHIQQ
186  EFRAQRTLA
187  EFRKSGSCY
188  EFRMVRAQE
189  EFRYQRAHC
190  EFSSRWSVF
191  EGKPRSRLG
192  EGKSRRHHD
193  EGKYGKKHG
194  EGRGMRRQC
195  EHKQKMRER
196  EHRPVRSQM
197  EHRTRHGWT
198  EHVRLKHLA
199  EIAKYRWVQ
200  EIKPCRHRC
201  EIKPRRIAS
202  EIKSKKKFD
203  EIKWQRGYY
204  EIRKSGHKQ
205  EIRMNKSNA
206  EIRTSKEAR
207  EIWKCRRQV
208  EKAIMKLRS
209  EKAPSKKGI
210  EKGYNKHRG
211  EKKLLNRWW
212  EKKPKNRYN
213  EKKTKQRMQ
214  EKKWRGIMP
215  EKREKHRQT
216  EKVRTCWRG
217  ELKGKKAIQ
218  ELRRYGFQH
219  EMKAKKCHT
220  EMKLMKKVW
221  EMKMGRQWA
222  EMKQMRKFP
223  EMRVKRTER
224  ENKSAKRGC
225  ENTRRKFTS
226  EPKLKVYKS
227  EPKSRPFKC
228  EQARSRKVG
229  EQGRTKKMY
230  EQKLRKAMP
231  EQKNSRAQF
232  EQRQFRAKD
233  EQRSSRYAA
234  ERCRFKNGN
235  ERHTMHKAP
236  ERKGTVKMT
237  ERKQKGTCG
238  ERVQARKYC
239  ESFKRKVGH
240  ESKSYKCLN
241  ESMRGRKMP
242  ESRDVRAMN
243  ESRFNRSQG
244  ESRFRKDSN
245  ESRIKREWH
246  ESRKAHHDR
247  ESRPFRRFH
248  ETARKGRWY
249  ETKKHSSFW
250  ETKLFKWQD
251  ETKLKKADK
252  ETKRHQMAQ
253  ETKRRQCGY
254  ETKVHKVIG
255  ETKYRKRAE
256  ETRAGRTKG
257  ETRHRMVGC
258  ETRLGKHTY
259  ETRLMRSVD
260  ETRPQRMGH
261  ETRRIQRWD
262  ETRYRANIG
263  ETVRQKHNQ
264  EVKIKKRTI
265  EVKNKGRGQ
266  EVKPARSTF
267  EVKSRQCWQ
268  EVLRMRHEQ
269  EVNRNKMRT
270  EVQRSKRIS
271  EVRPFRQGQ
272  EVRSSRLQN
273  EWKKRTTWN
274  EYARFKGHQ
275  EYKHKKTGW
276  EYKLQRSAQ
277  FAKDRRNPG
278  FAKEMRVYE
279  FAKMSGRYA
280  FAMDIRFAQ
281  FAVARSQQC
282  FMKNKRNYG
283  FPRNVTMLS
284  FQAPSRISP
285  FRDCKIRRY
286  FSQATRRQV
287  FTKAWAKRE
288  FVWSYMFGP
289  GAFCRLSAD
290  GAIRSTHSC
291  GAKTFQKLQ
292  GERLGRKVP
293  GFRMKEKMS
294  GFVKTNKSA
295  GFWPYLYMG
296  GIGQKKSWY
297  GIKSHKREP
298  GIVRRNTAN
299  GKGTMCCEC
300  GKNRCKFQC
301  GLGTKQFRN
302  GMAVKRREP
303  GMFKLNQSC
304  GMKVHRKAP
305  GMLQNRSHQ
306  GNKATNIML
307  GQGLFRRQC
308  GQKGSGRQA
309  GQKLRTSSG
310  GRSQKDWGI
311  GSAWQIWSD
312  GSKFTRQCY
313  GSKQQKGGV
314  GSKQTTGYT
315  GSKSHSHWM
316  GSKSNYHSG
317  GSSSKTTCC
318  GTAGCKKAA
319  GTAMFRVSA
320  GTIKRMTAY
321  GTKVKNCRN
322  GTKWSKKWQ
323  GVFDIRKNP
324  GVHWKKTAY
325  GVKFRNKTN
326  GVKLHTPFS
327  GVTGRFCCQ
328  GVVLIRQDD
329  GYKQQRNRD
330  GYKQTHWLG
331  GYWWLFADR
332  HASRKGTFP
333  HAWPMPATW
334  HKQWNYCPS
335  HKRTAPWTN
336  HQKYKKLTG
337  HRRPFQTKT
338  HVRSNLPIC
339  IAFQYQNRL
340  IAKMKSRYP
341  IARSGWMSG
342  IAYHYWKDV
343  ICLKRHAKA
344  IEKQRRVYA
345  IGAKRSWTS
346  IGIPKNHKP
347  IGRWMINSM
348  IGVKAHRSA
349  IHHTNFHSP
350  IHMKRAAYS
351  IIKPRSKVD
352  IKQKGELKC
353  ILLKHMKYP
354  IMKDRKSGS
355  IMPRCWDMC
356  IPQPSRKMP
357  IPRTINRCT
358  IQHRFLTYQ
359  IQKCMTRQA
360  ISTQPRQQS
361  ISWIQRTCM
362  ITFGTRKDA
363  ITFWKMRDG
364  ITKDIRWKG
365  ITRDSRWGM
366  ITTTARKVP
367  IVKEVRTNH
368  IVKPRGQCI
369  IVKQLKRTA
370  IVKYRVGTS
371  IVVESENRH
372  IVVRRFYDP
373  IVYSSRQNP
374  KAGTPGIQN
375  KEARHTRRE
376  KEFLYLSRE
377  KEKEYKKYF
378  KFRDAQNMS
379  KIKVANAAS
380  KKPANMFPW
381  KNRAVQGFN
382  KPGMVMNPN
383  KPRPKLNST
384  KQRHWGAKW
385  KQRSGWCCH
386  KSCKGRANG
387  KSFYGEHYF
388  KSNQMGKSP
389  KVKVRACSD
390  LAKDCRACN
391  LAKFKNKIL
392  LANTYHWEQ
393  LANVKGRVA
394  LAPRKQVQW
395  LARAKTSSV
396  LARYLGSQN
397  LCKEGRKAG
398  LCKWSKKQC
399  LFRMNMRTH
400  LGKSRKQMA
401  LIECRRRCP
402  LIKCKDRFT
403  LIKWNRKAM
404  LIRLYTNKE
405  LLCKVKDYQ
406  LLIKKNRGV
407  LLRLAQQGP
408  LLRMTTYAW
409  LMKICKSFP
410  LMWSRFEVP
411  LNMHYRSHK
412  LNRQRGHAS
413  LPERCRKQS
414  LPKPTKKGP
415  LPKSTKRWG
416  LQKMSRFMN
417  LQKTRSIIQ
418  LQTKKNRHY
419  LRVPRYGQS
420  LSKKRERCN
421  LSKTKSYVE
422  LTRFHGGMY
423  LVKDRCSGY
424  LVRMHRSDQ
425  LVSRLPSMR
426  LVVQRNVRQ
427  LWKTSRQCN
428  LYIHRWVSG
429  MAEHQIVTT
430  MAIRGTKAN
431  MAKLCQRKC
432  MALDFRNGK
433  MCAGYHREQ
434  MCKAHMRKD
435  MCTATSRYK
436  MEKQLKLHN
437  MFVTYYTLY
438  MGAPKKTLG
439  MHWSVHYNS
440  MHYLAMSAR
441  MIAEDEYWA
442  MIDSRKRSA
443  MISLKKKMS
444  MKILKYSQE
445  MKKDKTNST
446  MKLNRNHDC
447  MKSRPFMGS
448  MMAGMRISS
449  MMAKPLWAY
450  MMHQVTHDF
451  MMKGRSYCT
452  MMKPKGHYP
453  MNIKKNHWA
454  MPKRACNKW
455  MPWKIDTGG
456  MQKTSKKYQ
457  MQQRVFRSN
458  MQSLKSRWH
459  MSFKDLKNG
460  MSGSRRNAE
461  MSKQKKAGS
462  MSKSRSLNN
463  MSPFVRKAS
464  MSRESRSVS
465  MSWLERKAN
466  MTEGKKRIP
467  MTGKSPRGA
468  MTGVRWRSQ
469  MTIYQRGAA
470  MTMCLKKYY
471  MTMTMLPWY
472  MTRGHSIWG
473  MTRMRLSGP
474  MTTSRQRCW
475  MTWYHDIHQ
476  MVKHHRESF
477  MVKWSWHKC
478  MVMKRVMVP
479  MVVPAKYKW
480  MVWSADSYE
481  MWKDIRQWH
482  MWKSRLDSY
483  MYKCGIKCH
484  MYRAKLTAQ
485  NAMWLRHYD
486  NCAQYYGTG
487  NFKDMRSQE
488  NIGLKKKYF
489  NIRQPNQCA
490  NKHSQRREA
491  NKRDHKYWG
492  NKTKSHYGN
493  NMNHVAFAY
494  NMYMYRAQH
495  NNKGLSQNT
496  NQRLYAKSE
497  NRMRYSCYS
498  NSKTWGTLS
499  NTFISYRDQ
500  NTGKRSRQA
501  NTHALGRHG
502  NTKLSRYGM
503  NTKSAVKQP
504  NTLPSRYGN
505  NTNFRNMSW
506  NTNPSGKNF
507  NTYCKKHCS
508  NVAPKSHKW
509  NVAWRTRDL
510  NVKGIAHYC
511  NVKTLHHMW
512  NVSMLGRWN
513  NVTNQKKTW
514  NWNPCRKNA
515  NYWWMLSGP
516  PCGGKVIKA
517  PKRKGNEWC
518  PMKPTKYAH
519  PSSVKQTKA
520  PTKVLNRYN
521  PWAGTRWKQ
522  QAGCKGTWR
523  QAHMFFKHE
524  QAKWRNLWN
525  QAMHYWRYP
526  QARDRTAQF
527  QAVARGNLK
528  QCCKRKTGL
529  QCKLKGNLM
530  QCKTKKSAS
531  QCKYRYTKG
532  QCQPRKHTP
533  QCVCKKMKG
534  QCWPTMKCD
535  QDYQEDGKK
536  QEKKKANLT
537  QFKLKTRES
538  QGAGGRKDQ
539  QGALYKKQF
540  QIAKVQKTR
541  QIFRLPQAG
542  QIRDKSRHH
543  QLTRYMKST
544  QMHHKKNWM
545  QMHPESYSA
546  QMKSKTKWL
547  QMWFRYASE
548  QNSQIKKVG
549  QPEQRRKVP
550  QPKLRSQVM
551  QPKTRSMYQ
552  QPKVNRHTG
553  QPLYFRSQG
554  QQMTKKNFG
555  QSAGRKTVA
556  QSFLSLTPG
557  QSHMYGRIS
558  QSIYFRHGI
559  QSQNLRRQC
560  QSYWNLSYQ
561  QTKTYREGG
562  QTRGGCKRA
563  QTTQPRQWP
564  QVFATLTSW
565  QVFLNLREG
566  QVHGILRAH
567  QVKWKNRFP
568  QVSKCQIRK
569  QVSMRGHYR
570  QVVRNHHKE
571  RCGYHHSQT
572  RCRVAIVWT
573  RFAYWKNQG
574  RHQKRNWAN
575  RMFSVPMWD
576  RNKPIKHGP
577  RPNRVMARM
578  RTCYWSANE
579  RVHPWSQRQ
580  RWKDKNKLM
581  RWKHLKGVC
582  SAGWRSHCV
583  SALYHGAGF
584  SASWKGKTP
585  SCKPKSKST
586  SCMRKGRFQ
587  SDVRKPRQH
588  SECNNPFVM
589  SGCQMKRAF
590  SHKCKTSMT
591  SHKEIKGQA
592  SHPNTRQGD
593  SIGMRSHMG
594  SIKVQKRAG
595  SIQRLKWVN
596  SKDSFRRCC
597  SKHPRMQQA
598  SKHQYHQDA
599  SKKTGGIQT
600  SLKQQSYRG
601  SLRQNHMHQ
602  SNTTVRKQY
603  SQLSFRSAT
604  SQPRNKFSG
605  SRHRYPKCS
606  SRRVSSRMF
607  SRVKMSRQH
608  SSMPMFSGA
609  STAQKCKFM
610  STFYRFRDP
611  STGPKKNST
612  STKISRLHN
613  STKSRSHYH
614  STSSAKKYP
615  SVGYGKPWQ
616  SVHMNLRAH
617  SVKLRSWSK
618  SVKPCCRNR
619  SVRDIRYGP
620  SWWPLMTWG
621  SYVKPIQRP
622  SYWGYSRAH
623  TAKYRGLWQ
624  TARQFKSPR
625  TASSRLCCH
626  TCKGVSYRT
627  TCKPHGKCT
628  TCKYRSHLA
629  TCRGYNDSY
630  TFTRPLCMS
631  TGAFRRSGA
632  TGKLRGGWH
633  TGRFSSHMH
634  TGVKRNHAG
635  THHKARYTG
636  THKEKRTAI
637  THSSFKKMQ
638  TIIRRNTTT
639  TIIWARSMA
640  TIKTSRTDD
641  TIKYKSGNG
642  TIRDLRTQN
643  TMAQSWRSI
644  TMKSKQRWV
645  TMRSKSCSM
646  TMRWRNHSE
647  TNKFTRKGW
648  TNWLIKWMG
649  TNWPHVKAY
650  TPKSRGVYA
651  TPKVKSSFN
652  TPRPSTRAP
653  TQCQKKTAR
654  TQFQKLADR
655  TQKPKKSGS
656  TQNASRHMQ
657  TQPKLKRES
658  TQRDRMRAN
659  TQRPTTKTR
660  TSAFKKGFT
661  TSHAIIRLQ
662  TSKFFGMFA
663  TSKMPGRAS
664  TSKPNRKKT
665  TSSYKSRFH
666  TSWWLPSMT
667  TTARNQGTG
668  TTKGQVQCM
669  TTKGTGSHN
670  TTKPGRHSY
671  TTKTVREYG
672  TTRYSTAPS
673  TTVKRLNSF
674  TTWTPEQHP
675  TVKNNVLCG
676  TVKPQMVGR
677  TVKWGNKLW
678  TVNIKTRSH
679  TVREKGHDR
680  TVSSRQRTR
681  TWKTRTCAP
682  TWRYVMKEC
683  TYAKYNRMC
684  TYGFPVSVA
685  TYKYKNNYC
686  VAALNLRHP
687  VACKCKNRP
688  VAHNALKMM
689  VAKVMTTAP
690  VAKWRSKHQ
691  VARIKQDMF
692  VASRGGRGC
693  VASSQKRAI
694  VCKVNRKML
695  VCRHRQQMY
696  VCVKKYRCN
697  VGAGYKHCY
698  VHRFVNRDF
699  VIKGQATER
700  VIKSSWFKG
701  VIMRPISQQ
702  VKHKDQWGP
703  VKHRAKFCD
704  VKQFRKCFC
705  VLDRHWAAY
706  VLKQIGRNS
707  VMKDVKKVW
708  VMKDWKGKH
709  VMMLARQSQ
710  VNPYKLWKT
711  VPFNYWRME
712  VPIRVMRHG
713  VPIYTKWKN
714  VQKTSRRGE
715  VQVRRHAHG
716  VSDIANEAF
717  VSKAKSNFR
718  VSPTIRKSP
719  VSSLKKSQF
720  VSTRDKWRN
721  VTCRCKMKH
722  VTDRKQLRG
723  VTKQKCKMN
724  VTQMKHKGW
725  VTRQKCKMN
726  VVGKVMRDC
727  VVKQVGKQA
728  VVNYTALQD
729  VWGLTRHAG
730  WAKPTKKIM
731  WEPGIITGC
732  WVFSIQKQA
733  YIATKLRDQ
734  YIRDRGHYP
735  YIYPITYSQ
736  YMFEAPWIE
737  YSGAKGHMM
738  AAGASKNAK
739  AAHRPMFTS
740  AAKSFRRAA
741  AARSTQGIA
742  AATHKYRCN
743  AATKEKRHM
744  AAYTSRQLG
745  ACKIKTGQA
746  ACTKERSIR
747  ADKTKKHFA
748  AFKTMRWSM
749  AFPPYKYRK
750  AHRSKKTSM
751  AIYSAMTAF
752  AKAKMSRTY
753  AKKASKRGC
754  AKPIPQTKN
755  ALRLKNSLT
756  AMKMKKTHF
757  AMSKAIRNS
758  ANRFKNTEG
759  AQKSLHYTC
760  ASKPRKRYN
761  ATFRDSDYQ
762  ATHERRKSP
763  ATTKRKGCC
764  ATTRFPDAA
765  AVRFGAAQK
766  AVRLRSKVD
767  AWIRCIQMP
768  AYKQVKREL
769  AYMVRLNHH
770  AYMYRPATE
771  CAKGKTQTS
772  CASRKQRSH
773  CGSSYKKVQ
774  CIVQKTAQK
775  CKCGLKRFS
776  CKCLKTMKQ
777  CKTRACKYC
778  CRCKCAIKC
779  CSKYTAKAW
780  CSQGTKKSY
781  CSTQGRKAM
782  CSTSKKRTF
783  CSTSQRRWG
784  CTGPCCRPQ
785  CTKHLARQH
786  CTKKTRCQG
787  CVDILLVHR
788  CVGLDRRGY
789  DAKFSRGMQ
790  DAKFVRHQH
791  DAKPSRCCL
792  DAKSKKKWY
793  DANIEWHGN
794  DARKWSNCI
795  DARMKGISS
796  DASMWSGIE
797  DDGKEVWHH
798  DGFPKRKAC
799  DGSSIRRYP
800  DHFHPRQSP
801  DIARGKGKP
802  DIKMHRGAC
803  DKKDRKMIY
804  DKKGYALAY
805  DKKQRQWTA
806  DMQRKKREG
807  DQKFMKTYF
808  DRLPSRQCQ
809  DRRGKTSMP
810  DRRGYGVSN
811  DSQKPKKAP
812  DSRCFRRGY
813  DSRNRAHWC
814  DSSRARYKS
815  DTKQKGSPK
816  DTSRVKAAQ
817  DVKLKKRYY
818  DVKPRRSGF
819  DVRTSRGVT
820  DVRWIRHHH
821  DYHRLGRQE
822  EAKLAKSYS
823  EAKYKKNYS
824  EARGRAHSG
825  EARTSRWLA
826  ECKPKAKWM
827  ECKPRRMQA
828  ECRPTRINE
829  EFKHRWQGR
830  EGKLTKRCM
831  EIFKALRAE
832  EIRPCRFRN
833  EIRRQGQAI
834  EIRVIKSHS
835  EKHTFKKWA
836  EKKEAKKFN
837  EKKHKGEFW
838  EKRSISVHT
839  EMKVTKMRG
840  ENKLVKKTP
841  EQQCFLHGN
842  EQRIMRSQA
843  ERFHKMSAD
844  ERKARSTYC
845  ERQQRCRFS
846  ERVPMWRNA
847  ERYPQRSAF
848  ESGCNQPQD
849  ESGRKSRAE
850  ESIRAKRVA
851  ESKGYRSGC
852  ESKIKSAAS
853  ESKNVKDWK
854  ESKYRNRMC
855  ETHRKNQHN
856  ETIPFLDLG
857  ETKYVRKEW
858  ETRMRANFQ
859  ETRPFRGNE
860  ETRSRCHCA
861  ETRVSRNMP
862  ETRYFKNAY
863  ETVERCNFI
864  ETVRQKGHN
865  EVGNRKWQS
866  EVKRAPSTL
867  EVKWRKCLQ
868  EVLRPRAIA
869  EVRALRTQH
870  EVRMSRTIN
871  EVRQSRQVC
872  EVRSARQQS
873  EVTRHRLWS
874  EWHRFGRNS
875  EWWPIRHSW
876  EYKPCRRAV
877  EYKTARHAM
878  FAYKEWLPG
879  FFHSRMSQE
880  FHRALFHAG
881  FICMKKTDQ
882  FIGWMHRAN
883  FIWPIDHTS
884  FLNEYGYYQ
885  FSFQYLKKG
886  FTATSLRFP
887  GAGMKKRMS
888  GAKLKSRLD
889  GDKSRKSKM
890  GFSMMMIPW
891  GHKETRAMG
892  GILRKVNDH
893  GNVKIMRFA
894  GQKTTSTNY
895  GSKMYAHTP
896  GSRDTRQYP
897  GTHLELMNA
898  GTKQKAVIE
899  GTREHGKTP
900  GTWSAMRAT
901  GVKCQKSAK
902  GVKGHSHDR
903  GVWPCYYLQ
904  GYMECDHMQ
905  GYRFVGTTP
906  HAMIFQRAS
907  HAPMYKSAG
908  HNKDLKCQE
909  HRRMRDAIY
910  HSQRCKVIA
911  IAKGQQQMC
912  IAKQKCNCC
913  IAMRKWNCE
914  IANQLTMTT
915  IASILWSSA
916  IAVRYYHQW
917  ICKPKGKWL
918  IERKNNASQ
919  IFRLWNAKE
920  IGGPYRTIN
921  IGKYTKKMT
922  IGRFNNIAE
923  IIRPSSHAC
924  IIRSGTKYP
925  IMRGGTKYG
926  INKTVQRCG
927  INRPTRWPH
928  INVRSQHQH
929  ISNISKWRT
930  ISQSMKFSG
931  ISRDQKHVC
932  ITFPRIRAD
933  KAHAITDHS
934  KGMRCKAME
935  KHLMVPGKM
936  KKMGRMCDR
937  KMHRCKDDR
938  KNEVDTNGE
939  KSAVHQGGH
940  KSDTFRRVF
941  KTHKFSSCL
942  KVRSNREQM
943  KWQGSTHKT
944  KWTYNNTDL
945  LAGKMAHWQ
946  LAYMKILQQ
947  LCNIRCRSG
948  LDAQIVCYG
949  LFKAAVKAP
950  LFKPKKTSQ
951  LGKFSGAGS
952  LHKQYYHGM
953  LHWLIKESG
954  LKERKEVRA
955  LKGSSKSSF
956  LLWINTMIW
957  LMFYTLSRD
958  LMRNVNVEP
959  LNRQHGHAP
960  LNRYVSMGV
961  LPKVARKMF
962  LQGRYMGAQ
963  LQKNGRYSG
964  LSIRRNCCG
965  LSRHTKQLA
966  LSRPTMTIS
967  LTAKPFKCQ
968  LTGKYVGYS
969  LTKSRGQCS
970  LTRAHRSHE
971  LVIGRHQNW
972  LVRDIREFS
973  LVRYKSGGD
974  LVYTSLKDA
975  MAKQKKQAM
976  MAMEQRRFG
977  MAMREMKVC
978  MAMYYRMDD
979  MCRDRGKMV
980  MDGRFKATS
981  MEGCFMYVF
982  MGWPKHQDP
983  MHKVKSGNA
984  MIKNSGKEL
985  MIRGQRGGG
986  MIWPMSVQH
987  MLKMGFRYA
988  MLKYRQGGG
989  MLTYWTSRN
990  MMKCKRWDY
991  MMKSHKAGN
992  MNKDKRIMP
993  MNVQKRNYF
994  MPKLNRKAQ
995  MPKNYGHAP
996  MPMIKLSYS
997  MQAQPRKQG
998  MQHYLHHAT
999  MQRYKSKCC
1000 MQYMQRNAY
1001 MSKESRSQP
1002 MSLGQRTSW
1003 MSMVRKDQQ
1004 MTAGKKAWN
1005 MTTLQRQFM
1006 MVIPVEIMI
1007 MVKMKCTCT
1008 MVWPITRTD
1009 MVWPKQTEA
1010 MVWWEEKMC
1011 MVYRPLTSS
1012 MWAGKSRWC
1013 MWAPFRHWN
1014 MWAQTRQQW
1015 MYWHQTLSE
1016 NAKLNKRQM
1017 NHKSYPVAP
1018 NKHSTRAMD
1019 NRHKCGSWS
1020 NSGLKKYYG
1021 NSRNMLQNE
1022 NTKIRSVQH
1023 NTKSKSQLA
1024 NTVRTFHGW
1025 NVHAKLSAE
1026 NVKPTAWKW
1027 NYRSHRKIA
1028 PAVKKVERQ
1029 PCKLAGTWD
1030 PIGKHAFKC
1031 PLVKSGFGT
1032 PQEKRKNVA
1033 PQFTYRKYP
1034 QAAFHLKNA
1035 QATTKRTIF
1036 QCNVRTKMF
1037 QDFRLSSGM
1038 QEKCNRRGC
1039 QFAKQVKWF
1040 QGFMVMKAV
1041 QGKVKERTM
1042 QGRQVLGRE
1043 QILIKDCFS
1044 QKQKRTRAQ
1045 QMSGRCTCR
1046 QNRAIRSYT
1047 QPKFFYRSA
1048 QQLDATHER
1049 QQTKRSCMA
1050 QRKDKQTQH
1051 QSFRFWKHH
1052 QSKFKIPYC
1053 QSKLRLTEP
1054 QSQSTKAVW
1055 QSRQTGKFW
1056 QTCRKDRHF
1057 QTMKQIRAT
1058 QTRISRWDG
1059 QVFLKIRQE
1060 QVHNRLTQL
1061 QVHPSRWIR
1062 QVKMGKPNH
1063 QVMRQNTIT
1064 QYTRFNHVP
1065 RFKVWTCSC
1066 RFYDAMQMH
1067 RHDKQANGS
1068 RKNPTTCYS
1069 RKPHSGWRC
1070 RKRFTSMDP
1071 RLEDVHGNK
1072 RNKEWTGKG
1073 RQLPMNCCE
1074 RVNPELHMG
1075 SAKMQQISL
1076 SARDYREIA
1077 SARISAIGP
1078 SCKFKKSFF
1079 SCKHVVKVP
1080 SFIRTHRSW
1081 SFKMMTRQA
1082 SFKQKAREY
1083 SFRPTTWKQ
1084 SGSHYRRFP
1085 SHKFTGRCG
1086 SLNQFVMHE
1087 SQKHHTRSH
1088 SQKIVHYTN
1089 SSAQWLACD
1090 SSKFMACAS
1091 SSKLVSKTW
1092 SSRFLCHNE
1093 STKAWRYTG
1094 STKQAKRTA
1095 STTHLLRYP
1096 SVKLIGSEW
1097 SVVWPAQVE
1098 SWGYCMLDQ
1099 SWHMKMIAG
1100 SWKGMGKAD
1101 TAKITGSGS
1102 TAVRWMNGR
1103 TEYTRKKVP
1104 TGKSKSRMV
1105 TGKSKTWMP
1106 TGMRMPHGG
1107 TGTLTRWGP
1108 THFRKNWES
1109 TIANSRSHM
1110 TIKLSRFEP
1111 TIKVGHSRC
1112 TIWQRSGVD
1113 TKAIHNQSI
1114 TLKAYNHQI
1115 TMGFKTRYQ
1116 TMRGQPFGV
1117 TPDKRKWAQ
1118 TPILAGLVY
1119 TPKCIKWQQ
1120 TPRFHNKVP
1121 TPRSTRFCA
1122 TQHSLKAMM
1123 TSGWYKKSY
1124 TSKVKMWEY
1125 TSKVRSKCP
1126 TSVPHKWKR
1127 TTHLKLAAA
1128 TTKDGRAFE
1129 TTKEKKKDW
1130 TTKMGKWAA
1131 TTKPYQSIR
1132 TTKSRGFIP
1133 TTLRRHCCC
1134 TTLRTIKQA
1135 TTRTNSICS
1136 TVFYRHHHL
1137 TVGLGRRGA
1138 TVKSHTPMA
1139 TVKSREHSM
1140 TVLNYRRGF
1141 TVNVNKKAY
1142 TVRLQSYAQ
1143 TVRTLFKGN
1144 TVVAKTLRA
1145 TWRFNNHLC
1146 TYFKVMKDS
1147 VARPNVHQE
1148 VASSPRVCP
1149 VCVGRRAER
1150 VFKQFGKRE
1151 VGTSARKIG
1152 VLAPYRNCE
1153 VMVKRLATG
1154 VRQRPKFRP
1155 VSRTRIDSH
1156 VTKPKTVAD
1157 VTKWKNSGG
1158 VTMSRRSVW
1159 VTRSCCSFG
1160 VVKGMVCPC
1161 VVMQNNVAE
1162 WIEYISWWG
1163 YNFPKSAAE
1164 YNKSYRETG
1165 YPKPTRRDC
1166 YQKPSQTWS
1167 YSNLKSKAQ
1168 YTRGCHGCS
1169 YVSYARQSV

In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 75% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 1169. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 77.7% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 1169. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 1169. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 88.8% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 1169. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 1169. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two amino acid substitutions relative to any one of SEQ ID NO: 14-SEQ ID NO: 1169. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two conservative amino acid substitutions relative to any one of SEQ ID NO: 14-SEQ ID NO: 1169.

TABLE 4 provides additional 581 to 589 region sequences predicted to confer retina tissue tropism or preference, based on a primary screen of a recombinant AAV5 capsid library.

TABLE 4
Additional Exemplary 581 to 589 Region
Sequences for Retinal Targeting
SEQ ID
NO   581 to 589 Region
1170 KSRKVKCLK
1171 KKKYKGHIP
1172 KKRKKILFM
1173 KTKCTKTKN
1174 KRKKAKVIE
1175 KQKIKKTAF
1176 KKCGKKRHY
1177 LCKNKKMKN
1178 KKKRKGQCP
1179 KQKTKHWMK
1180 CSRKAKFKK
1181 KAKNKACKK
1182 AKKKTLITK
1183 RKKKGKPSA
1184 HRRRAQYRS
1185 KGKKIKLMM
1186 TKKPCKYKS
1187 KKKTKTQIP
1188 KKTKGKSGT
1189 CRRRRKIHE
1190 IKTRKKWKY
1191 KAKFKKWAS
1192 KCRKKVKVA
1193 KKSVKKALV
1194 KSRKKQVKH
1195 YMKKHKKGQ
1196 KKTLKKWLP
1197 RRRRASCAE
1198 KGKKRKTAM
1199 KQKKKQNHQ
1200 KKYNKKGMW
1201 VVKHKKKVC
1202 KKKCKNIFA
1203 KLNKWKSKQ
1204 KKKQKCVRG
1205 AKKAKRWHK
1206 KKRKLFVKN
1207 KRKKKNHCR
1208 KIKKKFDTI
1209 KVKIKQIKQ
1210 KKKIKMFCT
1211 IYKWKKKGT
1212 KRKGKKFCS
1213 KKKTCKFEG
1214 KTRMKRIQV
1215 QAKKKKQWD
1216 MKKKQKNVA
1217 KKRKAHLQW
1218 IKTKKKWGY
1219 KCKAFKGYT
1220 KVHKKKGWH
1221 RFRKFRRCT
1222 KSKKTKCLD
1223 KKKQKQCYF
1224 KQKKKPAIW
1225 AKKRRKGSM
1226 KVGKHLKKG
1227 TRRRRWCGN
1228 KKKKKRIFR
1229 KPKMGKYTK
1230 ARKKKAGKC
1231 MTKMKKKMC
1232 KRARLKHSQ
1233 KGKKRAKTG
1234 KQKFFKHAM
1235 KKKRNRDGL
1236 RSKQFRVHD
1237 KRRKPCWRQ
1238 QTKQKKWKN
1239 KQRKHKVDT
1240 KAKSKKGLM
1241 EVKKKKFMP
1242 KVKSHKLGQ
1243 KKKRVQSRD
1244 KAKRCKASC
1245 VQKKGWQKK
1246 KRKWKRDCF
1247 KAKKSKHDR
1248 KCKMMKIKC
1249 KKKKFPECG
1250 RYKHHRFLP
1251 KKHRKGQMT
1252 EWKKKKCFF
1253 VKKRSKVQA
1254 RRRRILHCP
1255 MKKRQRGAS
1256 KKHKKQLEN
1257 QTKPKKTKC
1258 KKKMQCIKC
1259 QQKEKKWKE
1260 KTKLYKYCY
1261 PKKFKVHKC
1262 YARRAKSTE
1263 KPVKKQFKE
1264 RCRSRRYPE
1265 KRRYRKHNY
1266 HKRTLKHWF
1267 RTRRLSPRE
1268 SKRKKGCVG
1269 TKPKKKWWA
1270 QSRKAKRIQ
1271 RFKSRRSRA
1272 LVGKKKTGK
1273 MVKLKKKHH
1274 KAKYWKHRF
1275 RPKKVKNCE
1276 HCRKRRHFH
1277 VKKMKIWKH
1278 KVRSKKMWS
1279 ITKSKKKWT
1280 KARKKMWSC
1281 KVKPKSNKS
1282 KIKRIIVAH
1283 KKAHAKKVM
1284 KKKQKRVGH
1285 RKKGGKLVC
1286 TKRKHKPVN
1287 RRKSCRFHR
1288 KKKYHPKWT
1289 AAKRQKIQW
1290 FVRKLKTTT
1291 YCKLYKKKG
1292 RRVRKHQRE
1293 PKLKKKGFS
1294 CPKNKKKVP
1295 FKKCKGTKS
1296 RQRKFKCMQ
1297 KKHRFKLPV
1298 DAKKDRYKK
1299 KKHRSHPSQ
1300 KMRKTKLWG
1301 EKKKYCHKT
1302 DVKKKKWPP
1303 QVKSKKKQI
1304 KIRKTKVYN
1305 KIIKIKKFW
1306 MKRKLKYAN
1307 KAKSRQFCQ
1308 ARARRRYCN
1309 KKRGYHFQH
1310 NKKQKCQKV
1311 VTCKKKSKS
1312 CIKKCKQWY
1313 KAQKHLKKC
1314 VRRKVRRTP
1315 KSRQKKGPH
1316 KRKTAKYFQ
1317 KYKSRKVNS
1318 YFRARRRYS
1319 TRRKKKSWN
1320 KKKPKSHLG
1321 KRKKSGHFY
1322 NRRVSRWRK
1323 QRQKIRRRT
1324 KMPKQKFKN
1325 KKNKKCKKP
1326 DTKRKKSCA
1327 SKKRHRSHV
1328 KYKQGGKQY
1329 KSARKKWSC
1330 HKKHFKKPL
1331 GRRKYRADR
1332 SVKHYKKHQ
1333 NTKRLKCKQ
1334 EKKFKKCGG
1335 KKRYYHRPC
1336 KGRKIRTQT
1337 VKKRPKWSK
1338 QIRRKKAYY
1339 TCKRKKLNA
1340 KARSLSRWL
1341 KLKYIKRSA
1342 KQRYRKHGQ
1343 RWRRRQKLQ
1344 DIKFKKKIF
1345 HKKKCQNCN
1346 RMKRYHYTG
1347 KVKCIKQLG
1348 RAKRYKHTW
1349 KGKCMKNAQ
1350 KNKKRVRGV
1351 KLKKQPFKG
1352 LKRKHRRTG
1353 MKTKTHCKS
1354 FYKRMRMHN
1355 HRKFKKQAY
1356 CKSRKRRGQ
1357 HKKRTVAWM
1358 KAKFCRKPQ
1359 KHRKFRCMT
1360 RRGRRWVPQ
1361 CFRKYKNKG
1362 KWKSKGKNC
1363 HKHRKQRYV
1364 RTRRYRHWL
1365 KTRKGRSNH
1366 PCRRRRLWG
1367 KMRKAHVTG
1368 SRKKCKVCY
1369 KSKSKYWGV
1370 KKKSKLFWN
1371 KKMKCKEAR
1372 VGKLKKKWQ
1373 SVKSKKSGL
1374 FSRKKKLYY
1375 VNYKKKGKC
1376 KWRKMKGCY
1377 KMKSKADKG
1378 ARKLKRTRF
1379 KYRKTNVFW
1380 KNKKEHKSD
1381 KGKHRKFYA
1382 KRKLGKFNG
1383 KKARKGQPW
1384 TAKRQRIKH
1385 KRKRTNYWW
1386 MQRKKKCTG
1387 KKEKKIWTC
1388 KQRKRFNSW
1389 KKKALGFRS
1390 KVRPKRAGP
1391 EHRRRRIVG
1392 KKKKCQAAP
1393 VKKIKHVKG
1394 RVRPTRKQC
1395 KERKQKEMM
1396 KRKKFMNAR
1397 RIRKMTRTQ
1398 KKKPNRIAA
1399 KKKTIRHNP
1400 VKKPRGRHP
1401 RCRKFKSDM
1402 KSKYAKNQA
1403 KTCKTKTMF
1404 HKKCKSQKS
1405 KGRKYWCGG
1406 KHKRRTFYP
1407 KKSKEKAPF
1408 KTCKKSKIV
1409 RKKRWHVQY
1410 KRSRLKRSH
1411 SKKRYMYKS
1412 SKVRKRFRV
1413 CKAKRKSGY
1414 VCRRIKGRW
1415 HKTHKKKMT
1416 KQKKYVMTA
1417 KRRKQYHCK
1418 KKATFKQAK
1419 RIKCKKTTL
1420 FKKRYLLWT
1421 KKDRHKHKS
1422 LARKFKLWH
1423 TCCKKKKWM
1424 RRRKIMGHS
1425 KIKPCKKNH
1426 KCKQYKMSV
1427 KQKLOKQAP
1428 KIKQCKRAW
1429 KRKKQSVYN
1430 HCKYHKKGF
1431 GRRCCRRGF
1432 TKRLKTRRD
1433 QRPRKRKGG
1434 KAKCSKSYC
1435 RRRKGLMIQ
1436 GKKKSKLGE
1437 RKKALKRHG
1438 SSKRRKQCF
1439 KMKFQKYAC
1440 KIRKWSAFE
1441 KKRRTVHPN
1442 KAGWLKKEK
1443 KHKTKHNWE
1444 DHKRQKRQP
1445 KYKHRGGYT
1446 EKKVKKEQW
1447 MSKRFKTMG
1448 PMKKKEYKC
1449 QKKWKFKTC
1450 EKKPQKKQY
1451 RGKARRSYA
1452 KIKRNRSNM
1453 SKKCGKKDF
1454 YWKKIKRWN
1455 KYKQVKKLA
1456 KQRKCYYKT
1457 HRRKTRYFR
1458 NCKGKCVKK
1459 KTKFRGSKS
1460 FKRKTRIDG
1461 KTKCFKGGF
1462 RVKHYRHYQ
1463 DKKPKKQYW
1464 HRKSKKWQP
1465 RKGKKDCKG
1466 KSRKHIRTW
1467 AKQRQRHQP
1468 MTKSKKRWN
1469 RRRRYMLIA
1470 CKKTKTHKF
1471 KQVKKKKES
1472 HTKRKGAWM
1473 KRMKRSRND
1474 KQRRKCVCY
1475 KKKCQSFGS
1476 KKKASGWTT
1477 EVKSKKRQP
1478 CRRRLKCGE
1479 KAKSRGGYN
1480 LAKYKKSYH
1481 KCKKCYKCD
1482 LKKKTKPCG
1483 EARRKKGWH
1484 CPRKSKFCM
1485 MNARVKRVG
1486 KCKFVKAHT
1487 KKRNKAQYV
1488 MVKRNKHYG
1489 KARWKGRVQ
1490 CSKKRKAGT
1491 GVRKTKWCN
1492 KQKFRGMRY
1493 VKRKHKFEN
1494 KGRKWGGTG
1495 IVKRLKQGA
1496 SKRKLGQVN
1497 KYKSQKWTV
1498 KRTRKKRMV
1499 MYKLKKTAV
1500 HRRKWLYPA
1501 KKKTYSCLS
1502 KRKRLPYGM
1503 KRRKNVWCP
1504 HKRKRYVAV
1505 KVRVHKMVC
1506 KWRKEKMHY
1507 KQKQKKVGP
1508 KRKAKQGCN
1509 TNKSKKSQN
1510 VKRRKIYGA
1511 KIRLRKGVS
1512 KCKIVKQMG
1513 KCRKQHHTM
1514 RAKIHRYYT
1515 GKRKHMPCP
1516 KCKKDRKQC
1517 QKHRTKKWS
1518 IKKKFGRCC
1519 LKRKDKFGE
1520 KSRKAWLCM
1521 RFRGHRCWR
1522 EKRKSKCCP
1523 KRRKQMHRV
1524 KQKWWKYGC
1525 KQKYGKFYN
1526 NGKLFKKHV
1527 TTKSFKWRQ
1528 KKRIHRHEY
1529 HTKSKKFFS
1530 KSRSKQRQC
1531 NVRRYKTHI
1532 VKKRYHRQQ
1533 HIRKAKKQC
1534 KRRRIRHLM
1535 KKKIGTKCF
1536 ESKRKRSMN
1537 YCKLKKIHQ
1538 NKMSKKKVC
1539 FFKKRRVCC
1540 RKKVCRFSN
1541 SVKMMKTLP
1542 KVRWKHGGA
1543 ITRKNKLWQ
1544 VIRRMRNFF
1545 RRRRLTPSA
1546 KNRRKKYAC
1547 KIRQKCMKF
1548 ACKNKKKDG
1549 CFKRRKYMV
1550 KAKKRANDY
1551 RRKHMRSKS
1552 GSRRRKHTH
1553 KVKMRGFWD
1554 KGRKRHQYM
1555 RYKSCKAKG
1556 RRQRSRYWF
1557 HIRKQKNNN
1558 GSRKRKMCT
1559 RYKCYREYP
1560 CKKFAKKHD
1561 KDKMCKAKG
1562 KRRKTHTKV
1563 SGKKGKSDN
1564 HKRKPYSWM
1565 RHRKKVTHD
1566 IVKSKKSYI
1567 QSKTTKKVC
1568 TKTAKKCKG
1569 RKGKCKFVY
1570 KTKRSWCSG
1571 SSKKPKHCA
1572 RLRRMWYSG
1573 HKRRNNWWP
1574 KCKLQKNNV
1575 KAKSRRYVE
1576 KRKFYKCNM
1577 KKKYCIGHM
1578 KKKANRATY
1579 DFKKCKMWQ
1580 KRKALKVDS
1581 KKQRFRAAY
1582 YHRKGKHRN
1583 HVRSKRHMM
1584 KFGKQKTLC
1585 TKRRYHHHC
1586 KKHRGSFHN
1587 RMKTRKTCS
1588 KMKCSKHKD
1589 GNRRRKYWG
1590 CYRRYKSYC
1591 EWKRYRVQS
1592 LKKTHKKSH
1593 KLKNKHWFC
1594 ICHRRRRCH
1595 PKRKQKWAS
1596 KHKRSYQAH
1597 KLKSNKQCC
1598 KRKKNTFVV
1599 KRRSYKWIN
1600 TARKTKQMI
1601 VARRKRHYT
1602 HKHRYRYLW
1603 STRRMTRGM
1604 MVRRYRSAA
1605 KAKVRQFSK
1606 MCKRVRTPP
1607 HRRKKVTCA
1608 HQKKQKWPH
1609 TRKRYVVYA
1610 KFRKANWPE
1611 KSRQYKRTW
1612 EMKKYKKWP
1613 KLKKKLSEE
1614 TFKKTKFIP
1615 CKKKTLAQV
1616 QKAKYKWCF
1617 GKRRMRSGW
1618 KKHKAGGQL
1619 MAKNKKCGL
1620 FVKSRRFPN
1621 KCRKIAHNC
1622 HRKPRRVHS
1623 TRRRTKISQ
1624 RVRHKRRHW
1625 KVRNWKSMA
1626 FRRTRRYWS
1627 VTKYKKKAF
1628 YKRKQQCAQ
1629 KRKYHKLCN
1630 KKRHRVSHT
1631 LMKAKKKDT
1632 KYKNKKIVG
1633 IVKKHKKAE
1634 DVKFCRYYR
1635 GYPRRGRRT
1636 VKKGPRTEK
1637 TNKSKKCMW
1638 AFKRFRSDC
1639 KAKQKGFMN
1640 AIKAKKVGF
1641 KTKRRMLRQ
1642 KGKKHQFSP
1643 KKKSHKLSM
1644 KSKIQKIHM
1645 MSRKKMWRS
1646 KKYRFNWNH
1647 KKKCQQCCH
1648 KIKAFRWQG
1649 QLKKFKYKA
1650 RTRKANHGT
1651 EARKAKMYA
1652 SVKKWKQRE
1653 AKGKPKVMC
1654 RGRKRWVNH
1655 KSKCFKLQS
1656 KRQSRKCRG
1657 KGRGTKYKY
1658 KIKRMKARC
1659 MVKSKKKNF
1660 AVKYYRRQQ
1661 KHKWKRTSF
1662 KKKSCICVY
1663 KGRKCGPMM
1664 MIRKAKINC
1665 KAKTKQQWS
1666 KKSKCHQRC
1667 TAKRQGLKQ
1668 KYRQKRCVQ
1669 KQKVQCSHK
1670 KWKRHFKGS
1671 HKKYWKNSA
1672 KVRSKQWVW
1673 QKRKYVHKG
1674 RKKFIKMQC
1675 PRRRTRLTH
1676 KIRPKRLEM
1677 KQKVTKIGS
1678 FKRKTAVKP
1679 KVKSGKRAQ
1680 KLRAARYRG
1681 KVKPRGMHR
1682 KVRRHKGVL
1683 KYKAMKTCG
1684 LMKFKKQFC
1685 KKKQKTAHH
1686 KAKSKWHNF
1687 KIKRYGSCD
1688 DAKKWKKCH
1689 KRRRSKYET
1690 RIRFIKYAH
1691 RVKWTRQNQ
1692 MGRKLKSKE
1693 KTRKVHIWT
1694 TKKITKHSS
1695 VGKRSKISW
1696 MPKRKRCAS
1697 NHKSYKRQH
1698 LKNKTKKQA
1699 NYKKFKCFQ
1700 RHRHDRFRH
1701 KLKIVKWAH
1702 SYKVKKSAY
1703 AGKKFKCSI
1704 SARKKGQVI
1705 RRRLQKSNS
1706 MAKTKKYWQ
1707 KRRKYWRFE
1708 LWKYKKKFD
1709 KWKCGKFYS
1710 KKRSVKSKG
1711 IAKKHKSGM
1712 RVNKMKTYP
1713 RRKSTKNHK
1714 LARKCKWVC
1715 SVKKAKWYN
1716 KWRAIKGQS
1717 KKTVKRRTG
1718 KIKMLKGVM
1719 VHKLNKMKW
1720 KGKVYKDKQ
1721 KYKLRKTLF
1722 IVKLKKCIM
1723 RKRASKVCN
1724 KKTRRKKEF
1725 KKRKLDFCS
1726 KAARKKSMC
1727 KARKCTPSH
1728 MNKKTKYHH
1729 RKKSRYCHP
1730 QAKQKKHYH
1731 TVKKHKDSN
1732 NVKSKKKFW
1733 SVKRCKAYT
1734 KHRKSIWVQ
1735 NKRKKSQDV
1736 RRRGWKERC
1737 KRKYRQNGN
1738 KFKTPKGWT
1739 KKKFGGAHW
1740 AVKRRKCPG
1741 KRIRKKISS
1742 IKKSPKKRM
1743 KARNSRYSI
1744 MVKPRRSIA
1745 YTKSKKSAL
1746 HRKRWHAMH
1747 KRKNAGRGV
1748 KAHKRKQAN
1749 KKARSHWRC
1750 KMRPSKFHS
1751 RVRKARSFP
1752 KARKYGRYL
1753 RKKRQACWF
1754 SQKAYRGHS
1755 HIRKARYDH
1756 HAKQKHQKQ
1757 RTKSCKWKH
1758 KSRKQYAQW
1759 KGGKKRCKV
1760 DKPKKKYAA
1761 KLKSCKQCS
1762 HTKAYRRES
1763 KKRLKPTSG
1764 HKKYRKQWA
1765 KTKFRKNCT
1766 TLKCKRKGM
1767 KSRKHANSG
1768 KRKRCMIDH
1769 HKRRITYWM
1770 ISKAKKTNM
1771 KFRNRRCAY
1772 TTKYHKKCW
1773 RTRKWKWWP
1774 KTKQLKCTK
1775 NFRKYKMHN
1776 KRRRSPYMS
1777 NAKWIKKWY
1778 KYRIRRHMC
1779 GSKNKKQMC
1780 MLKKGKHHP
1781 YWKRTRFQF
1782 IMRKFKRES
1783 KRKRVAAKD
1784 KARKQWMHS
1785 RSKIYRTWE
1786 SCKKKRMIF
1787 KTRLKKITR
1788 TARKRKHTT
1789 HFKCQKWRF
1790 KGQRKKSGL
1791 KSKGKQWYT
1792 KRRPIRDCF
1793 TVKKSRLRN
1794 SMRKFKWKE
1795 VGKGKKQMC
1796 QKGLKKHKP
1797 PSRKLKRLC
1798 SVRRNKHVY
1799 FMKRCKMQT
1800 NKKKFHHAQ
1801 TNKKFKSVS
1802 TRRKRPCYP
1803 NRKRQRNWE
1804 RAKTSRTEV
1805 YKPRKRNAT
1806 CKKKLSRHQ
1807 KVRKSRGQS
1808 HQKGKKRGL
1809 SKKPMKKCC
1810 KQKKSHSHG
1811 RIKLQRAMH
1812 KQKKQLDTT
1813 THKCKKTGV
1814 RLKMHRAMC
1815 KHKCSKFYQ
1816 NVRNKRAHP
1817 NKHKPKYHL
1818 SAKLKKRCN
1819 KGKNKIGDN
1820 KLKSKTFAS
1821 QCKRTKHYK
1822 YAKPKKYCL
1823 KRSRMRCFW
1824 QKKQLKAAA
1825 LKLRKKHGQ
1826 KTKKAYVVS
1827 RSMRIRRDY
1828 KKKTNTHLG
1829 KRKYNRSWC
1830 RRRKQDHVC
1831 CVKSKKTGY
1832 SCKSKKSQH
1833 LRKQKKWTG
1834 KRRKCPQYE
1835 KIKNRKSWE
1836 AGRKAKRVW
1837 KRRHGHIHS
1838 KMKNMTMWM
1839 KRRHNKNYD
1840 IRMRKKVGG
1841 VRKHIKRQY
1842 KKKTSWMGM
1843 HKRFYKVMW
1844 HKKRVCRMG
1845 KVCKFKQSA
1846 WFKIKRRRS
1847 KRRNKHPYW
1848 KTKCNRKAT
1849 DCKKKGALS
1850 KGSFKKKMP
1851 KGRYKQRSS
1852 HKQRKQQWV
1853 HKKRENYVF
1854 VKRKPPRGM
1855 KAKLYRQFP
1856 KCRRARSMD
1857 KATKKFAAT
1858 SKCNKKKWF
1859 KSSRKRIYQ
1861 RRRMRKIAF
1862 KNKKASIIG
1863 RKRMAKQPG
1864 NVRKHKCIH
1865 KWKRTKIVW
1866 VGRFGRVGT
1867 CVKTKKTAP
1868 KKRSFNCIF
1869 MQKKTKGCY
1870 SVKYKKQTN
1871 KKHKHQINC
1872 KCKPVRRAE
1873 IYRRYMRAH
1874 QCRRGRHQQ
1875 HKRKWFDKP
1876 KQRKLGLGE
1877 KNKIYREIQ
1878 KQKQTKFGN
1879 RVKIPIQIR
1880 NKHRYKCKY
1881 RKRYSKLNS
1882 NKHKMRHHN
1883 KRQRKIWRQ
1884 KVRRCKLKY
1885 CSKKSKRQS
1886 HRKTVKWNA
1887 KGKSPKLTG
1888 HIRKHWGSR
1889 KSKSKSVHD
1890 NTRKLKNCW
1891 RNKRRAWNN
1892 FCKSKRINC
1893 KRKGQGRTC
1894 NKCGKKKQP
1895 RCRRQKVPY
1896 EKRKKGIHA
1897 LTRKYKYCT
1898 KTRRPHQTV
1899 QVKHFKWTS
1900 KVKFSKWYK
1901 QKCKVKYAY
1902 VKRLKKAVC
1903 SEKRMKRKG
1904 KCGRKPINK
1905 LQKAKKHWQ
1906 DFKVRKKYP
1907 KVRHWKCSM
1908 KSRKQANAE
1909 KNRLKKRSP
1910 KHRMFQRSW
1911 HMRKAKQFT
1912 RERKLKFQD
1913 KYKSGKHHW
1914 KRRHIRRPG
1915 KWKFKPFSQ
1916 KRKKQQGYH
1917 LKRRSPHQY
1918 IQRKSKCGC
1919 KGKMKRLET
1920 VIKFKKCYS
1921 SVKPRKKAS
1922 KGGKNKVMV
1923 MAKSCKCKQ
1924 KKDKKHLTF
1925 KSKPRGRGT
1926 CSKLMKKKP
1927 KSRKQGISC
1928 KTKEKKLCY
1929 QGKSKKWNF
1930 FKKRMHRKC
1931 KTKKHGNQQ
1932 KKKLYWSQP
1933 TVKKAKRFS
1934 HKHRSIVKC
1935 HNKKMRLSG
1936 CYKSKKLCN
1937 KVKWRVKPE
1938 KARFIRHSA
1939 KKRVGPNVA
1940 KKNRKAKDY
1941 KKKWKEWLH
1942 CHRKVKIVC
1943 KKKFWTIGN
1944 MAKRPRLGT
1945 KLRTMKGLG
1946 QYKAYKKVQ
1947 TFRKCKGYW
1948 NKRKKAFDN
1949 KKKWTQHMS
1950 RQKAIKSFH
1951 KYRGWKSPG
1952 ANKKRRRAY
1953 VVKAKKNIM
1954 KKIKYRKTF
1955 KKKWQGQAP
1956 GAKWYKKGM
1957 RSRPSKQVV
1958 GTRRNRVQQ
1959 IRKKSRSKS
1960 KKKHLHGHS
1961 GLKKHKMAS
1962 SKRRTNRAV
1963 RQKKKMANE
1964 WRKRCKNTS
1965 LGRKQKLWH
1966 AVRYKRRQE
1967 KQRKSVGRQ
1968 KWKKQTCFL
1969 KGKRRWCKC
1970 CVRRTRWRN
1971 KRRKTPLHT
1972 MKKHHRQHW
1973 YTKSSRKGP
1974 KQRFFKTGS
1975 KLKHRGRWH
1976 HVKGHRRLV
1977 LKRKQRCQH
1978 DSKYRRSAR
1979 KQRKATICS
1980 EYKKKHKCG
1981 KIRPKKQVY
1982 CRKVHRNYC
1983 KARMKRQKR
1984 KLKKPRNCY
1985 KRKWWLMHS
1986 KIKMHGWRH
1987 KNKKAKYCS
1988 KIKKKQLDD
1989 KRARQKWQA
1990 RTKNRYWRV
1991 YKPRHLHKE
1992 KRPGKRKRN
1993 KIKLFKQGY
1994 IKKRMNSSL
1995 RRRHYKVNS
1996 KSKMSKHGA
1997 KLKEHKRMF
1998 AKKMLKRRG
1999 QAKIIKKGM
2000 NHRRKKCQF
2001 CRRKSKGQC
2002 KGRGMKWMH
2003 RWRLKKFQG
2004 RTRKWQKIW
2005 WKKRYSLQM
2006 CKKRYSHGQ
2007 DAKSKKRAA
2008 SKKRNQLIQ
2009 SPRPRKQAM
2010 VKKKAGLTQ
2011 HHRKPKYDT
2012 NRKARRCTD
2013 IAKWKKCTM

In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 75% sequence identity to any one of SEQ ID NO: 1170-SEQ ID NO: 2013. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 77.7% sequence identity to any one of SEQ ID NO: 1170-SEQ ID NO: 2013. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 1170-SEQ ID NO: 2013. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 88.8% sequence identity to any one of SEQ ID NO: 1170-SEQ ID NO: 2013. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having a sequence of any one of SEQ ID NO: 1170-SEQ ID NO: 2013. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two amino acid substitutions relative to any one of SEQ ID NO: 1170-SEQ ID NO: 2013. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two conservative amino acid substitutions relative to any one of SEQ ID NO: 1170-SEQ ID NO: 2013.

Retinal Pigment Epithelium Tissue-Tropic AAV VP Capsid Polypeptides. Described herein are engineered AAV VP capsid polypeptides comprising a variant 581 to 589 region predicted to confer increased retinal pigment epithelium (RPE) tissue tropism, and predicted to confer increased retina tissue tropism compared to a wild type AAV VP capsid polypeptide (e.g., an AAV5 VP capsid polypeptide), based on a primary screen of a recombinant AAV5 capsid library. In some embodiments, an RPE tissue-tropic engineered AAV VP capsid polypeptide may also have tropism for choroid tissue. TABLE 5 provides 581 to 589 region sequences predicted to confer RPE tissue tropism or preference.

TABLE 5
Exemplary 581 to 589 Region
Sequences for RPE Targeting
SEQ ID
NO   581 to 589 Region
2014 DCTFHDAEI
2015 TDEHVKMGP
2016 GTVWKNWPD
2017 NIEPTANCQ
2018 DEMAHYASS
2019 WINYTVKDR
2020 EFDQCTHGI
2021 QIYVTHQGP
2022 GTVNEYSWN
2023 VRYACLYEN
2024 WFDHNYCFG
2025 EYCPCGEVQ
2026 DRPCAVHEA
2027 VCVNRLECP
2028 TEQKQYESI
2029 TDNCKGECQ
2030 CNTQFMKRE
2031 MMIQNHCLS
2032 AVTAPTFRG
2033 FYTNAGCYC
2034 AQQSWEQIQ
2035 MHMNQCVID
2036 IHTIEQKCS
2037 IKLDVEMAG
2038 AHCTKTMQV
2039 MPQQNVAVP
2040 MQYFWHYAH
2041 AYESKIHTG
2042 MSLWCSEER
2043 LATAHSMRF
2044 VWYFYNEAP
2045 VQMAVLAYW
2046 VVLTQLEDS
2047 NQMFNNEYP
2048 HTYGSLAQY
2049 NTFMECVGG
2050 VKQMGCDIA
2051 HGQCALHTV
2052 MIGTFAYHQ
2053 VNPTKAEYA
2054 LMLGAYKEC
2055 MGEPTCEYR
2056 LTVMWGCCY
2057 PNHCYSTWN
2058 DLHAYICFI
2059 WVTMHNQLC
2060 GMEYYAHNW
2061 PPNVTVDQE
2062 QPDTVWHYA
2063 VSWVERACP
2064 CPPDHCYTA
2065 NTQSQACYI
2066 EYWFTHAEN
2067 PLEVWQTYT
2068 LVTMADHHA
2069 STENHHFEN
2070 DALTDFEGC
2071 EHCDGWRIS
2072 AQQAVEEVQ
2073 MITNLFMAG
2074 NKTDGHYQC
2075 DGLNEEMWK
2076 TQLRDMISS
2077 SEQRTNHYA
2078 HVTDHQGGI
2079 HQCCGLVMQ
2080 AQNGFDKDL
2081 VFQAFMRSM
2082 FSCPKDGYA
2083 NGGMFELTL
2084 QNDTLEHFY
2085 DQLQKDFYF
2086 TSDATCQWI
2087 ATNENIMAW
2088 EPAQKAGIS
2089 QTALRWNWD
2090 ELEPVVCQW
2091 NACTHNTFT
2092 HADANTKTY
2093 PEYSTDHPN
2094 YAVTDQEGH
2095 AIFMHPLTE
2096 AWQGATHEA
2097 QTYFMHTSA
2098 TASHVAEFK
2099 IHPVQFCKC
2100 QHMISHDKA
2101 IYTHCWHEY
2102 IAEPHYTAA
2103 TDMIVKEQC
2104 NNQPPDGAC
2105 QIEPTPEHT
2106 EILVYMYFH
2107 MMCNKIHDE
2108 MVFTRFDHN
2109 LWECATCNP
2110 NVEMGPRAM
2111 CANMEDTDY
2112 PDKACQMID
2113 SHGEKCMSV
2114 EFTLFDSDR
2115 ETLFYNAFA
2116 VTLISHCKC
2117 LNCCYKEMT
2118 TCTSCVHDY
2119 FTCIWFRWA
2120 MHPSTSVTC
2121 QKNHFEMQQ
2122 NDLYKANYN
2123 TVFQMQMCN
2124 PEHCEAWPV
2125 DVEMFFMVG
2126 MLYWCLQNG
2127 YTGWLMSDM
2128 HCVVMQRMY
2129 LHDVAAENR
2130 EEEHCAKLG
2131 HTMYVDTAN
2132 CLDWLHREY
2133 PPCETAHTY
2134 GVHTKMIAW
2135 HDVCMSYKS
2136 NLPQPVLMM
2137 IPGDYVNLS
2138 TSTVFHNWC
2139 DKLDINMTL
2140 CHYQGEHIP
2141 TYEVNCENA
2142 NFDTQPKAI
2143 MCMPADQTL
2144 AKETWDCVG
2145 PGPAHVDHI
2146 ATIVTQHGC
2147 GMYIMKEHQ
2148 PTHATTMVQ
2149 DVYAMVRPC
2150 ESHPLWHDL
2151 QSVMASTAN
2152 NEGVCSYVQ
2153 HIYSCDQSN
2154 STTKHENGH
2155 GQQPYNRME
2156 ITVTKCSDV
2157 VADTCCDMM
2158 DKHLTCQQA
2159 VEAVLFTAI
2160 VEPCRWYTD
2161 CSQSTCKMT
2162 YIAQPVDMA
2163 HICDMPKGR
2164 TIYPRLPLT
2165 QHSNLTRPC
2166 EKACCFTHL
2167 ASEENLMVK
2168 MKYTAWMDG
2169 VQYACLYEN
2170 EATLNDNHC
2171 ACNLVYADS
2172 NALNIHNLT
2173 CWILHMRSA
2174 GLDVWPWET
2175 QTAEVKACN
2176 VHTCMYGMT
2177 WVMAHNLPS
2178 PEAGYQSEC
2179 HAQMMLSGN
2180 IHFACMVMH
2181 AWQMQVNGP
2182 NFQITEAGQ
2183 CEDSFYKFD
2184 IMTSQMYPA
2185 RSELYGMTL
2186 QTLMVLRNM
2187 EHLYGDIVY
2188 MEQQMKMMF
2189 EFELDTKLC
2190 TINVQNFPT
2191 TQVLEEMAW
2192 TSFSASHWG
2193 QTIYRFNAA
2194 VIDPRHDGY
2195 NEWNQCQAH
2196 TTVNNHDGW
2197 CAYQKHGYV
2198 QTHWQYCRV
2199 SQARICSYC
2200 TNNFRMIAS
2201 TRMQADNMH
2202 NLDNKNEGP
2203 RWVGLWCAD
2204 DRQAMVKTD
2205 NAQHRSQAP
2206 EKLMLHQSV
2207 LVICMQSST
2208 TVHHGFADP
2209 KSTCETDIQ
2210 NQCFHCAWN
2211 NMPMTQNGH
2212 LFGMMPQMK
2213 TIHPFSASR
2214 FGMQDHCVC
2215 FGPLLGTIP
2216 AQGRYASQC
2217 VIHQEWPCT
2218 ETPNNEQTH
2219 QRMYLDHCL
2220 SSGCWYQLG
2221 TNEHQMVPW
2222 RSYVQDFEQ
2223 EIHVKFRYD
2224 GIHAMIVSE
2225 QNEICECYL
2226 IGVCWNYAD
2227 DENGYSAPF
2228 PMIMHQLAG
2229 DASMWGFHT
2230 DLSTFNHWY
2231 QVHQLTESV
2232 EIVNWLERE
2233 IFDWANWHY
2234 CEDILTTAA
2235 NSYPPGQGA
2236 TTSPRMMYQ
2237 TFSFVLDQD
2238 PLDRINMPF
2239 TAHSTMWGW
2240 EIGPDQDTC
2241 ELHITCLYS
2242 MNFLFEVSY
2243 MHGNQHAHK
2244 EFMNHSNAA
2245 ETDPTNRID
2246 GQLVECAAS
2247 NQHDFIRHF
2248 WAETGFCME
2249 VTHQIQRGF
2250 YRDPWVQCS
2251 LCNATWADP
2252 HLWPDTCFQ
2253 TVPEEYLRP
2254 GIGCAETAH
2255 SHDICCKFE
2256 SHNTCESIE
2257 ASDPFQMSM
2258 VFYMGHCCY
2259 YQAQCAMSG
2260 FQWCTQLGC
2261 IMTSWTKIC
2262 MQNAIARHA
2263 SVIHFGSYT
2264 GWQDMMQMP
2265 LCHADGRCS
2266 WLMDNTFPW
2267 LMGYCQKNM
2268 HQNWDNGAP
2269 ERFCELHKA
2270 CSLRTCFGG
2271 PTCAHNYRT
2272 LMDHTCKCD
2273 YTSDAAHQV
2274 SIQKEDNQH
2275 YQFPRESVI
2276 MINGPKCYY
2277 IANQKGLTV
2278 SFISWAELC
2279 RSGYQDWMH
2280 VHLPDTRNV
2281 DSGWHHACQ
2282 FVTTITTHY
2283 YGDANWAVM
2284 PVTILADEY
2285 LNYAGYCRP
2286 MNIYHENLS
2287 VTLTCNTNA
2288 FANASGFWR
2289 ITNDHNHLW
2290 DKLHGQREY
2291 SNTLLCKMV
2292 QISNVTANN
2293 GNQWYQCTA
2294 EIWACYTHG
2295 DWLQEHNGN
2296 ETYKSAEWG
2297 GICMPQEHA
2298 IHFFNLDHC
2299 CQELYGIHD
2300 QHQHVFKDS
2301 AHCVDMDTW
2302 NTADKWRLG
2303 YWHEMLSWP
2304 SACPSENRE
2305 PNWQCLEHD
2306 FLHAVWARP
2307 TNHWDHRSG
2308 SHVCRLSAE
2309 LVCVASSAC
2310 YVGMIPVHP
2311 PQSSHIGDT
2312 GSTIQNRHA
2313 DHLCFPINE
2314 TTLALGDYG
2315 PVHEWKSHQ
2316 KCASYTEPP
2317 EWELCNTTT
2318 EVACNKMMQ
2319 HTMSTTLVY
2320 STEACNYGS
2321 SLMCMEHTY
2322 TTGIYMCDQ
2323 FAMVMHDQP
2324 SRHCCLEFS
2325 TWNIACGRH
2326 EVHFSRITC
2327 FHTNYFWEG
2328 MTEYKVGFY
2329 DICDFCRQF
2330 VTMTVFHPF
2331 HTELDGCYV
2332 AWGMACTTW
2333 WISMTVGAP
2334 FANYCVAMP
2335 NILALCEGT
2336 DRLTHCCEP
2337 HCDYHVCKG
2338 HSVIKESCE
2339 MSMQKMLDN
2340 VLHQCAIEV
2341 ANVTMQHQY
2342 GPVDKAGAN
2343 KEDSKASNP
2344 DTPSYKCNW
2345 LHHFHMKHA
2346 ATNQVIRHM
2347 WSASDPYSM
2348 KEEFVHQQW
2349 CYQDIQHMV
2350 DHMEMCSSA
2351 YPVWVKVQN
2352 LPQQKNEWY
2353 TNAEFYMMR
2354 FWQLIDSAL
2355 YPVGLYQGI
2356 CTFPMHGVG
2357 GDNVCCYPQ
2358 TVGTMINAY
2359 DGSERQNAY
2360 ENFCIYKDS
2361 EHGMKYQHP
2362 GATPFEKMN
2363 HNIWLETGW
2364 TSHQKFMGS
2365 LTGSDGQSS
2366 CEVQCPFDC
2367 QVWACYLPS
2368 WFTFFMAGA
2369 TPKMEICQA
2370 DNNWMYQAD
2371 THALSMKGT
2372 IACLEQATF
2373 GVNWYINSF
2374 TIVDWVHMG
2375 TRLDMAMDA
2376 PEHPVGYTT
2377 TEGLFEWGW
2378 NNPTKTCTT
2379 CLIQQDVVC
2380 LWECYYCNS
2381 PVGIWPSIE
2382 LREFLTVQT
2383 LADGQFMGN
2384 AYQLKVFFN
2385 WVDNLMRHS
2386 NAEFEGCVT
2387 SVTVFWHPG
2388 MHAPANTQD
2389 ASYCIHRSY
2390 TKSEPCLDC
2391 GEVRMSANY
2392 EVYSHDSQY
2393 EQMSNDASY
2394 YPHAYMVTG
2395 SAIPFIRHG
2396 HGGPQVMRS
2397 NVRECHALV
2398 TAGMMQYCD
2399 CEHEMSSYY
2400 HDNGTNKKM
2401 MIPAWNVTQ
2402 AYVSAPRID
2403 IANQNESSW
2404 NTFMLELDS
2405 MITQWMHHR
2406 ADNVQWSEC
2407 SITCPSQTC
2408 FVDPWEWTR
2409 PCLQIGMQQ
2410 APCNKTHSW
2411 DGPSDFKTC
2412 VNAPPSHVE
2413 CPNEMVHYK
2414 VSNEWEASD
2415 TWNPRCWQP
2416 FCEQFGSLC
2417 LQCFLANRE
2418 RMDMHNNST
2419 YCNFIVNAM
2420 PTHTKGNEN
2421 NNFEQRVGH
2422 IMGYLWTQN
2423 YSAWMREFN
2424 DLFNIIQMD
2425 FVSNQTKWE
2426 QCLPLHNHC
2427 GVGFIPTPY
2428 DFVSNWDKF
2429 PQIICMMTV
2430 RPDHEQEST
2431 THLFHKEHA
2432 TGNMAYNCG
2433 MHDQRMYTW
2434 VVGWLTHQA
2435 MILQKNMER
2436 QVEQCLKED
2437 LKISPVNER
2438 AYEFCKNED
2439 IFEHHNRYP
2440 DAYTFINGC
2441 EACLHGFSE
2442 VMGQMAYQY
2443 LNSLVVQGK
2444 HLDPCGWAG
2445 TYSDKIVNT
2446 SFGACYQFA
2447 TQQAFFCVR
2448 EQMWNHHET
2449 VKPADANAG
2450 AIPTFHRAG
2451 NWIVSAKQQ
2452 GMYACQMEW
2453 CGHMSHRSQ
2454 GVCCNHNQI
2455 SLGPVNMTS
2456 TVAGEQMEP
2457 SLLWAVWLD
2458 CAVIGVENP
2459 GVQLIWAGL
2460 HNYASGWVT
2461 DHIWRHEAG
2462 PKLQDVERC
2463 GWPNQSYIC
2464 ENENTWHSG
2465 DKQHTVSAM
2466 PTGFWPYVH
2467 GCTMCYMYC
2468 FTIPQVRYS
2469 AEEIVYESW
2470 TTNAPCEIN
2471 ISDQFGSWI
2472 IVHGTATAE
2473 TATIVKQHW
2474 MICQNMSHT
2475 LIKPANGEC
2476 KDFNSELTN
2477 TPEEPVRGG
2478 NQMFDQNEY
2479 YLQVSMQGY
2480 NHVRNVEQC
2481 TIMHTQRGA
2482 FVSQPGYAV
2483 SMYVMPFWL
2484 VMILSNHGC
2485 VWGPFHLTR
2486 YGYHEDMMC
2487 TSTAESARD
2488 NTAHLYGFD
2489 PFSPKAQVA
2490 INCYSYNEF
2491 MKHMPMTDN
2492 HTHCVLAEH
2493 MVTTLAGND
2494 IYVQKHSDW
2495 PAFLDGVEG
2496 MTPGRHVLS
2497 CDQWLQCYQ
2498 AADSRGVPN
2499 AWCSFQHIK
2500 MQMAYYQSH
2501 QKVCHMTAI
2502 TNWRTDVNG
2503 EINEWTIAN
2504 FTEFYQAHD
2505 SEKCWPDYQ
2506 GYTGNDESS
2507 WFSQNGWAH
2508 QCALETPIP
2509 DEILRYSFQ
2510 KAVITESAC
2511 ALSAWGMPS
2512 VIWSVEHAE
2513 NAHLKMTAS

In some embodiments, an RPE tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 75% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513. In some embodiments, an RPE tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 77.7% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513. In some embodiments, an RPE tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513. In some embodiments, an RPE tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 88.8% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513. In some embodiments, an RPE tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having a sequence of any one of SEQ ID NO: 2014-SEQ ID NO: 2513. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two amino acid substitutions relative to any one of SEQ ID NO: 2014-SEQ ID NO: 2513. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two conservative amino acid substitutions relative to any one of SEQ ID NO: 2014-SEQ ID NO: 2513.

Ocular Tissue-Tropic Sequences Generated by Machine Learning

Additional 581 to 589 regions that confer ocular tissue tropism may be generated using machine learning algorithms trained with sequences identified in ocular tissue in in vivo screens. The machine learning algorithms may be employed to identify patterns in amino acid sequences that favor accumulation in ocular tissue (e.g., retina, RPE, or both) as compared to other tissues (e.g., non-ocular tissues). Alternatively or in addition, the machine learning algorithms may be employed to identify patterns in amino acid sequences that favor accumulation in ocular tissue as compared to a wild type AAV capsid (e.g., comprising a VP capsid polypeptide of SEQ ID NO: 1). These patterns may be used to generate new sequences of 581 to 589 regions that confer ocular tissue tropism to VP capsid polypeptides and rAAVs assembled from the VP capsid polypeptides. In some embodiments, new sequences of 581 to 589 regions may be generated by randomly sampling amino acid residues at each position of 581 to 589 regions that favored ocular tissue tropism in an in vivo screen. The generated sequences may be tested using classifiers (e.g., gradient boosting classifiers or random forests classifiers) to predict ocular tissue-specificity for each 581 to 589 region. The 581 to 589 regions with the highest predicted ocular tissue-specificity may be identified as ocular tissue-tropic sequences.

Disclosed herein are engineered AAV5 VP capsid polypeptides capable of forming an assembled virion that exhibits increased ocular tissue tropism as compared to a wild type AAV VP capsid polypeptide (e.g., a VP1 of SEQ ID NO: 1, a VP2 of SEQ ID NO: 10, or aVP3 of SEQ ID NO: 11), wherein the engineered variant AAV5 VP capsid polypeptide sequence has one or more amino acid substitutions in a 581 to 589 region of the VP capsid polypeptide, corresponding to positions 581 to 589 in SEQ ID NO: 2 (X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹). In some embodiments, X¹ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X² is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X³ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁴ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁵ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁶ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁷ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁸ is selected A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V. In some embodiments, X⁹ is selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, or V.

In some embodiments, provided herein are AAV5 VP capsid polypeptide having at least one mutation in a 581 to 589 region, wherein said at least one mutation drives increased ocular tissue tropism.

Retina Tissue-Tropic AAV VP Capsid Polypeptides. Described herein are engineered AAV VP capsid polypeptides comprising a variant 581 to 589 region predicted to confer increased retina tissue tropism compared to a wild type AAV VP capsid polypeptide (e.g., a wild type AAV5 capsid polypeptide of SEQ ID NO: 1), generated and selected using machine learning. TABLE 6 provides 581 to 589 region sequences predicted to confer retina tissue tropism or preference.

TABLE 6
Additional Exemplary 581 to 589
Region Sequences for Retinal Targeting
SEQ ID
NO   581 to 589 Region
2514 HKKRARQRP
2515 HKKKKKQEP
2516 HKKKARTRP
2517 HKKRKRVRP
2518 HKRRARVQP
2519 AKRRKKRRN
2520 HKRKKKRRT
2521 HKRRARYRP
2522 HKKKGRMRP
2523 HKRKKKRRP
2524 HKKRKKQRV
2525 TKKRKRICP
2526 HRKRGRVKP
2527 HKKKARQKT
2528 HKKRKRLRS
2529 AKKKKRMRP
2530 HKKRYKQRP
2531 HKKRGREQP
2532 HRRRKKQRP
2533 HKKKKKQKP
2534 HDRKKKFRP
2535 HKKRKRKRP
2536 HKRKKKLET
2537 HKKRGRTRW
2538 HCRRARSYP
2539 HKKKAKQRP
2540 HKKRARHKD
2541 HCKRKKVRS
2542 HSRRARVQP
2543 TKKRKRTQW
2544 HKKRKRMKS
2545 HKKRKRQKW
2546 HDKKARSKP
2547 HKKRKRQRP
2548 HCRRARMRC
2549 HKKKKRVAS
2550 HKRKKRQAY
2551 APKRKKFRP
2552 HLRKAKTAP
2553 AKKKKKFRP
2554 HKKKGRMKP
2555 HDRRGKQRP
2556 HLPRQRVKP
2557 TDKKKKQCW
2558 TKKKKKHCP
2559 SKKKGRERP
2560 HDKRGKMKP
2561 KLKRARTQP
2562 MKKRKRQAW
2563 HLKRAKFRT
2564 HKKRKREKP
2565 MKKRKKQRN
2566 HDKKKRQRE
2567 HRRRKKQKC
2568 HRRRKRLQP
2569 HGRRAKVRP
2570 HKKKKRANP
2571 HKRKKKTRP
2572 AKRRARTKP
2573 HKKRLRMRP
2574 AKKRKRSRP
2575 HPKRAKAKP
2576 HKKRKRHKP
2577 HRRRKKLKN
2578 HDKKKRVKP
2579 HQKKKRLQP
2580 HKKRARFQS
2581 HKRKKKIKP
2582 HKKRKRQEP
2583 HKKRARHRP
2584 HKKRLKHIW
2585 HKKKKRMRP
2586 HCKKKRVRY
2587 HKKRKRSGN
2588 HKKKKKARP
2589 ARKRKKLKP
2590 SKKKGRQKP
2591 HKKRDKQRP
2592 HKKRKRMRY
2593 HKKRKRHRT
2594 HPKRKKLAP
2595 HKRRARQRP
2596 HKRKKRTRC
2597 HDKRKRHRW
2598 QPKRKRVAP
2599 CDKKKKTRP
2600 HKRRKKLRP
2601 HKRKARTRP
2602 HRKKLKSKP
2603 HKKKLRVRP
2604 MDKKGKTCW
2605 HKKRARVEP
2606 MKKRGRTPP
2607 HKRRKRTRN
2608 AKKKKREKL
2609 HCRRAKQRE
2610 HKKKLRMRW
2611 HPKRKRTRD
2612 HKKKSKQKP
2613 HQRRKKKKP
2614 TKKRKRVKA
2615 HKKRLRVKP
2616 HKKKKKVRP
2617 TKKRKRVRS
2618 HCRRGKVRC
2619 HKRRKRMRP
2620 HKKKKRQAW
2621 HKKKKRLRP
2622 HKKKKKRCS
2623 HDRKKKTKP
2624 HKKRKRHGP
2625 HKRRARKRP
2626 HKKKKKVRC
2627 HKRKKRQRP
2628 HKKRKRDRP
2629 HKKKAKFQP
2630 HDKRKRTRN
2631 HKKKKRFNP
2632 TKKKKRQKW
2633 ALKKKRQKP
2634 HKKRLRFKP
2635 AKKKKRQRP
2636 HRKRAKVAP
2637 HCKKKKQIP
2638 AKKRKRQKW
2639 HKKKGKHRV
2640 HKKRDRMCS
2641 HKKRARLKP
2642 AKRRKKAKP
2643 TLKRKRTKP
2644 HKKRARLAY
2645 HKKRKRRRW
2646 HLKKKRKQN
2647 HKKRKKLRP
2648 HKRKKKFGP
2649 EKKKSKMQP
2650 HCKRAKTRP
2651 TKKKKRHKN
2652 HKRRKKERW
2653 HKRRGKQRP
2654 HKKRKRTKP
2655 AKKRAKQRP
2656 HKKKGRTRP
2657 HCRRKKVRW
2658 HKKRKRFKP
2659 HKKKKRHKP
2660 HEKRKRFKP
2661 HKKKKRTRV
2662 HPRKAKCRD
2663 HKKRAKQRT
2664 HKKRARHQT
2665 HKKRKRHRL
2666 HRRKAKTRT
2667 HKKKKRTYW
2668 HKKRKRLRC
2669 HKKRKKQRP
2670 TKKRKRLRP
2671 HDKRKRVKP
2672 HDRRKKTAP
2673 HKRKKKVRP
2674 AKKKKRQKP
2675 HLRKKRLRP
2676 HKKRKRQKP
2677 HKRKKRQRW
2678 KDKKKRVRP
2679 HDRRKKFKH
2680 TKKKKRMRP
2681 HKRRKRRGW
2682 HKRKSRTRP
2683 HRKRKRVCP
2684 MKKRKRQRP
2685 HKKKKKQRP
2686 HRKKKRVKS
2687 TKKRARQRA
2688 MKKKGRVRP
2689 HRKRGRMRA
2690 MKKRKRVVP
2691 HKKRKRLRY
2692 HCKKKRQRP
2693 HDRKKKVQP
2694 HCKRAKTGP
2695 TPKRKRLRS
2696 HKKRGRVRP
2697 TKKRKRQRY
2698 MRRRGRSRP
2699 HKKKKKQCP
2700 HKRKKKDQT
2701 HCKKARFRP
2702 HDKRLKQRW
2703 HLKRKRTRE
2704 HKKRKRTRW
2705 HKRKKRFNV
2706 CDKKLRFFP
2707 KKRRARQGP
2708 TKKRSKVRS
2709 HDKRLRHKE
2710 AKKKKKVWW
2711 HKKKKRLRW
2712 HKKRLKQKN
2713 HKKRKRLRV
2714 HKKKKKERP
2715 HKKRKRSQP
2716 HKKRARVRP
2717 HKKKKKFRT
2718 AKKKGKLRQ
2719 QKKKGRDRS
2720 HERKKKLRP
2721 HKRKKKTKE
2722 HKKRKKVKP
2723 HKKRARLRW
2724 MKKKKRVRP
2725 HKKRARLRS
2726 HQRRAKTRP
2727 HRKKLRQKP
2728 HDKKKKMMP
2729 HKRRKRICP
2730 HRRKKKQKM
2731 TRKRSRVIN
2732 HKKRKKRRW
2733 HKKRKRRVP
2734 HKKRKRMRP
2735 TKRRARVRT
2736 HKKRKRVAP
2737 HPKRKRHRP
2738 SKKKKRFAP
2739 TLRKKRQRP
2740 KKRKKRKGN
2741 HKKRKRTRP
2742 HKKRKRHNP
2743 HKKKGRHQC
2744 HKKKKRSRP
2745 HDKRKKQKP
2746 HKKRKKQRE
2747 HKKKGKVKP
2748 HLKKKKKQP
2749 HPKKKKLRP
2750 HRKRAKVRC
2751 HDKKKRLRP
2752 TKKRKKDKE
2753 HKKRARQRY
2754 MKKRARLRC
2755 HKKRARFRL
2756 HKKRGRIRP
2757 HQKKCKTCP
2758 HPKRARTRP
2759 MKKKKRQCN
2760 HLKKKRWRW
2761 HKKKKRLKN
2762 HKKRKRART
2763 HKKRKKMRP
2764 HKRRKRRRS
2765 HQRRKKLRN
2766 HKRKKRLRN
2767 HKKRKRMKP
2768 HKKKKRVPY
2769 KDKKKKLKP
2770 AKKKARMKW
2771 TCKKAKMCP
2772 HKKKLKMWP
2773 HDRKKKQIW
2774 HKKKKRMCP
2775 HKKKLRQRP
2776 TKKRKRQRP
2777 AKKRKRQAP
2778 KQKKKREWP
2779 AKKRARQKP
2780 HCRKKKTRY
2781 AKKRLKVQP
2782 HCKKKKQRP
2783 KKKRKKRRP
2784 ADRRAKVRP
2785 HGKKGRVRP
2786 HKRKAKVRN
2787 HLKKKRRKT
2788 HEKRKRERP
2789 HCRRKKERP
2790 TKKRKRTAP
2791 HLRRARLKN
2792 HKRRKRHRW
2793 HKRKKRQQQ
2794 HDRRGKTQP
2795 TDKRGKQKP
2796 AKKKKRHKM
2797 HKRKKKMRP
2798 HKKRKRLRH
2799 HCKKARRKP
2800 HRKRLRQRP
2801 HKKRGRVKP
2802 HKKRKKDKS
2803 MKKRKRHQH
2804 HKKRKKVKD
2805 HDKRARQRP
2806 HDKRKRVWP
2807 AKKRKKHRP
2808 TRKKKRVKP
2809 HKRRKRHRP
2810 HKKRLRLRP
2811 HKKKKKLRI
2812 HRKRLRSRP
2813 HKRRKKERP
2814 HKRRKRLRT
2815 HKKRKRHRN
2816 HKRRKKLRW
2817 HKKRSKQRP
2818 HDKRKRVRP
2819 HKKKKRVKP
2820 IKRKKRHYP
2821 HRKRAKQQP
2822 HDKRKKMRD
2823 HDKKLRFRW
2824 AKKRSRWRC
2825 HKRRKRQKP
2826 HERKKRVRP
2827 HKKRKRTRV
2828 HKKRLRVRP
2829 HKRKKKHRP
2830 HKKRARHRS
2831 HRKRKRLRP
2832 HKKRKRTYY
2833 YKKKKKVCS
2834 KKKRKRQRW
2835 HKKRKRVKP
2836 HKKRKKVRS
2837 HDKRKKMQP
2838 TKKKAKQKP
2839 HKRKKRWRW
2840 HKKRKRFRP
2841 QQRKARHRP
2842 HCRKDKQQP
2843 HKRKLKWKP
2844 HKKKKRQKP
2845 HKKRKRTCP
2846 TKKKSKTRP
2847 HKKRGRMRP
2848 HKRKKKLKC
2849 HKKKKRFKP
2850 HRKRARLKP
2851 HRKKGKQRP
2852 TRKRKRMRD
2853 HQKKKRQLP
2854 CKRKKRFCP
2855 HPKRKRQYP
2856 HEKRAKHCP
2857 HKRRKRQQP
2858 HKKRKRLND
2859 HKKRGRQQH
2860 HKKKSRHRP
2861 HKKRKRMYP
2862 HKKRARSRW
2863 HDKKAKFRP
2864 HKRRAKQRP
2865 HKRLLKDRP
2866 HKKRARQRL
2867 HKKKKRMKP
2868 HKRKKRVRW
2869 HKKKLRMRP
2870 IKKRARMRP
2871 HKKRKKLCP
2872 HKKRKRFCP
2873 HKKRKKTLA
2874 TKKRKRVCP
2875 HPRKKKLRP
2876 HKKRAKFQP
2877 ACRKGKQAW
2878 HPRRKRTKP
2879 HQRRARLRP
2880 IKKRKRTRP
2881 HRKKKKDKS
2882 HKKRKRQRW
2883 HKKRKRRRM
2884 HPKRKKQRP
2885 HQKRGRCRP
2886 HPKRARFRP
2887 HKKKKRQRY
2888 AKRRAKARP
2889 HKRKKRQKN
2890 HKKRAKSQT
2891 SDKRKRMKT
2892 HKRKKRKRP
2893 HKKRKRMRW
2894 HDKRARTRP
2895 MDKKKRQKP
2896 HKKKKRTAD
2897 HKRKKRLKP
2898 HKKRKRLKP
2899 HKKRARTRP
2900 TKKRARVKP
2901 HDKRKKLNT
2902 HKKKGRHRP
2903 TKKRARFRP
2904 HKKRKRFNP
2905 HDKRKRTRP
2906 TDKRKRFRP
2907 HKKRKKFQP
2908 HKKRKRVQC
2909 HKKKKRQRP
2910 TRKKKKMKN
2911 TKKRKRMRS
2912 HKRRKRTKP
2913 TRKRARVKP
2914 TKKKKRMGY
2915 HKKRGKVRP
2916 KKKRKRQCV
2917 HRKRKRTRP
2918 HDRRAKRAY
2919 HKKKKRERY
2920 HKKKKRHRW
2921 HKRKKKVRY
2922 HKKKLKTQS
2923 HPKRKRMCP
2924 HRKRKRMRP
2925 HRKRARVKP
2926 HDKRKRMRP
2927 HRKKKKVRP
2928 HCRRAKFLP
2929 HDRRKRLRP
2930 HKKRKRFKS
2931 HCRKKRFRP
2932 HKKRARQRS
2933 HKRKKRQKP
2934 HRRRKRFHW
2935 HKKKKRVRP
2936 HKRRKKTRT
2937 HPKRKRTRP
2938 HKKKARSRP
2939 HKKKKKTNN
2940 HKRRARARP
2941 HCRKAKQQP
2942 HPKRAKQIP
2943 HKKRKRLQP
2944 HKKKKKGKP
2945 HKKRKKMCP
2946 HDKKGRVKP
2947 HKKRKRVRC
2948 HKKRKRMDS
2949 HKRKKRFRS
2950 HRKKKRHKW
2951 HQKKKRFRP
2952 HKRRDRTKP
2953 HDKKKRMNP
2954 HKKRSRDRE
2955 HDKKKKQRC
2956 TKKKKRFCS
2957 HEKRGKHRP
2958 HKKRKRFRW
2959 PKKRKRMRW
2960 AKKRSKQQY
2961 AKKKKRMKW
2962 AKKKARVIP
2963 HKKKARQRP
2964 HKKRKKVNP
2965 TPKKKRLQN
2966 HKKRKRLAN
2967 YKKRKRQRL
2968 HRRKTRMRS
2969 HKKRKRQAW
2970 KKKKKRHRP
2971 HKKRGKEKP
2972 AKKRKRQRP
2973 HKKSAKDRP
2974 HKKRQRQAP
2975 HDKKKKFQW
2976 HKKKKKQRW
2977 AKKRKRQKP
2978 HKRRARVKP
2979 HSRRARMRT
2980 HKTRARFKP
2981 AKKRKRLCQ
2982 ACKRKRMKP
2983 HCKRARVKP
2984 HRRRKRGRS
2985 HKKRARVQP
2986 HSKRARQGW
2987 HKKRAKHRC
2988 HDKKKRHKP
2989 HKKRARVKD
2990 HKKRKKVRP
2991 AKRKKRVKP
2992 HKRRKKTAY
2993 HKKKARHRP
2994 ARKRARQQP
2995 IKKRGRVRY
2996 HEKKARVKP
2997 HKRRKKRRT
2998 HKRRKRQRP
2999 TKKRDRHYP
3000 HDKRAKQRP
3001 HKKRKRLRW
3002 HSKKKKFCP
3003 HKKRKKQRW
3004 HCKRAKARC
3005 HKKKKKQQP
3006 AKRKKKQRP
3007 HQKRKKDQP
3008 HKKRKRSKY
3009 HKRRKKTQP
3010 HKRRKRTKW
3011 HDKRARERP
3012 HKKKKKHKT
3013 AKKRKRFRP
3014 KKKRARMRP
3015 HKKRARHEP
3016 HKKRAKERP
3017 HKKRCKSNP
3018 HKKRARFMP
3019 HKRSKRQRW
3020 HLKKKKAKP
3021 HKKRKKHRP
3022 HRKRKKQRP
3023 HKKKKKQKN
3024 HKRRDRKQP
3025 HCKKKKQKW
3026 HKKRKRVRS
3027 HDKKKKTGN
3028 EKKRKRHRT
3029 TKKKKKVRP
3030 HKRKKKVKP
3031 HKKRKREQP
3032 HKKRKKLKW
3033 HKKRDRTKP
3034 HKKRKKQNY
3035 HKRRKRRRH
3036 ADKKAKVAP
3037 HCRKKKQRP
3038 HKKKAKLQP
3039 HKKKGRFRY
3040 HDKRKRFKP
3041 HKRRLRQRP
3042 HPKRKRERP
3043 HKKKLKTCP
3044 HKKKGKQAP
3045 HKKRKKMRN
3046 HKKRKKSRN
3047 TKKRKKVRP
3048 HDKKARTKP
3049 HCKRAKQRP
3050 HRKRARTRP
3051 ACKRGRLRP
3052 HKKRKRHRP
3053 AKKKKRVRP
3054 TKKRKRVRP
3055 HKRKARHKN
3056 HKKKGRLRP
3057 HQKKGKVKP
3058 HKKKKKQRT
3059 AKKRKRRRY
3060 HKKRGRHKY
3061 HKKRKKVCP
3062 HRKKKRQRP
3063 HDKKSKQRP
3064 HKRRKRQWP
3065 AKKRKRLRP
3066 HKRRKRQPP
3067 HDKKKKMKV
3068 HCRRAKTRW
3069 HCKKKKMRP
3070 TCRKGKQRP
3071 HKKRARFKS
3072 SPKRKRFRS
3073 ADKKKRHKP
3074 HDKRARSRP
3075 HKKKKKQQM
3076 HKKRGRVQP
3077 HKRKKKDCQ
3078 HKKKKKFKP
3079 HKKKARLQP
3080 ARKRARVRP
3081 HQKRGRVYP
3082 HKKRKRVRY
3083 HKKKKKLRP
3084 TKKKKRVRP
3085 HLKRARQRP
3086 TKKKKKQRP
3087 QKKRKKQEW
3088 HKKRKRRRH
3089 HKRKKRVRP
3090 HCKRKRMQS
3091 HKKRKRTRY
3092 HKKRKHQKP
3093 HEKKAKTQT
3094 HDKKKKTRP
3095 TKRKGRDKS
3096 HKKRARVKP
3097 HCKRKRVRE
3098 HKKRKRFVL
3099 TRKRAKVQP
3100 TKKKKRRIP
3101 HRKRKRRRP
3102 HEKKKRQKP
3103 HKKKGRMRY
3104 HCRKGRQKY
3105 HDKRKRTKE
3106 HQRSAKQCC
3107 HRKRKRFRP
3108 HKKKLRVQW
3109 HKRRARFRP
3110 HDRRKKQRP
3111 HKRRKRVAP
3112 KKKRKRQKP
3113 HKKKARVKP
3114 HKRRARMRT
3115 HKKKAKVKP
3116 MQKKKRHRP
3117 HKKKKKVKT
3118 TDRRLKTIP
3119 HKRKKRTKW
3120 HKRKLKQRP
3121 TKKKKRQRP
3122 APKRGRFIP
3123 HRKKLRFKP
3124 HKKRARVKT
3125 KKRKKRQRP
3126 HKKKKRQQP
3127 HKRRKRSYS
3128 HCRRAKVKC
3129 QKKRGRRKW
3130 HRRKGRQRT
3131 HKRRKRFRN
3132 HQRRAKLQY
3133 HLKRARVRP
3134 HKKKKRLKP
3135 HKKKKRTCP
3136 HDRKKKTRP
3137 HKKKKKFRA
3138 HDKRARFQP
3139 HRKRGRTKS
3140 HRKRKRHRP
3141 HEKKGREAP
3142 HKRKGRVCP
3143 HKKKGKKRP
3144 HKKRKKCRN
3145 HKKRARVRT
3146 KQKRKRFRS
3147 HKRKKKDRP
3148 HRKRSRVRP
3149 HDKRARVRP
3150 HKKRLRFRN
3151 HKKRKRRNW
3152 HQKRKRTRP
3153 HKKRGKMKW
3154 HKKKGKYRN
3155 HKKKKRMRS
3156 HKKKKRQCE
3157 HKKKKRFEP
3158 HLKRKKSKP
3159 HCKKCRHRP
3160 HKKKKRQRE
3161 HDKRKRLRP
3162 HPKSARQRP
3163 HCKRKKLRP
3164 HDRKKRQRP
3165 HKRRKREKP
3166 HKKRKKRSW
3167 AKKRKRVQT
3168 HKRRAKQGW
3169 ADKRKKMRP
3170 HLKRKRFRP
3171 TKKRGRTNP
3172 HKRKKRTRP
3173 HKKRKRALP
3174 HKRKKRMRN
3175 KKKKKKQRW
3176 HKKRKRVQP
3177 HKKRKRVCP
3178 AKRKKKDIP
3179 HKRKGKMRP
3180 HKRRKKDQW
3181 HDKRAKTKP
3182 HKKKKRVRW
3183 HKKRKRTKA
3184 HDRRKRQRW
3185 HKRKAKERP
3186 HKKKKRHRP
3187 HKKKSRVRP
3188 HKRRKKQKP
3189 HCRRKRLRP
3190 HQRRGRLRT
3191 HKKRKRVRN
3192 AEKKARTQW
3193 TKKRKRAKE
3194 AKKRARQRP
3195 HRKKKRTAP
3196 HKKRKRLRP
3197 PKRKKRQRN
3198 HKRKKKTRW
3199 HRKRKRQRW
3200 TKKRKRRGT
3201 HKRRKKQGP
3202 HKKKKKHRW
3203 HDKKKRERP
3204 HEKRLKFKW
3205 IKKRKRMCY
3206 HKKKKHQRP
3207 HKKRKRHKC
3208 HRKKKRQKP
3209 HDKRKRSRP
3210 HKKKGRQIP
3211 HKRRKRTRP
3212 HRKKKRARP
3213 HKKRLKRRW
3214 HCKRKKLAP
3215 HKKRKKTRW
3216 HKKRGHQRP
3217 HKKRKRFQS
3218 HKKKKRSKP
3219 HKRKKKVKA
3220 HKKKKKHRP
3221 TLKRARVKP
3222 HKKKKKFQP
3223 HPRRKRKRP
3224 AKKRARVRP
3225 HKKKKRQRT
3226 HKRKKRTRM
3227 HRKRSRKRT
3228 HCRRKKQKP
3229 HKKRKRQGP
3230 HKKKLKQRN
3231 MKKKKRLKW
3232 HRKKKKQKW
3233 HKKRKRTKY
3234 MKKRKKHRC
3235 TKKRAKMRP
3236 HRRKKKLRW
3237 TKKRARSNP
3238 HKKKTRHRP
3239 HKRKKRFPP
3240 HKKKKRAKW
3241 HKRKKKARP
3242 HKKRKRHVW
3243 HDRKKKTRE
3244 HKKRKRFPP
3245 HLRKARIEP
3246 HRRKARQRN
3247 HCKKKKQRS
3248 HKKRSRCKP
3249 HGKKKKQQW
3250 AKKKLRQRP
3251 HKKRGRQRP
3252 AKRKKRKRE
3253 HKKRKKTRP
3254 QKRRKRVRP
3255 HKKRKRQRH
3256 HKKRGKFCP
3257 HKKRKRQRS
3258 HKKKKRIRP
3259 HKKRAKQRP
3260 SKKRKRHRP
3261 IKKRKRVEP
3262 TKKRKKMRN
3263 AKKKKKFGS
3264 TQKKGRVKP
3265 HDKRGRQRC
3266 HKRRKRMRW
3267 HKKRKRTQP
3268 HKKKKKVKP
3269 HKKKKKMCW
3270 HKRRKKQND
3271 HKKRKRVGP
3272 YKKRGRMRP
3273 KPKKKRFRG
3274 AKKRKKQKS
3275 HKRRKKWRP
3276 HRKRKRLGY
3277 HKRKDKVRT
3278 HKRKKKHRW
3279 HKRRKRRRP
3280 HKKKGRART
3281 AKKRARWIP
3282 MKRRKKLRP
3283 HKRKKKFKW
3284 TRKRKRVCP
3285 HQKKAKTEP
3286 HKRKLKVRP
3287 IKRRKRMHW
3288 HKKKKKQKV
3289 QCKRGRMRP
3290 HQRKKKHKC
3291 HKKKAKTRT
3292 HKKRKRVRE
3293 TPKRLRMAP
3294 HCKKARVKP
3295 TKRRKRFRP
3296 KDRKKKQRT
3297 HKRKKRMRP
3298 HKKKLRQKA
3299 TDPRGRQKP
3300 HDKKARQRP
3301 HKRKKRAWW
3302 HKKRKRMRC
3303 HKKRLRLRT
3304 TKKKNKMGP
3305 HKRRKRFRY
3306 HKKRKKTKW
3307 HDKKARLVP
3308 HKRRAKTAP
3309 HORRKKFNN
3310 HKKKKRLCW
3311 HKKRKRFRC
3312 EKKKKRVKP
3313 HKKRKKQKP
3314 TKKKKKQKP
3315 HKKRKKQQN
3316 HKKRGKAKW
3317 AKKKGRHRP
3318 HKKRKRRRP
3319 AKKRARTRW
3320 AKKKKRQCN
3321 HRKRKRTAY
3322 HKRKKRFIP
3323 TKKRKRTKP
3324 KDKKAKTQP
3325 HKKKKRHRC
3326 HRKKKKTWT
3327 AKRKGRLFP
3328 HKKKKHTNP
3329 HKKRLRVRW
3330 HKKRKRQRL
3331 HKRRARQRY
3332 HCKKARSKP
3333 HKKKKKRNH
3334 HKKRSRLKP
3335 HDKRAKQQP
3336 HRKRGRLNP
3337 HKKKAKARP
3338 HKKRARMKP
3339 HKKRGKVEY
3340 HRKRQRARP
3341 HPKKKKQKP
3342 TVKRARVAT
3343 HDRKLRQRP
3344 HEKRKRMAP
3345 HKKRSRMRP
3346 HDKKKKLRP
3347 HKRKGRGRP
3348 HKKKAKVAS
3349 TKKRGRQCP
3350 HCKKKRQKS
3351 AKKRAKQKS
3352 HGKRKKVHT
3353 HRKKKKVPP
3354 SCKRGRTRP
3355 HPKKKRVRP
3356 HKKRKRFWH
3357 HKKKKKFRP
3358 HQKRKRVRA
3359 HKKKARARP
3360 HKKRKRFGP
3361 HRKRKKMRP
3362 ADRKKRMRN
3363 AKRRKRHAP
3364 HKKRKKTNC
3365 HQKRDKQRT
3366 HRKRKRQRC
3367 HQKRKRVKP
3368 AKKRKRVRP
3369 HKRKKRHKC
3370 AKKRSRVHP
3371 HRKRKRHRW
3372 HKKRKRFRT
3373 TKKRKRVQP
3374 AKKRKKVKP
3375 HKKRGRHRS
3376 HRKKKRLRW
3377 SKRKKRFKD
3378 HDKRGRTKP
3379 HERKKRERP
3380 AKKRKRVAP
3381 HKKRLHVRE
3382 HKKRGRLRP
3383 HPKRKRVKP
3384 HKKRSRQRP
3385 HRKKKRTRP
3386 AKKRLRHRS
3387 HQKKKRTRW
3388 HKKRKRGKY
3389 HDKRARFRY
3390 TKCRKRVRP
3391 TRKKKRVCP
3392 HKKRKRVWY
3393 HQKKLRSKP
3394 HKKRLRVRN
3395 HLRKAKTKP
3396 HKRKKRHKP
3397 HKRKARQRE
3398 HKKRARHKP
3399 HKRKAKQAV
3400 HDKRKRTQP
3401 HQKKKRVKP
3402 HPKRLRSRA
3403 HCKRGRVRP
3404 HLRKKRLKP
3405 MKKRKRVRP
3406 KKKKLKFQY
3407 HKRKGKQRP
3408 HDKKKKQRP
3409 TKKRARQRP
3410 HKRKKKLQL
3411 MKKRKRRRP
3412 HKKRGKDCW
3413 PKRRGRTAP
3414 HECRGRFRP
3415 HRRRKRARP
3416 AKKRKRHRP
3417 HDKRGRHRN
3418 AKRRARVKP
3419 HCRKKKQRY
3420 HKKKKRFRH
3421 HKKRKRHRS
3422 HKKRSRVRP
3423 HKKRGRSRT
3424 HKKKKRTKW
3425 MKKKKRFRP
3426 ADKKKKMRP
3427 HRKRKRFKS
3428 HKTRSRQKY
3429 IKKKKRMRP
3430 TKKRKRFKW
3431 TKKKAKLKC
3432 SDKRGRMCP
3433 HKKRAKVKP
3434 HKKKGRQRI
3435 HLKKGKLRP
3436 HKKRAKFKH
3437 KKKKKRTRI
3438 HKKRAKQKP
3439 YKKKKKMKN
3440 HKKKKRKRP
3441 HKKRKKDKP
3442 HDRRKRLKP
3443 AKKRSRVRP
3444 HKKKKRFKW
3445 HKKRKRFRN
3446 AKKKKRVCS
3447 HKRRKRFIP
3448 MEKRKRLRP
3449 HKRKAKDRW
3450 HRRRARMEP
3451 HKKRLREKT
3452 KPKKKRMKN
3453 QKRRKRRRC
3454 HRKKARVRW
3455 HKRRARLRP
3456 HKKRKRFWT
3457 HKKKKRLAP
3458 HRKKKKQRN
3459 HKKRKKARP
3460 HKKRLRTKP
3461 HEKRKREQP
3462 HCKRKRVRW
3463 HKKKKKSRP
3464 TKKKDRHKP
3465 HKRKLRFRP
3466 HEKRKKARD
3467 AKKKKRFRP
3468 HQRKARMKT
3469 AKKRKRQKN
3470 AKRKLRMRW
3471 MKKRKKFKN
3472 HKRKARLRS
3473 HDKRKKQQP
3474 HKKKKRRCM
3475 HKKRGRGRW
3476 HPKRKRTCP
3477 ACKKKKQQP
3478 PKKRGRTQP
3479 HKKRKKERP
3480 HKRRKRRRW
3481 SKKRKRMRP
3482 HLKKGRHRP
3483 TKKKDKHKC
3484 AQKKAKARP
3485 AKKRSKQRP
3486 HCRKARQQP
3487 HKRRSRLKW
3488 HDRRKRSAA
3489 HKRRTRVRP
3490 EKRRKRVQP
3491 HDRKKKTQC
3492 SKRRKRFGP
3493 HQKKLKERP
3494 HLKRKRVKP
3495 HPKRKKQQW
3496 HKRKKKTRL
3497 HPKRLKVRP
3498 HKKKKRTQW
3499 HRKRKRTGP
3500 HKKRKRSKT
3501 HRKRKRMRC
3502 HKKRKRQAA
3503 HKRRARHRT
3504 TKKRKKSRN
3505 QKKRKRQRY
3506 HKKKARQKN
3507 HKKRKRECS
3508 TKKRKRQIC
3509 HDKRKRIKP
3510 HDRRKKMRP
3511 TKRRARTKY
3512 HKKRKKFRP
3513 HKKRARLRP
3514 AKKRARMRP
3515 QRKRARVRN
3516 HPKRKKTKP
3517 TKKKKRFKW
3518 HKKRKKHCP
3519 HQKKKRKCP
3520 HKRRKKTRS
3521 HKKKKKTRT
3522 HDKRKRLQP
3523 CKRKKRTCP
3524 HKKKLQTKN
3525 KPKKKRVNH
3526 TKKKKRTRT
3527 HGKKKRVKP
3528 TKKKKRTRP
3529 HKKKKRTRP
3530 HDKRKKQRE
3531 HKKKKRLRS
3532 HKKRAKLRP
3533 HKKKAKDRP
3534 KKKKKRLRP
3535 MKRKKRFRC
3536 HCKKAKQRP
3537 TRPRKRTKP
3538 HDRKGKQRP
3539 HKRRAKFRT
3540 HRKRGRLRP
3541 HKKRKKQQP
3542 HKKKKRQRS
3543 HDKKARVKP
3544 HEKKGRMRP
3545 KKKRKRHRP
3546 KKRKKRVRP
3547 AKKRLRHRP
3548 HKRKGKFRP
3549 HDRKAKVRP
3550 HQRKKKMQW
3551 HKKRSRQKS
3552 HKKRGRFRE
3553 HKKKKKARW
3554 HCKRARTAH
3555 HKKRQRMRC
3556 HKKRARQAP
3557 HKRRAKVIP
3558 HCRKDKTRW
3559 TKKRARLRP
3560 HRRKKKLAS
3561 HKKRAKQKY
3562 AKKRKKQHP
3563 HPKRKRQKP
3564 HKRKARVRP
3565 HKKKKRARP
3566 HKKKKKMRC
3567 HKKKAKTRP
3568 HQKRKKQRP
3569 HRKKLRCRW
3570 IKKKKKMRS
3571 HKKRSRLRP
3572 HRRKKRVGP
3573 HKRRDRQRS
3574 HQKRGRVRT
3575 HKKRGKMRP

In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 75% sequence identity to any one of SEQ ID NO: 2514-SEQ ID NO: 3575. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 77.7% sequence identity to any one of SEQ ID NO: 2514-SEQ ID NO: 3575. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 2514-SEQ ID NO: 3575. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 88.8% sequence identity to any one of SEQ ID NO: 2514-SEQ ID NO: 3575. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having a sequence of any one of SEQ ID NO: 2514-SEQ ID NO: 3575. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two amino acid substitutions relative to any one of SEQ ID NO: 2514-SEQ ID NO: 3575. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two conservative amino acid substitutions relative to any one of SEQ ID NO: 2514-SEQ ID NO: 3575.

TABLE 7 provides additional 581 to 589 region sequences predicted to confer retina tissue tropism or preference, generated and selected using machine learning.

TABLE 7
Additional Exemplary 581 to 589
Region Sequences for Retinal Targeting
SEQ ID
NO   581 to 589 Region
3576 KGRRKKVSG
3577 AQKKVKKFG
3578 HKKRRKVWH
3579 KSKIKKYAG
3580 QNKKKKWSW
3581 HKKKLKWVS
3582 KKKKPVTWG
3583 KVKTKKKWA
3584 KTKKIKSHG
3585 KRKKAARKP
3586 KQKIKKSSG
3587 KKKKTRHQR
3588 KVKKKVCGG
3589 KKRPKRRQC
3590 MAKRKKWRP
3591 KTKKKHTSD
3592 RNKKKKRCW
3593 CKKKKRKGC
3594 KMRKKKCEQ
3595 KKKFVKMTH
3596 KTKAFKKLG
3597 KVKRKRKAG
3598 KVKTCKKPQ
3599 MKKLKKLWC
3600 KWKKKKGIF
3601 FKKKGKAHA
3602 LKKMKKQAC
3603 KTRKTKWSP
3604 KAKWYKKGN
3605 KRKRRRKKS
3606 KKKVWIKSQ
3607 KYKNKKWNS
3608 NVKRYRHAQ
3609 RTKKRRSCG
3610 IPKKKRKWC
3611 KGKLKKHCT
3612 HRKKKRQWS
3613 KPKKAKQQQ
3614 HKKKMGRGH
3615 KKKTRKVQE
3616 NKKHKKRGM
3617 KKKSKITNH
3618 LCKKKKRFQ
3619 KAKRQRWRP
3620 QYKKKKRVS
3621 TKKRRRRMT
3622 KARKLKIQG
3623 KTHRKKKFM
3624 TKRKKKIGP
3625 SKKRNKVCT
3626 KSKFHKQKA
3627 KKLKAKVCM
3628 KLRKKRTRG
3629 HKKRRKSHH
3630 RKKKRYKIV
3631 KKKNKLHVQ
3632 KSKWVKKWH
3633 RKRKKARTP
3634 KKKSKHMQA
3635 KRKRAKVNC
3636 NWKKKKVCT
3637 IKKKKKHND
3638 KHKMKKHVG
3639 KKKKMHPCT
3640 KVKGRKIFK
3641 KKKKLKSWF
3642 NRKRRRKKM
3643 KAKRPKSKA
3644 KKARKKFVA
3645 KKRKIPRKG
3646 GRKKFKIKN
3647 KVKVKKGYW
3648 KVRKEKTKH
3649 MKKKKRLLV
3650 KHRKSKTRT
3651 YKKRRKRWA
3652 KKRGKKFSP
3653 KLKKRGKGG
3654 ATKRKKKAL
3655 KKKKAHATY
3656 KHKKKHYHN
3657 HRKRTRYGC
3658 KMKRKKSNQ
3659 KRKRQKQYQ
3660 AHKKKKHLT
3661 KSRKSKGKG
3662 QTKRRKKGC
3663 KGKKFKKGV
3664 KAKQKWVKF
3665 RVKRCRRCA
3666 RAKRPRRQW
3667 KQKKKQYPQ
3668 KVKRWRGQQ
3669 CKRRRKRYI
3670 KKKYRKRRG
3671 KRRKKGNAT
3672 SKKRLKSHG
3673 KKKRKSHNS
3674 KKKDQKACV
3675 LRKKKKQTG
3676 TRKRKKKVK
3677 VKKKQKSHE
3678 KKKKFKNVE
3679 RAKQKKKQS
3680 KMRKSKVCP
3681 ARKRKKSCC
3682 MKHKKKWCH
3683 QHKKKKRYA
3684 KRKMIKKCM
3685 KKMKKRQTG
3686 KNKKKKKMC
3687 KCKRKRRRG
3688 AKKKRKVIM
3689 HRRKQRRYQ
3690 KKRKQKRGM
3691 KKARKTKSH
3692 KKRKFNRAA
3693 KRKKSRSYG
3694 MKKVKKKTG
3695 KGRRQKRAA
3696 KNKKKREAT
3697 YKKMKRKQV
3698 KRKKKPNDQ
3699 NKRKKRGGP
3700 TARKKKCKM
3701 STKRKKKGN
3702 HKKRGRSMH
3703 KKRKYHCDW
3704 KCKSKKKIA
3705 YKRKWKHCE
3706 TIKKFKRKH
3707 RAKRKRKNM
3708 AKKRKKDWS
3709 KARKARRFF
3710 KKKKHLSNM
3711 KKKALKRPM
3712 KGKRQKKQE
3713 CHKNFKKKG
3714 KKKTNKCTN
3715 RTKKRKCFA
3716 RIRKRKQRQ
3717 KKRIMKKSH
3718 APRKKKEKG
3719 KTKKFKWRV
3720 QKRKEKKCC
3721 LKKRKRVAA
3722 RVKRKRYWQ
3723 CKKLWKKHH
3724 KKKWIRRKD
3725 KLRKMKKTP
3726 RKKKKAWAT
3727 KVKKWGWKT
3728 IKKKIKIAG
3729 RVKRARHYS
3730 KKRRCQRGQ
3731 KKKKWWQCA
3732 KAKFTKKYQ
3733 RRKKAKHCS
3734 KRKKYKWQL
3735 TKAKKKAPV
3736 IRRKKKNGS
3737 HKKRKRCNN
3738 QSKRKKRKW
3739 RHRKKRQYP
3740 KQRKKKTAN
3741 KARAKKLKA
3742 KKRRYRHEY
3743 KRKRRHHTH
3744 KKKGYKCMW
3745 KVKKAKQIF
3746 KKKVKMHIG
3747 VYKNKKVKS
3748 KKHKTKAHH
3749 MAKKKKWQI
3750 RKRKIRRNC
3751 KKKKCRLQW
3752 KKKRNKAWW
3753 KKKRKDRAY
3754 CKKTKKYFT
3755 MKKKQKNTY
3756 KKKGKGINS
3757 CKKGRKKWM
3758 KKRRYKCAH
3759 QAKKKKKQG
3760 KKKRKARMD
3761 RMKRRRHSS
3762 TNKPKKCKG
3763 PKKRKFVKG
3764 KKRKGTGGW
3765 NKKVQKKPC
3766 TGKKKKWQP
3767 QGKKKKVNG
3768 KYRKWKRTM
3769 KRRRARQSS
3770 KSKKNSYKN
3771 KSKVTKTKG
3772 KSRKRRTQW
3773 KKKQNKWKW
3774 KNKFTKMKS
3775 MKKMKKCSG
3776 KMKRKKGQS
3777 KKLRKKSCG
3778 KFKKKHIME
3779 KVKWNKKCT
3780 KAKKKVRLC
3781 KKKHTTSKG
3782 HKKRRARAH
3783 NKKRKRGHY
3784 KKKKRFHFN
3785 KCKRKHVAS
3786 HKKKVKSHN
3787 VVKWKKCKT
3788 KSKNKKGCN
3789 KCKKKQNHV
3790 KGKRKRKHS
3791 KIRKHKKDN
3792 NKRKRKYKG
3793 KVKWKQKVG
3794 KMKHKKHSA
3795 AKKAQKQKQ
3796 KKKAKSYDN
3797 KSKTFKYGG
3798 KTKPKKCGG
3799 KAKRKTFVS
3800 KVRKKRQHA
3801 KTRKYKIYQ
3802 KKKKSMRHR
3803 QKKKKSCHG
3804 HKGKKKALG
3805 KVKMRKKNT
3806 KRKNKKSFW
3807 YVKRRKKKN
3808 KKKCKWGMM
3809 GKKGNKCKQ
3810 VKKKIKVST
3811 KWKRKCKGQ
3812 KKQKKRTYT
3813 KTRAKKKTT
3814 KKKKYHHDT
3815 WKKRKKAGF
3816 CCKTKKQKG
3817 KARRRKRYP
3818 KKKKTRVIE
3819 QQKAKKCKG
3820 KCKKKIRWT
3821 KKKLKRRAN
3822 VAKRRRKCC
3823 KQKKSKYTH
3824 KKKMRKREH
3825 KRKKKWKAH
3826 KRMKKKRAY
3827 SRKKKKKMS
3828 KKKQGRFKE
3829 GIRKKKKTT
3830 LVKPKKKAQ
3831 KIKGRKKHC
3832 KGKCKKTHH
3833 KLKKRKSVN
3834 KARKSKRAT
3835 KPRKKKGSE
3836 KRKRMRNMH
3837 HKRKKPPKE
3838 KKKSKYSGV
3839 RSRKKRRGM
3840 KRKRHKHQS
3841 HKRKGKSKW
3842 KKRKLKWFW
3843 KQKVKKENC
3844 GKKKGKRMN
3845 KHKKCIKCA
3846 KTRKRRAYC
3847 SKKTYKKAY
3848 TKKKGKQYH
3849 KIKMKKLQF
3850 KSRMKKLKT
3851 KKRRRWRYM
3852 SKKRVKSSG
3853 KNKRKKNHD
3854 MKHKKKQQN
3855 RTKKRRRQH
3856 KQKIKKMGF
3857 QSRKKKRNS
3858 KGKKRKQMH
3859 YNKKKKHSG
3860 KGKAKKRRH
3861 KKAKGKAYP
3862 MIKIKKKGT
3863 KKKKVYRYS
3864 KKKKTVPAW
3865 CFKKRKKGV
3866 KCKRTKKRN
3867 KVKCKKHSG
3868 KVKKMKSMW
3869 KVRRYKRLS
3870 NKQRKKKQC
3871 KAKTKRHKD
3872 KVKRMKMTA
3873 MKKKKVRYH
3874 KSKCKKGRA
3875 TCKWKKAKH
3876 KVKRVRKYW
3877 FKKKTKCMG
3878 KTKKKTTMF
3879 MRRKKKQVY
3880 KKKRKRRES
3881 RKKKKKAGD
3882 CGRKKKRCD
3883 KVKKRKMYM
3884 KKKRKKIGL
3885 HKKRRRYPY
3886 KKKKAHCSC
3887 KVRKTKACI
3888 SQKKKRVKH
3889 LMRKKKQVP
3890 KKKAKSTDC
3891 CRKKKKAHV
3892 KKKCRKHQY
3893 KARKKFKTN
3894 KGRKKRHPG
3895 KVKKSKHMM
3896 KRKQKFAKH
3897 KNRMKKKHC
3898 LCKSFKKKF
3899 KAKKRRQFH
3900 KLKRRRRHS
3901 EKKKKRRVC
3902 KASKKKRYH
3903 GIKKKKSVM
3904 TKKRKRVKM
3905 VCKKKKMKH
3906 HIKKKKGFG
3907 KKRQKKMCA
3908 CKKKMKTGW
3909 HKRRRFTGY
3910 KRRKHKKMM
3911 QCKKQKQKS
3912 IKRRKKCMH
3913 KNKAQKKPA
3914 KWKKMKLFM
3915 KRRRRARGW
3916 KVKGRKKYP
3917 NKKHKKCHS
3918 KKKRVGQVA
3919 KAKPKKNHC
3920 TMKRKKHQC
3921 KRKGVKKRQ
3922 KRKKMTKSL
3923 KKRRQKTVQ
3924 RVRRRKSTG
3925 ATKKKRKNM
3926 KKKFKNWTY
3927 RTKRYRWRC
3928 RTKAKKTKS
3929 KKKMGKKCN
3930 KAKRFKLYT
3931 KKKKCWMEQ
3932 KGKKNKMIY
3933 KKKRVSWSC
3934 RHKKKKDAH
3935 KKKWKASQC
3936 KSKKFKLSY
3937 KTRKVKWCM
3938 RKKKKRRSM
3939 RFKKKKRFA
3940 KFKKKCYAW
3941 KKKKSRTRH
3942 HKRKKSWHL
3943 KKKRNRRSA
3944 RKKRVRNSH
3945 CKRKKKHTL
3946 HKRKQRQRC
3947 AKKKKKHKP
3948 KWKMKKWMP
3949 RRKRRHSAT
3950 RIKRKRWSS
3951 HKKYCKKTS
3952 RVRRRKWCE
3953 KSKRCKFKQ
3954 KKKKMMCNH
3955 KVKKVRKYH
3956 KKKKVFKTH
3957 KTKKKSYDM
3958 KTKLKKMFS
3959 TKKTMKKAN
3960 ARKKKKKRG
3961 KWRKAKAKY
3962 KKRKQKSTH
3963 KRKRKITSD
3964 RAKRIRIRC
3965 KTKTLKTKF
3966 QARKKKRLG
3967 KTKKKLMGN
3968 IKKRRKLHP
3969 KKKKKFRCS
3970 KQKFGKKAG
3971 KKRKIVCGY
3972 KKRGKKKGH
3973 KKKGQKGYA
3974 LRRRKKNRY
3975 KVKKIKNRD
3976 KRKRFKNDK
3977 KRRKTNRQP
3978 KTKRYRFHN
3979 KARRKRCQC
3980 KTKKRRSSN
3981 QVKKKKRLM
3982 KVKRKKIGW
3983 RSRKRKSYV
3984 KRRKFKRSD
3985 MKMKKKRGH
3986 KKKKFIKSL
3987 KVKRRKRRM
3988 KVKKGQQKC
3989 VKKSVKKIC
3990 KKKAKHGWE
3991 KTKRKRAYW
3992 KKFKCKNSW
3993 RRKRFRFYS
3994 TRRKGKRCN
3995 KKKKMYHSS
3996 KVRKKKDHC
3997 SKKRYKRGS
3998 KNKKCKFSN
3999 HKRKSQHHA
4000 KVKKKRLSA
4001 KAKRKRRHN
4002 RAKKKKRAG
4003 KRRRQRRHH
4004 KTKKKAKCV
4005 KVKKYKAHY
4006 KLKKKRRYF
4007 RVKKKRQAE
4008 KNKKVVKHH
4009 KFKKMRKAT
4010 KKKKRSYMP
4011 KMKSKKCAG
4012 RKKKKQLGI
4013 KFRKRKIYS
4014 KIRKRRQHT
4015 KRKKKMRPA
4016 KAKKQKTTE
4017 SMKKFKKMS
4018 KKKVLKTVE
4019 KSKVKKHGW
4020 KQKKIIKCF
4021 KRKKNKMGP
4022 KSKKNKWQQ
4023 KKKRIQCHV
4024 KIKTKKKMA
4025 KRKRCVWRS
4026 KKRKKNTFS
4027 PKKKKRWTP
4028 VKKSKKQTN
4029 KKKAKHIEC
4030 KAKKNKGHY
4031 VKHRKKVKY
4032 KTKQKKHCC
4033 KTHKKKGSY
4034 IKKSKKAFG
4035 TRKIKKQKG
4036 KAKKMKMSW
4037 KKKRSLKIE
4038 KKKRKKTIY
4039 KAKHKKQIE
4040 CRKKKRRMW
4041 KKRRKGMGF
4042 KVRKAKVQQ
4043 CKKKKSVCF
4044 MAKRKKRRH
4045 MKHKKKNHV
4046 KSKKRKMTT
4047 KCKKNKHHP
4048 KKKRLRGRG
4049 IVKKGKHKS
4050 SKRKKKIVW
4051 KTKMRKKNA
4052 KKKYSKNTC
4053 AKKKKGMKW
4054 KSKKGKTSP
4055 MIKKIKKCG
4056 RFKRKKMKM
4057 HTRKMKTHF
4058 KTKKSKVAM
4059 GRKKRKKSD
4060 KRKCIKQKF
4061 KRKKGRKAE
4062 QQKKKKATW
4063 KRRKRGYST
4064 KMKRYRWHY
4065 CMKRKKKQP
4066 RKKKKWWST
4067 KKKKYQVFT
4068 KIKMYKKFN
4069 SKKKQKCLV
4070 RKRKKRRIY
4071 IKKRYKHLV
4072 KIKYSKKTG
4073 NAKRYRQHY
4074 KRRRIQRSM
4075 KVKKKGRSD
4076 RTKRNRKCQ
4077 KKRSKSKCS
4078 KCKNAKKVG
4079 HKRRCRHRY
4080 RHKKKKEHC
4081 HKKTKKNSS
4082 KCKKRKFMP
4083 KNKRVKKMG
4084 MKRRKKKWI
4085 NKKNKKVNN
4086 AVKRKRRMQ
4087 KKKRQRGWF
4088 KSKTKSKVC
4089 KVKHVKKQS
4090 NNKKRKKFQ
4091 IKKMKKARM
4092 KVKLKKICH
4093 KFHKKKQSW
4094 KCKKWKIMM
4095 KGKSGKTKM
4096 VRRRKKRWA
4097 KKKAKNYTY
4098 HKKRKPTVY
4099 KVRKRRYCA
4100 KKKRRRNAW
4101 KSKSKKMFR
4102 KKKRKVYGM
4103 SRRRKKNKH
4104 RKRKKRYHM
4105 KPKRKSCKH
4106 KTKRRKSMC
4107 AKKKFKYNN
4108 RRKRIKSSQ
4109 KKKGRRKNR
4110 KAKGFKKMD
4111 RRKKAKHVH
4112 YKKRKKCGM
4113 KARRMKRQK
4114 SAKKKKWDS
4115 VHKKKKSCW
4116 QVKVKKKCL
4117 KAKRFRWRS
4118 KKKIYKLHN
4119 KKHMKKSQV
4120 RRRRKKFTP
4121 KKKWIKGWG
4122 QAKKKKVHA
4123 QKKKMRKFS
4124 KKRCKKCSS
4125 KRHRAKKKH
4126 MAKRYRWWS
4127 KKKYFKKVY
4128 KKKKKPRSG
4129 RQKKRKAGS
4130 KRKRRIGRT
4131 KSKKKIRAS
4132 KRRKMRQVS
4133 LVKKSKKNG
4134 RKKKKMGWN
4135 KAKVHKKRN
4136 KKRLCKWKV
4137 KSRKMKFMC
4138 GGRRKKRYY
4139 LKKKTGRKP
4140 KAKRCKRWY
4141 LYKKRKKCI
4142 KAKAFKSSQ
4143 SKRKNKSCT
4144 KOKKKGDAR
4145 ILKRKKKSL
4146 KVKKKQVNG
4147 HRRRTKRFQ
4148 KVKKKTVGP
4149 KALKKKGWG
4150 SKKRKKQKH
4151 KVKPKKHLA
4152 KKKSIKVVP
4153 KKRRAKNCP
4154 KTRKGKKHG
4155 ISRKKKQAG
4156 KAKKKRNQA
4157 VKKRKRVWT
4158 QKKRQRYPS
4159 KKKGVKNRS
4160 KRRKIKKGG
4161 KRKRPRQSC
4162 RKRKRIGGT
4163 KKKRSRRSC
4164 RKKKRCKSS
4165 KTKKPKQHP
4166 HKKKKCNWC
4167 KQRKIKRYP
4168 KTKKKQRAN
4169 KSKNKTTKC
4170 RFKRKKFIS
4171 KKKMKSRHP
4172 KCKSKRHHK
4173 KRKTKKHPQ
4174 KSRKTKYCK
4175 RTKRSRSNY
4176 KRARKKAKC
4177 AAKRKKKCC
4178 KKKRYRRYW
4179 TKKRYKRMY
4180 KKRRIRNYG
4181 KRKKNLKAN
4182 VLKHKKKSC
4183 KTCKKKWMG
4184 KRRKLRRGG
4185 KNKKKHWRP
4186 KSRKTKTGW
4187 KKSRKRKQF
4188 HKKGFKKWY
4189 KAKRKKWLH
4190 KKKRFVMRG
4191 KTKKQRKAV
4192 KGKKSKQGG
4193 RKKQQKNKA
4194 KFRKKHTLP
4195 RKKRYRWCQ
4196 HKKKKHFYA
4197 VKKRNRRTM
4198 RKKKMKGAG
4199 KKKSMARKW
4200 KTKKTKAWG
4201 KTRRKKHTD
4202 LKRKKPKCQ
4203 QVKGKKAKP
4204 IKKRRRFGP
4205 NGKHKKKCF
4206 KMKACKKAG
4207 KKKRNKIYS
4208 KKKKGNYLT
4209 KKKQYKSWV
4210 KFKKMKRKM
4211 KQKRSKAYC
4212 KGKKRGRQM
4213 KKKKHWFVA
4214 KARWKKRHG
4215 RKKRKRRNN
4216 KKCKKKVPA
4217 VTKKKKVRT
4218 SVRKKKKAA
4219 AKKHMKKVG
4220 TKKKKRYHN
4221 KWRKFKCYH
4222 HKRKRHMNP
4223 RKKTKKAFT
4224 IQKKKKCWL
4225 KYRKYKTSS
4226 KSKRYKTCC
4227 VKKKSKVTS
4228 KSKRKGHNK
4229 RKKMKRQKE
4230 KNKRKAKWP
4231 KRKKRGSWG
4232 KARRVRRYY
4233 QKKKVKKCW
4234 VRKRQRQCT
4235 RKRKWKCHC
4236 KVKKKAVVY
4237 KVKKVKISP
4238 KKKKHQPVA
4239 KRRRKTGSQ
4240 QNKKKKAYI
4241 AKKKCKKWT
4242 TKKRRKSPS
4243 KCKRRKKAG
4244 KNKRRKKLY
4245 KVKASKRKC
4246 KKKRFSQVF
4247 KGKWKKFIG
4248 HIRKKKYGN
4249 KLKWKKMWC
4250 KRRKNRYWA
4251 HKKKIKRCD
4252 KCKKKSTYS
4253 KKFKVKHIC
4254 QKKVMKKCG
4255 HKRKICGHH
4256 KVKKKRCRK
4257 KTRKKNHGT
4258 KKQKKRSQN
4259 KKARRKRYH
4260 KSKKHKHDH
4261 KSKDKKQWQ
4262 AKKRKRVAW
4263 SPKKKKWRT
4264 KFKKTKWKF
4265 KRKVKKLMF
4266 KFRKVKTAT
4267 YKKMKKCAY
4268 RKKKDRRKC
4269 HKRRRKTPP
4270 KAKKKNFVI
4271 GKKHTKGKQ
4272 KMKSKKMQQ
4273 RAKRYKKTA
4274 NCKRKKGNK
4275 KKKHMKIGN
4276 KYKFKKWST
4277 KSKRYRMMV
4278 KKKKAKMDG
4279 TNKKKKKAV
4280 KLKKFKRDW
4281 KQKRRRRCM
4282 KKKWLKNIY
4283 KVKMKKIWA
4284 KKKSSKSFC
4285 KKRKHINKA
4286 KRKRKRRCH
4287 YKKKMKWML
4288 AKKGKKQMT
4289 CKKFQKKFA
4290 NKRRIKHRQ
4291 IKKRRKTQN
4292 RKKQKKRTS
4293 RSKRRKACG
4294 YGRKKKQCK
4295 RTKKKKVCS
4296 KAKTKGYKN
4297 KSKKKRNQQ
4298 KLKRTRRSW
4299 RTRKVKHKC
4300 KVKRYRNHW
4301 QRRRNKRQQ
4302 KKRRYHSWA
4303 KKKSKKNSA
4304 KVKWKKDQG
4305 VKKGMKKQY
4306 KVRRKRRPS
4307 YVRKKKFGG
4308 KVKKKRIQF
4309 MKGKKKCAG
4310 KKKWVKTFW
4311 NKKHRKKGH
4312 KKKRHQVVK
4313 MWKRKKVKC
4314 KGRRKRSAM
4315 KCRKKQAKN
4316 KKRKHARVH
4317 KLKVKKVGS
4318 KCKRQKRCA
4319 HIKFKKKQC
4320 AKKNKKWFT
4321 KQKIVKKWM
4322 KTKRIRHHQ
4323 KIRKKRRRL
4324 GFKKKKKQQ
4325 RKKRGKCYG
4326 KVKKRKTNG
4327 KKKRRSNLS
4328 KRKSGKNKS
4329 KKRKTHATK
4330 KCKKRGRTK
4331 QKKCKKRAI
4332 QKKFRKKQQ
4333 KQKRIKKLG
4334 KKKLKGWHV
4335 KKKKMYFSY
4336 KTKKVKYWN
4337 RKKFLKRKG
4338 IKKRKKTQW
4339 KFKPKKAYA
4340 KKRKRSAKS
4341 LAKPKKKAN
4342 KVKRKSNKT
4343 KKKCKLAMF
4344 KKKANKHMD
4345 KTRKRRLYA
4346 RKRRHKGRP
4347 RKKKKQASY
4348 KKKKTRHKS
4349 HKKIKKYVS
4350 KKKLGKCRW
4351 QKRKIRRMA
4352 RHKKKRHCQ
4353 KKKKGKGIA
4354 KKKKYWMIH
4355 KKKRPKATT
4356 KGKKKSVYP
4357 KSKKKRRFD
4358 MIKKVKTKG
4359 KSKKKAQMH
4360 CKKYKKYNY
4361 KKRRTRHSF
4362 KHKAMKFKN
4363 HKRKKKLGV
4364 KVRRKKNAP
4365 KKKITKRGA
4366 MKKKKKVCC
4367 KVRKRKKCA
4368 KFKRKNCKQ
4369 SVKKKKNVS
4370 GPKKKKWSS
4371 RKKRHGKGC
4372 KVKMCKQKW
4373 HKRKGHWVQ
4374 KFKKKINFW
4375 RKKRGRKES
4376 TKKRKPKGS
4377 HKKRNRFCT
4378 KRKCKAKGN
4379 KTRKSKKDR
4380 KIKRKRKHM
4381 TKRRHKRQV
4382 KKKTCKLGH
4383 KKKKAQRHT
4384 KKKCKRKYA
4385 HKKNIKKHW
4386 EKKRKKWYS
4387 KKKHCKLHW
4388 KLKSKKRGR
4389 STKRRRRAS
4390 KRKKSMMKT
4391 AKKKIKKVG
4392 KRKRWKKLF
4393 KVKKSKAHM
4394 KKRRWRHHH
4395 RSRKVKRHY
4396 KKKKTLHTN
4397 CKKKRKQHC
4398 TKKTKKQQP
4399 KKKRLKHSD
4400 MARKKKSRT
4401 NKKPRKVKW
4402 VKKRKRNHV
4403 KVKKMKWKR
4404 KKRKNKEFI
4405 KKKGKRHRG
4406 LAKHKKHKH
4407 KQKKMKRQD
4408 KAKWKKWSW
4409 LKRKKRKDC
4410 KKRKWHYYG
4411 KAKKKHSRV
4412 KQKKKRRTT
4413 KKKCKNSGT
4414 QKRKRKLSE
4415 CKKLKKTGY
4416 RKKKPKMQM
4417 RRRRSKSKA
4418 HKKSWKKYP
4419 KKKWKVVNW
4420 KKKVQKMHP
4421 KKRKKGSWA
4422 KIRRYKRQA
4423 KKFKKKSAN
4424 SKRKKRKWG
4425 MSRKKKRST
4426 KKRRHGRWY
4427 KKKKSSTGP
4428 KVRKTKIGE
4429 KKRRTCRHQ
4430 KKRKGIRGT
4431 HKRKKHNQM
4432 RKKRHKGNQ
4433 LCKKKKRTC
4434 LKKPKKTCN
4435 KIKHKKWLV
4436 KKKKKIQMQ
4437 KVKRKQQLC
4438 RCRKRKSIC
4439 SKKRRRRMS
4440 ICKKKRLKG
4441 KLRKFKGKY
4442 KLKRKKNVQ
4443 RMKKKRQIM
4444 KKRRQKVKH
4445 KKKSKKMFE
4446 HRKRVRVRF
4447 KMKKKRCPA
4448 SARKKKWCC
4449 HKKRKQTGT
4450 KKKACKKSA
4451 KIKKTRKNH
4452 VKKKLKTGA
4453 KFKARKHKT
4454 KHKSHKKQL
4455 RKNKKKHNA
4456 CRKKKKIKC
4457 HHKRQRAHH
4458 CVRKKKQVG
4459 SFKWKKKQY
4460 HGKQKKKCC
4461 KARRMKNWS
4462 KKKRFGRQK
4463 KNKKMKKAA
4464 KTKVKKVAH
4465 KKKNYKSSY
4466 QKKGRKKNL
4467 TRRKKRRPC
4468 KGKVSKKQS
4469 RNRKKKWCC
4470 KKKKRKNHR
4471 LHKKKKGNW
4472 HTKKKKFAP
4473 NKKKFKTVQ
4474 KFRKKRWVP
4475 KKKKQNHGC
4476 VNKKKKHAA
4477 SMKKKRKAS
4478 SKKKQKARP
4479 TGKKKKHYW
4480 YCKKWKIKN
4481 TKRKKKQFH
4482 KKQKKHRMP
4483 KTRNKKPKC
4484 HAKGKKKCM
4485 KKKKCPHAQ
4486 KKKRVKDKQ
4487 KKKTQRHHN
4488 KKKWWKKSQ
4489 KVKRKGHCQ
4490 KVKRSKHCQ
4491 KIRKKKDMQ
4492 KKKIRKNFY
4493 SKRKYKKTG
4494 KKKPKHVCA
4495 KRRKHIRRH
4496 CRKKTKQKV
4497 RARKKKCFF
4498 IKKCKKRVM
4499 HKKRNRKSK
4500 KKRFKKAFG
4501 CIKKKKYMN
4502 KRKKQYKVC
4503 KMKTYKIKQ
4504 KHQKKKRSG
4505 YKKMKKAMI
4506 KAKKKKKKF
4507 HVKKKKWNG
4508 KKRCKKHGS
4509 YKKKTKYSS
4510 KKRRYRHAG

In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 75% sequence identity to any one of SEQ ID NO: 3576-SEQ ID NO: 4510. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 77.7% sequence identity to any one of SEQ ID NO: 3576-SEQ ID NO: 4510. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 3576-SEQ ID NO: 4510. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 88.8% sequence identity to any one of SEQ ID NO: 3576-SEQ ID NO: 4510. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having a sequence of any one of SEQ ID NO: 3576-SEQ ID NO: 4510. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two amino acid substitutions relative to any one of SEQ ID NO: 3576-SEQ ID NO: 4510. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two conservative amino acid substitutions relative to any one of SEQ ID NO: 3576-SEQ ID NO: 4510.

TABLE 8 provides additional 581 to 589 region sequences predicted to confer retina tissue tropism or preference, generated and selected using machine learning.

TABLE 8
Additional Exemplary 581 to 589 Region
Sequences for Retinal Targeting
SEQ ID NO 581 to 589 Region
4511      KHKKKGGPQ
4512      RKQKKKAWC
4513      KKRKRAPKI

In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 75% sequence identity to any one of SEQ ID NO: 4511-SEQ ID NO: 4513. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 77.7% sequence identity to any one of SEQ ID NO: 4511-SEQ ID NO: 4513. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 4511-SEQ ID NO: 4513. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 88.8% sequence identity to any one of SEQ ID NO: 4511-SEQ ID NO: 4513. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having a sequence of any one of SEQ ID NO: 4511-SEQ ID NO: 4513. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two amino acid substitutions relative to any one of SEQ ID NO: 4511-SEQ ID NO: 4513. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two conservative amino acid substitutions relative to any one of SEQ ID NO: 4511-SEQ ID NO: 4513.

Features for Retina Tissue-Tropic AAV VP Capsid Polypeptides. The present disclosure provides features of 581 to 589 region sequences that enhance retina tissue tropism or preference, as determined from a primary screen. In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains one or more basic amino acid residues (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains two or more basic amino acid residues (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains three or more basic amino acid residues (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains four or more basic amino acid residues (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains one basic amino acid residue (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains two basic amino acid residues (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains three basic amino acid residues (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains four basic amino acid residues (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains five basic amino acid residues (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains six basic amino acid residues (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains seven basic amino acid residues (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains eight basic amino acid residues (e.g., K, R, or H). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains nine basic amino acid residues (e.g., K, R, or H).

In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains no more than three acidic amino acid residues (e.g., D or E). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains no more than two acidic amino acid residues (e.g., D or E). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains no more than one acidic amino acid residues (e.g., D or E). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains no acidic amino acid residues (e.g., D or E). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains one acidic amino acid residue (e.g., D or E). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains two acidic amino acid residues (e.g., D or E). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains three acidic amino acid residues (e.g., D or E).

In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains more basic amino acid residues (e.g., K, R, or H) than acidic amino acid residues (e.g., D or E). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains one or more basic amino acid residues (e.g., K, R, or H) and no acidic amino acid residues (e.g., D or E). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains two or more basic amino acid residues (e.g., K, R, or H) and no more than one acidic amino acid residue (e.g., D or E). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains two or more basic amino acid residues (e.g., K, R, or H) and no acidic amino acid residues (e.g., D or E). In some embodiments, a 581 to 589 region with retina tissue tropism or preference contains three or more basic amino acid residues (e.g., K, R, or H) and no more than two acidic amino acid residues (e.g., D or E).

In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 (X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹, wherein X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, and X⁹ are each independently any amino acid) comprises K, R, or H at position X³. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises K or R at position X³. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises K at position X³. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises R at position X³. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises K, R, or H at position X⁶. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises K or R at position X⁶. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises K at position X⁶. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises R at position X⁶. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises K, R, or H at position X¹. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises K or R at position X¹. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises K at position X¹. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises R at position X¹. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises K, R, or H at position X⁴. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises K or R at position X⁴. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises K at position X⁴. In some embodiments, a 581 to 589 region having a sequence of SEQ ID NO: 5014 comprises R at position X⁴.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X¹ of SEQ ID NO: 5014 is K or R. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2343, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, or 1555.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X² of SEQ ID NO: 5014 is K or R. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 752, 2144, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 285, 1626, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 3646, 4059, 1431, 1331, 310, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 1959, 1840, 3736, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 2382, 3675, 1833, 3974, 419, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 3879, 2698, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 1019, 2012, 1803, 3642, 497, 1322, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 1675, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1050, 3515, 2219, 1433, 1323, 4301, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2324, 605, 1368, 3827, 4103, 606, 607, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 4879, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 3815, 2005, 1964, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, or 2250.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X³ of SEQ ID NO: 5014 is K or R. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 4177, 1289, 740, 741, 18, 745, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 23, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 34, 35, 36, 37, 38, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 45, 756, 46, 48, 1952, 758, 49, 3122, 2551, 3718, 3484, 3577, 759, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 760, 53, 3925, 55, 3654, 56, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 63, 64, 768, 771, 65, 66, 67, 68, 3816, 2599, 2706, 74, 3865, 1549, 1361, 3882, 3713, 1942, 1312, 4501, 76, 77, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 82, 4065, 83, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 90, 91, 779, 1180, 92, 785, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 794, 795, 104, 105, 106, 1849, 108, 1579, 110, 1906, 113, 1444, 1344, 116, 802, 117, 118, 121, 803, 804, 1463, 805, 122, 124, 125, 127, 807, 132, 809, 810, 133, 1978, 812, 135, 136, 137, 138, 813, 140, 815, 1326, 141, 142, 143, 144, 145, 1634, 1302, 817, 146, 818, 147, 148, 149, 151, 152, 153, 154, 155, 819, 820, 157, 159, 160, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 826, 827, 181, 828, 182, 829, 184, 185, 186, 187, 188, 189, 830, 191, 192, 193, 194, 195, 196, 1391, 197, 200, 201, 202, 203, 204, 205, 832, 833, 206, 834, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 215, 1896, 1522, 3490, 838, 217, 218, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 226, 227, 230, 231, 842, 232, 233, 844, 236, 237, 851, 852, 853, 1536, 240, 854, 242, 243, 244, 245, 246, 247, 249, 250, 251, 252, 253, 254, 255, 857, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 264, 1241, 265, 266, 866, 1477, 267, 867, 869, 870, 271, 871, 872, 272, 1252, 273, 1591, 275, 1980, 276, 876, 877, 277, 278, 279, 1892, 1539, 880, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 282, 1799, 283, 1626, 1374, 287, 1620, 1290, 1354, 888, 291, 1956, 889, 292, 4324, 293, 4138, 891, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1515, 1617, 1961, 304, 306, 1589, 4370, 308, 309, 894, 3646, 4059, 1431, 1331, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 898, 321, 322, 899, 1958, 901, 325, 902, 326, 1491, 329, 330, 905, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 1762, 4472, 1472, 1529, 4057, 1976, 4507, 1583, 338, 911, 1711, 340, 912, 2013, 341, 4440, 917, 344, 918, 919, 921, 922, 347, 351, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 925, 1782, 926, 927, 3610, 357, 359, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 1211, 1873, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 1359, 1734, 3650, 1910, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 390, 391, 4406, 4341, 1480, 395, 1714, 1422, 396, 397, 3618, 4433, 1177, 3898, 398, 949, 950, 399, 951, 400, 1965, 4471, 952, 402, 2475, 403, 404, 4139, 1482, 3602, 4434, 3721, 1592, 1519, 1352, 4202, 4409, 1977, 1917, 407, 408, 1631, 1684, 409, 3889, 958, 959, 412, 960, 414, 415, 961, 1905, 416, 963, 417, 3675, 1833, 3974, 420, 421, 965, 966, 969, 970, 422, 1897, 423, 4133, 3830, 972, 424, 973, 427, 1708, 4141, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 434, 1606, 979, 2604, 2895, 436, 3448, 1692, 983, 3862, 4055, 4358, 984, 985, 1664, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 987, 988, 990, 451, 452, 991, 992, 1728, 994, 995, 454, 1696, 3116, 1869, 456, 1386, 999, 3879, 2698, 1001, 461, 1447, 462, 464, 4425, 1645, 1231, 1468, 472, 473, 476, 1273, 1007, 1744, 1488, 1659, 477, 1604, 481, 4313, 482, 483, 1499, 484, 1016, 4073, 1777, 1458, 4274, 487, 1775, 4205, 1526, 1697, 1017, 2000, 489, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 491, 1948, 3699, 1735, 3792, 4290, 495, 4090, 496, 2012, 1803, 3642, 1322, 498, 1021, 1022, 502, 1333, 503, 1023, 1890, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1029, 1366, 2112, 1261, 4027, 3478, 3763, 2959, 517, 3197, 1595, 3413, 1448, 518, 1675, 1797, 520, 1999, 3759, 1215, 4122, 1730, 524, 526, 3966, 3911, 529, 3289, 1821, 530, 531, 1874, 1038, 536, 537, 3767, 1929, 1041, 1042, 3683, 542, 1338, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 546, 4240, 3580, 1046, 1047, 550, 2598, 551, 552, 3819, 1259, 4062, 2841, 1050, 3515, 4301, 1052, 1053, 3738, 1567, 1270, 3857, 1055, 1257, 1238, 3662, 561, 562, 1058, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 572, 1912, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1451, 1654, 3934, 4080, 4352, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 1950, 1963, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 1559, 1250, 1555, 4114, 1818, 1075, 1076, 1077, 1704, 4448, 1078, 1079, 1786, 585, 3354, 1832, 3432, 2891, 2505, 1903, 1081, 1082, 4459, 1083, 1563, 590, 591, 1085, 594, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 600, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1087, 1088, 3888, 1368, 3827, 4103, 606, 1090, 1571, 1091, 1438, 1092, 1093, 612, 1094, 3701, 4389, 613, 1603, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1100, 1702, 1101, 1667, 1384, 623, 3700, 1788, 1600, 624, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4860, 2557, 2795, 2906, 3118, 1614, 1947, 4479, 3766, 632, 1104, 1105, 633, 1813, 636, 3706, 1110, 640, 1111, 641, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 1114, 1766, 3221, 2643, 2739, 3920, 644, 1116, 645, 646, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2369, 2695, 3293, 650, 651, 1120, 652, 1121, 3264, 655, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3994, 1319, 4467, 1802, 1227, 1623, 662, 663, 664, 1124, 1125, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 1135, 672, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 679, 1142, 1143, 681, 1145, 682, 685, 3822, 689, 690, 691, 1147, 1601, 3905, 694, 695, 1414, 1150, 1795, 1372, 1695, 1866, 4115, 1719, 698, 1920, 699, 700, 1544, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1854, 1902, 1510, 4182, 706, 707, 708, 4476, 1245, 714, 1841, 4234, 1314, 4096, 717, 1155, 4217, 1156, 723, 1157, 1627, 725, 1159, 1953, 1160, 1201, 727, 3787, 3747, 730, 1846, 3815, 2005, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 734, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1628, 3705, 1195, 3859, 1164, 1165, 1166, 1745, 1973, 1168, 3807, 4307, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X⁴ of SEQ ID NO: 5014 is K or R. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 739, 4177, 1289, 15, 743, 3477, 3051, 2982, 2877, 746, 3036, 3426, 3073, 3169, 3362, 2784, 3192, 1638, 25, 1703, 1836, 3660, 30, 32, 752, 1653, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 2633, 757, 1952, 3122, 2551, 3718, 2216, 3484, 3577, 1308, 1230, 3960, 2994, 3080, 2589, 3681, 51, 761, 3925, 3654, 763, 764, 57, 4086, 1740, 767, 772, 2599, 2706, 70, 3865, 1549, 1361, 3882, 1942, 1312, 4501, 1413, 3593, 4043, 1806, 3908, 4397, 1615, 2006, 3945, 2854, 3523, 3669, 1356, 777, 4065, 84, 1484, 778, 87, 3891, 4456, 4040, 4496, 2001, 1478, 1189, 1490, 1885, 2270, 1180, 786, 4458, 1970, 1590, 98, 1298, 101, 1688, 794, 107, 1849, 797, 1579, 111, 112, 113, 1444, 801, 114, 115, 119, 120, 122, 1760, 123, 124, 806, 125, 126, 127, 128, 129, 130, 134, 811, 814, 139, 1326, 144, 816, 1302, 150, 152, 821, 160, 161, 162, 1651, 1483, 179, 180, 183, 185, 187, 1391, 198, 199, 831, 204, 833, 207, 3901, 3312, 2649, 1301, 4386, 3028, 1896, 1522, 3490, 216, 218, 1612, 225, 228, 229, 234, 239, 849, 850, 1536, 241, 246, 248, 855, 249, 252, 253, 261, 4966, 864, 263, 4749, 2296, 1241, 866, 268, 868, 269, 270, 873, 874, 1252, 273, 1591, 274, 1980, 878, 1539, 3601, 3877, 1930, 1420, 1678, 1460, 1799, 1374, 1290, 1354, 290, 2391, 4324, 294, 4138, 3903, 892, 3829, 298, 3844, 1436, 300, 1515, 1617, 1961, 303, 1589, 893, 4370, 3646, 4059, 1331, 1558, 1552, 320, 1958, 1491, 1635, 332, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 2785, 3249, 3527, 3352, 2569, 4457, 2011, 3906, 1533, 1755, 1888, 4248, 1557, 3804, 1363, 1934, 1602, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 1852, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 2662, 2875, 3223, 2878, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 4472, 1472, 4057, 4507, 1711, 913, 916, 1594, 4440, 343, 918, 345, 348, 350, 1518, 3728, 3637, 3570, 3429, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 355, 1782, 928, 3610, 358, 4224, 1918, 1959, 1840, 3736, 4155, 1543, 4049, 1633, 1495, 372, 1873, 1726, 1748, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 4149, 1313, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 3979, 4461, 4113, 3817, 4232, 3902, 1857, 1904, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 3785, 3687, 4318, 4243, 3866, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 3296, 375, 1395, 1584, 4093, 3940, 3778, 4374, 4210, 4009, 4264, 4368, 1610, 4194, 4474, 4013, 4266, 1759, 1922, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3790, 3712, 1969, 934, 1790, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 3845, 4511, 3656, 1406, 1596, 4504, 1359, 1734, 3650, 1305, 1208, 1988, 4451, 1282, 4380, 1658, 1452, 1687, 3791, 4491, 4323, 4014, 1304, 1440, 4422, 3861, 1383, 3644, 3691, 4259, 1749, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 1297, 1586, 1251, 1299, 1954, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 3627, 3777, 1371, 3685, 1325, 1940, 4482, 4258, 3812, 1581, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1666, 1407, 4187, 1188, 1724, 1646, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 2561, 4442, 3900, 4298, 1203, 4441, 3628, 3725, 937, 4447, 3776, 3658, 4064, 1324, 1367, 3594, 3680, 1300, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 1546, 3613, 3273, 3452, 3525, 4105, 3835, 1263, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 4333, 3146, 4281, 4211, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 1471, 4176, 1232, 1989, 4125, 1741, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 3826, 1473, 1883, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1410, 1823, 1498, 1329, 386, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 3953, 4228, 4226, 4277, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 1859, 4183, 1408, 1403, 941, 4033, 3623, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 4322, 3991, 4106, 1641, 1570, 3978, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 4201, 1898, 1845, 1226, 1220, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1884, 1682, 4364, 4306, 3869, 3600, 3914, 1968, 1670, 3811, 1865, 3961, 1506, 4221, 1376, 1379, 3768, 4225, 945, 394, 1714, 1422, 3618, 4433, 1965, 4471, 954, 4139, 1482, 3721, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 3889, 413, 962, 418, 3675, 3974, 964, 420, 967, 968, 1897, 1272, 4133, 425, 4141, 430, 3749, 4044, 3590, 1944, 4126, 977, 4400, 1606, 980, 2604, 2895, 3448, 4563, 1692, 4055, 4358, 1664, 4309, 4045, 3854, 3682, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3985, 3535, 1306, 4084, 3282, 447, 1353, 1780, 449, 1485, 453, 1728, 454, 1696, 455, 3116, 1869, 457, 1386, 3879, 2698, 459, 1447, 4425, 1645, 467, 1488, 478, 1604, 1011, 4313, 4073, 4274, 1775, 2000, 2480, 1882, 1817, 1880, 1800, 4473, 3783, 3870, 1948, 3699, 1735, 3792, 4290, 492, 4090, 1019, 1803, 3642, 497, 500, 1333, 1890, 1024, 3608, 1864, 1531, 3636, 1699, 1028, 1366, 1030, 4027, 3478, 3763, 2959, 1293, 517, 3197, 1595, 3413, 2238, 1031, 1448, 1032, 1675, 1797, 3759, 1215, 4122, 3966, 528, 3911, 3289, 1821, 1874, 1037, 536, 1039, 3767, 3683, 540, 541, 1338, 1616, 1901, 1517, 2719, 3803, 4123, 4233, 3129, 3087, 3505, 4158, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 543, 4240, 3580, 2598, 4062, 2841, 1049, 3515, 1433, 1323, 4301, 1051, 3738, 1270, 3857, 1056, 3662, 1057, 3981, 1063, 568, 570, 3620, 1064, 4002, 3964, 3707, 3666, 1348, 4273, 4497, 1401, 4438, 1895, 1912, 3939, 4170, 4056, 1221, 1654, 1067, 3934, 4080, 4352, 574, 3739, 1565, 3950, 1397, 3716, 1569, 1465, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 4455, 4512, 3750, 3633, 4070, 4104, 4162, 4235, 4346, 1572, 4443, 3761, 1346, 3592, 1891, 4469, 1275, 577, 1963, 4129, 1296, 1360, 3733, 4111, 3993, 4108, 3949, 1556, 1435, 1424, 1830, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 4293, 1827, 3839, 3983, 4395, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1650, 4299, 1773, 2004, 1267, 1364, 4007, 3729, 3665, 3722, 1712, 1751, 3924, 3952, 1343, 4114, 1704, 4448, 1786, 3354, 586, 3432, 2891, 587, 1903, 2077, 1080, 1563, 2274, 595, 2559, 2590, 2738, 4478, 4069, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 4017, 4477, 1794, 4263, 3072, 2199, 3888, 604, 605, 1368, 3827, 4103, 607, 1571, 1438, 3701, 4389, 4897, 1603, 2154, 1715, 4369, 1652, 1733, 4218, 1798, 621, 1667, 1384, 3700, 1788, 1600, 1102, 1423, 2771, 1339, 3070, 2557, 2795, 2906, 3299, 3118, 4779, 2028, 1614, 1947, 630, 4479, 3766, 1106, 634, 1108, 635, 638, 3706, 3735, 3390, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1585, 3221, 2643, 2739, 3920, 1801, 4279, 2502, 1117, 2965, 2695, 3293, 3264, 2076, 657, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 667, 1133, 1134, 673, 1933, 1731, 1793, 3342, 683, 1146, 687, 3822, 1601, 692, 3905, 1414, 696, 1695, 4115, 701, 1544, 702, 703, 4031, 2010, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 1532, 1493, 1854, 1510, 705, 1153, 4476, 1375, 712, 1245, 715, 4234, 1154, 1314, 4096, 720, 1311, 721, 722, 4217, 726, 3815, 2005, 1964, 1262, 4480, 4294, 1582, 3439, 2833, 4287, 4509, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 1195, 3859, 3807, 4307, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X⁵ of SEQ ID NO: 5014 is K or R. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 2498, 4177, 742, 16, 17, 18, 745, 3477, 1548, 2982, 3426, 3073, 3169, 747, 3362, 4942, 23, 28, 2038, 3660, 750, 31, 32, 1640, 34, 37, 4925, 1205, 4288, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3688, 4320, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 1225, 3178, 3006, 3252, 2991, 2642, 2519, 3363, 2633, 42, 755, 44, 756, 46, 1952, 758, 2410, 2551, 3718, 1308, 1230, 3960, 1378, 2589, 3681, 760, 53, 4951, 4591, 762, 3925, 55, 3654, 763, 60, 61, 4086, 1740, 766, 1966, 63, 2041, 64, 769, 770, 2384, 771, 65, 772, 2197, 68, 3816, 69, 2599, 70, 3865, 1549, 3882, 75, 4501, 76, 774, 1413, 776, 3757, 3593, 4043, 4397, 4415, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 1356, 81, 82, 4065, 83, 84, 1294, 87, 3891, 4456, 4040, 1189, 1490, 90, 92, 782, 94, 1831, 1867, 4458, 1936, 100, 792, 2007, 4556, 795, 104, 106, 1849, 2509, 110, 1906, 798, 2359, 2461, 4864, 1344, 116, 120, 121, 803, 1463, 805, 1760, 123, 124, 806, 127, 2085, 130, 132, 809, 1978, 134, 813, 139, 815, 1326, 141, 142, 145, 4816, 1302, 817, 146, 818, 148, 149, 4546, 150, 153, 156, 157, 163, 164, 166, 169, 823, 824, 1483, 175, 177, 178, 179, 826, 827, 182, 183, 829, 184, 185, 190, 191, 192, 2361, 195, 1391, 197, 2223, 201, 202, 4775, 1334, 837, 3901, 3312, 212, 4386, 3028, 213, 1446, 214, 215, 1896, 3490, 217, 219, 223, 225, 2088, 4542, 226, 227, 230, 843, 844, 237, 845, 239, 849, 852, 1536, 854, 244, 245, 248, 855, 251, 253, 255, 257, 858, 860, 262, 863, 4535, 865, 264, 1241, 265, 1477, 267, 867, 1252, 273, 275, 1980, 277, 281, 1892, 879, 1539, 881, 1295, 282, 285, 1626, 2082, 1374, 1620, 4564, 289, 887, 888, 889, 4324, 293, 4138, 296, 3903, 892, 3829, 298, 301, 302, 1589, 4370, 2342, 309, 4059, 310, 1779, 1558, 1552, 317, 320, 898, 321, 2016, 2134, 324, 325, 327, 1635, 4484, 1756, 4609, 332, 4635, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3214, 3163, 2541, 3090, 3097, 3462, 3037, 3419, 2780, 2931, 1276, 2789, 3228, 2657, 3189, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3102, 3466, 3461, 2788, 2660, 3344, 2720, 3379, 2826, 3249, 3527, 4460, 3352, 4319, 3906, 4248, 3804, 1363, 1404, 4349, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3782, 3629, 3578, 3885, 4081, 1764, 1852, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 4222, 1504, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3909, 4269, 3019, 1415, 3020, 2748, 2646, 2787, 2760, 3158, 3170, 2703, 3494, 3404, 2675, 2749, 3341, 3355, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 2875, 3223, 2878, 1808, 2951, 3519, 2579, 2853, 3387, 3401, 3007, 3568, 3152, 3367, 3358, 336, 3290, 3550, 3309, 2613, 2765, 1355, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 1622, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 1464, 3560, 3236, 2730, 3572, 1607, 909, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 3002, 2338, 4472, 1472, 1529, 4507, 1583, 340, 912, 2013, 913, 2277, 1594, 4440, 917, 343, 344, 345, 346, 350, 351, 4498, 3637, 3570, 3429, 4091, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4034, 2820, 3912, 3287, 1218, 1190, 4145, 354, 3610, 4224, 1840, 3736, 1770, 4155, 932, 363, 1279, 2156, 1722, 368, 1566, 370, 4967, 372, 1211, 2494, 1726, 1748, 1191, 4039, 4411, 4506, 4270, 4156, 3780, 1550, 3899, 1181, 3919, 1639, 3664, 4189, 4001, 3799, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 1605, 4408, 4149, 3741, 3893, 1280, 1983, 3979, 3817, 1489, 4214, 3902, 1857, 1904, 3820, 3789, 4252, 4330, 4082, 3785, 3687, 4243, 3704, 4172, 4315, 1192, 2769, 2678, 3296, 2343, 4093, 4453, 3940, 3778, 4374, 4339, 4368, 4194, 4474, 4013, 1771, 1759, 3860, 3832, 1381, 4356, 1233, 4212, 3858, 1198, 3611, 1919, 1819, 3790, 1969, 4247, 1790, 3894, 1554, 3576, 4314, 1851, 1850, 4511, 3656, 3638, 1406, 1443, 1661, 4504, 3831, 4435, 1208, 1988, 3849, 1835, 4380, 4024, 4491, 4323, 4014, 1511, 1981, 1676, 1547, 1383, 3644, 3691, 4259, 1176, 4216, 1924, 1387, 4423, 1256, 4119, 1251, 3990, 4029, 4097, 3890, 3796, 4343, 1202, 4413, 4384, 3808, 3892, 3926, 3756, 4405, 4109, 1210, 4492, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3784, 4470, 4010, 4334, 3821, 4171, 3824, 3631, 4494, 1320, 1204, 1223, 1284, 1685, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4100, 4327, 3634, 3617, 4445, 4303, 1370, 3838, 1187, 3615, 3746, 3935, 1941, 4419, 1171, 3670, 3777, 936, 3685, 1325, 1940, 4482, 4258, 3812, 4124, 4508, 4500, 3652, 3972, 1630, 4421, 1172, 4026, 2740, 3125, 3546, 4513, 4340, 1763, 1487, 3589, 3907, 4041, 3851, 4077, 4187, 1193, 1196, 1724, 1717, 1200, 1975, 1613, 4006, 3653, 3833, 1593, 4442, 3900, 4388, 1820, 4317, 4249, 3628, 3794, 4447, 3776, 3658, 1377, 4011, 4272, 3594, 4185, 3686, 3696, 1350, 4230, 3853, 4244, 1909, 3897, 1546, 3273, 3452, 3525, 4105, 3835, 383, 1263, 1492, 3856, 3586, 1175, 4144, 1224, 1199, 3667, 2778, 4412, 1507, 3146, 4281, 1179, 3843, 3740, 1388, 1474, 1342, 1471, 4176, 1741, 1508, 4378, 1212, 4015, 1207, 3698, 3825, 4231, 3806, 3896, 3963, 4286, 3743, 4130, 3605, 4173, 4265, 1246, 1737, 3826, 1473, 1992, 1883, 1656, 3671, 4063, 1847, 4239, 3915, 1265, 1498, 1329, 3874, 4261, 1791, 3579, 4359, 4131, 4297, 4357, 4046, 3788, 4169, 1925, 4228, 4101, 1889, 1369, 4088, 4019, 1194, 3772, 3850, 1315, 1530, 1859, 4183, 1408, 4033, 3623, 1928, 1459, 1765, 4004, 3591, 3967, 4168, 3957, 3878, 3980, 3958, 4051, 3798, 4032, 3991, 4106, 1641, 4464, 3813, 4257, 3846, 4345, 1787, 1214, 4483, 4201, 1220, 3867, 3640, 3916, 1209, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3883, 4326, 4092, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3987, 3583, 3647, 389, 4304, 3793, 1937, 3996, 3800, 4367, 4099, 1390, 4364, 4306, 1278, 1672, 1542, 1915, 3600, 3948, 3811, 1362, 4276, 1445, 1721, 1632, 3607, 1317, 1778, 1668, 391, 4406, 4341, 1480, 393, 394, 395, 946, 3618, 4433, 1177, 947, 950, 400, 4471, 401, 402, 954, 3602, 4434, 3721, 1825, 4202, 4409, 406, 1631, 1684, 3889, 410, 412, 2352, 1905, 417, 418, 3675, 1833, 3974, 419, 964, 420, 421, 969, 4733, 1272, 971, 423, 3830, 973, 426, 1708, 428, 4141, 3749, 1619, 975, 4044, 3590, 1706, 4400, 979, 2895, 3448, 438, 982, 2433, 983, 442, 3862, 2435, 443, 4309, 4045, 3854, 3682, 444, 445, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3599, 3775, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 3694, 446, 3985, 3535, 4084, 3282, 988, 2107, 990, 451, 452, 453, 992, 993, 1696, 996, 3116, 1386, 999, 458, 3879, 460, 461, 462, 2339, 1003, 4425, 1645, 1004, 466, 2328, 468, 1231, 1468, 2496, 473, 474, 2108, 1273, 1007, 1744, 1659, 478, 1009, 1012, 4313, 482, 1499, 484, 2513, 2205, 4592, 1458, 4274, 2122, 4905, 4205, 2000, 488, 1894, 3917, 3616, 4311, 4085, 4401, 1310, 3783, 1538, 3870, 1948, 3699, 1735, 3792, 2202, 4090, 2378, 2012, 3642, 1020, 2302, 4665, 4781, 500, 1022, 1023, 4686, 505, 507, 508, 509, 1025, 1732, 1816, 3636, 1028, 516, 1366, 4572, 2489, 1261, 4027, 3763, 2959, 1293, 3197, 1448, 1032, 519, 2420, 522, 3759, 1215, 4122, 1730, 524, 526, 3966, 1035, 527, 528, 529, 530, 531, 1036, 532, 533, 536, 537, 3767, 1929, 1041, 3683, 1043, 4906, 542, 1338, 1796, 4331, 4332, 4466, 3803, 3087, 3505, 1449, 1044, 4414, 3453, 3254, 544, 546, 1045, 547, 4240, 3580, 4680, 549, 550, 2598, 551, 3819, 1259, 4062, 554, 1049, 1050, 1433, 555, 1052, 1053, 3738, 3857, 2089, 1056, 2193, 1257, 1238, 3662, 1059, 1060, 4203, 3981, 1303, 4116, 567, 569, 3620, 4002, 3679, 3707, 4497, 4438, 1264, 3939, 4170, 4056, 1271, 1451, 1654, 3934, 4080, 4352, 574, 3739, 1565, 1419, 3950, 3716, 1465, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4164, 3630, 4229, 4292, 4215, 1729, 4223, 4455, 4512, 3633, 4070, 4104, 4162, 4443, 3761, 1587, 3592, 1891, 4469, 1963, 4129, 1360, 3949, 1861, 4120, 1292, 4293, 3839, 3983, 3928, 4295, 3715, 3855, 3609, 1990, 4007, 3722, 1624, 3924, 3952, 580, 2003, 1343, 582, 4114, 1818, 1704, 4448, 584, 1078, 1786, 585, 1832, 586, 2891, 587, 4936, 1082, 4459, 2113, 590, 2308, 593, 1858, 597, 2738, 4150, 3260, 3481, 4439, 1268, 4050, 3377, 4424, 3492, 1412, 4477, 4263, 3072, 2009, 3888, 3827, 4103, 1438, 609, 610, 611, 3701, 4389, 613, 4369, 617, 1921, 1373, 1870, 4218, 1099, 1702, 4801, 623, 3700, 1788, 625, 4878, 1423, 1339, 3875, 628, 2557, 2906, 2029, 4876, 1103, 631, 4479, 3766, 632, 1104, 1105, 634, 4651, 1108, 1813, 636, 638, 641, 4581, 1112, 2164, 3735, 3390, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 4398, 1269, 3624, 4481, 1432, 3295, 1568, 1766, 2643, 2739, 4760, 1115, 3920, 644, 645, 646, 4279, 3762, 1637, 1509, 2200, 1117, 4780, 2965, 2695, 650, 651, 653, 654, 655, 658, 4035, 2910, 3391, 2808, 3676, 2852, 3284, 3537, 1319, 4467, 1802, 1227, 660, 4812, 2364, 1124, 1125, 665, 4917, 1127, 1129, 1132, 1133, 2236, 673, 4557, 1136, 1139, 678, 4737, 4531, 679, 680, 1144, 681, 4525, 2415, 685, 2445, 3822, 690, 691, 1601, 4621, 3905, 695, 1149, 696, 2027, 2160, 1795, 1372, 4115, 2194, 1920, 4031, 1393, 1277, 1400, 4402, 4157, 4028, 704, 1902, 1510, 4182, 1153, 4476, 2053, 710, 1375, 715, 4096, 717, 1155, 719, 1311, 722, 4217, 1156, 723, 1157, 1627, 4566, 1158, 724, 725, 1953, 1201, 3787, 3747, 1846, 3815, 1822, 1537, 1318, 4294, 733, 734, 3439, 2833, 4505, 4267, 3697, 4112, 2967, 3651, 1805, 1163, 3859, 2275, 737, 1167, 1745, 3807, or 4307.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X⁶ of SEQ ID NO: 5014 is K or R. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 738, 4177, 1289, 740, 14, 743, 744, 17, 3477, 1548, 3051, 2982, 2877, 746, 19, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 22, 1638, 748, 24, 749, 27, 1703, 1836, 28, 3660, 29, 750, 1640, 33, 35, 36, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 44, 45, 756, 47, 48, 1952, 3122, 2551, 3718, 3484, 3577, 1308, 3960, 1378, 2994, 3080, 2589, 3681, 51, 760, 762, 3925, 3654, 763, 59, 60, 4086, 1740, 1660, 62, 1966, 63, 2438, 768, 66, 67, 68, 3816, 2599, 2706, 72, 73, 74, 3865, 1549, 1361, 3882, 773, 3713, 1942, 1312, 4501, 76, 1413, 775, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 1356, 4065, 1294, 1484, 85, 86, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 780, 1180, 92, 781, 782, 783, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 1936, 1590, 98, 99, 789, 790, 1298, 1688, 791, 792, 2007, 102, 103, 104, 105, 107, 108, 1579, 1906, 111, 798, 112, 799, 800, 1444, 801, 114, 115, 1344, 116, 802, 117, 118, 119, 121, 803, 1463, 1760, 806, 126, 128, 807, 129, 131, 808, 133, 1978, 811, 812, 135, 136, 137, 138, 814, 140, 1326, 141, 142, 143, 2344, 816, 1634, 1302, 817, 818, 147, 148, 149, 150, 151, 154, 155, 819, 820, 156, 157, 158, 161, 162, 165, 822, 168, 169, 170, 823, 172, 1651, 173, 1483, 174, 825, 176, 178, 180, 827, 181, 828, 4911, 184, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 198, 199, 200, 201, 202, 203, 205, 832, 206, 834, 207, 208, 209, 210, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 225, 228, 229, 230, 231, 842, 232, 233, 234, 238, 847, 239, 850, 851, 853, 1536, 240, 241, 242, 243, 244, 245, 247, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 864, 263, 2318, 865, 2326, 264, 1241, 266, 1477, 867, 268, 868, 269, 270, 869, 870, 271, 871, 872, 272, 873, 1252, 1591, 875, 274, 275, 276, 876, 877, 277, 278, 280, 1892, 1539, 881, 3601, 3877, 1460, 282, 1799, 284, 1626, 286, 1374, 1620, 1290, 1354, 887, 1956, 889, 292, 4324, 4138, 891, 296, 3903, 297, 3829, 3809, 4271, 3844, 1436, 300, 1617, 1961, 302, 304, 305, 2147, 1589, 4370, 307, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 318, 319, 322, 1958, 323, 324, 901, 1491, 328, 329, 4484, 907, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 3804, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 3548, 3179, 3407, 3841, 3347, 3142, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 344, 920, 921, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 354, 1782, 927, 3610, 356, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 364, 1279, 365, 1543, 366, 367, 4049, 1633, 1722, 369, 1495, 1566, 373, 1211, 1726, 1442, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 4149, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 3902, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3687, 4318, 4243, 3866, 3704, 4172, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 1584, 4093, 4453, 4210, 4009, 4264, 4339, 1738, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1336, 3894, 3576, 4314, 3695, 1850, 4362, 1815, 3638, 4454, 1661, 4504, 1359, 3650, 1305, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 1283, 3861, 3644, 4259, 1418, 1176, 4216, 1421, 3992, 4423, 4253, 3748, 4119, 1297, 1954, 4450, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 4275, 4492, 4365, 4118, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 4470, 3941, 4348, 3587, 3818, 4350, 3821, 3929, 3824, 4465, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 3627, 3777, 1371, 3685, 4258, 3812, 1581, 4124, 4508, 4500, 3652, 3972, 1528, 3717, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 3758, 4510, 3742, 1710, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1997, 1701, 4280, 4006, 1984, 3833, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1324, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 3826, 1992, 1656, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1410, 1823, 1498, 1329, 386, 940, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1859, 4183, 1403, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 3937, 3801, 1787, 1214, 4483, 4201, 1845, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 953, 401, 403, 955, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4409, 1977, 405, 1631, 1684, 409, 3889, 2117, 411, 413, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 1272, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 978, 4400, 1606, 980, 2604, 2895, 436, 3448, 2188, 438, 1692, 442, 3862, 4055, 4358, 2276, 985, 1664, 443, 4309, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3985, 3535, 1306, 4084, 3282, 1780, 448, 990, 991, 1485, 992, 1728, 993, 994, 1696, 997, 3116, 1869, 456, 1386, 1000, 3879, 2698, 460, 1001, 461, 1447, 1002, 1003, 463, 464, 4425, 465, 1004, 466, 469, 1231, 1468, 470, 1005, 476, 1273, 1744, 1488, 1659, 1604, 479, 1013, 1014, 481, 4313, 1499, 1016, 4073, 1777, 485, 4274, 487, 1775, 4205, 1526, 1697, 2000, 488, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 4473, 4085, 4401, 3783, 3765, 1538, 3870, 491, 3699, 3792, 4290, 494, 2421, 4090, 2012, 1803, 3642, 1322, 1020, 502, 1333, 504, 1890, 507, 3608, 1732, 1864, 1816, 1531, 513, 3636, 514, 1699, 1027, 1366, 4950, 4027, 3478, 2959, 1293, 3197, 1595, 3413, 518, 1032, 1033, 1675, 1797, 2315, 521, 1999, 3759, 1215, 4122, 1730, 3966, 1035, 4973, 528, 3911, 3289, 1821, 530, 532, 1874, 533, 1038, 538, 539, 3767, 1929, 3683, 1338, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 548, 549, 2598, 552, 553, 3819, 1259, 4062, 554, 2841, 3515, 1433, 1323, 4301, 555, 558, 3738, 1567, 559, 1054, 1270, 3857, 2175, 1257, 1238, 3662, 561, 1058, 563, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 1912, 573, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 4195, 4223, 1540, 4455, 4512, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1814, 4443, 3761, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 1287, 1713, 1556, 1736, 1995, 1705, 1861, 4120, 4417, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1712, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 1903, 4459, 589, 1563, 1084, 591, 592, 594, 595, 1858, 596, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 1412, 4017, 4477, 1794, 602, 4263, 3072, 2009, 1754, 3888, 603, 604, 1368, 3827, 4103, 1571, 1438, 611, 1093, 612, 1094, 3701, 4389, 614, 615, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2473, 1423, 2771, 1339, 3875, 3070, 2015, 2557, 2795, 2906, 2103, 3299, 3118, 4576, 1103, 1614, 1947, 631, 4479, 3766, 1107, 635, 1813, 636, 2431, 637, 1109, 639, 3706, 1110, 640, 642, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1568, 1766, 3221, 2643, 2739, 3920, 647, 1801, 4279, 3762, 1637, 1509, 648, 1117, 1119, 2965, 2695, 3293, 4722, 1121, 653, 1122, 3264, 655, 656, 657, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3537, 3994, 1319, 4467, 1623, 660, 1123, 664, 1126, 1128, 1129, 1130, 670, 1527, 671, 1772, 1137, 5005, 1933, 1731, 1793, 3342, 1140, 1141, 687, 3822, 1601, 1148, 693, 3905, 694, 1414, 1149, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 1920, 4999, 1544, 703, 4031, 4305, 1636, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 4028, 3989, 704, 1493, 1902, 1152, 4182, 707, 708, 709, 4476, 1375, 713, 714, 1841, 4234, 1154, 1314, 4096, 718, 719, 720, 2063, 1311, 721, 4217, 1627, 1158, 1953, 1201, 3787, 729, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1805, 3705, 1195, 3859, 1164, 1165, 2351, 2423, 1745, 1973, 3807, 4307, 1169, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X⁷ of SEQ ID NO: 5014 is K or R. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 740, 15, 742, 743, 17, 22, 24, 1836, 32, 36, 2450, 39, 752, 753, 1998, 3059, 2519, 757, 48, 1952, 50, 52, 760, 2389, 54, 2346, 58, 4086, 1660, 1966, 768, 2402, 772, 71, 72, 2453, 3882, 775, 1806, 3669, 1356, 2132, 81, 84, 85, 87, 4040, 88, 1885, 782, 783, 784, 785, 94, 788, 2173, 98, 2007, 102, 113, 799, 4848, 1444, 4821, 2329, 115, 119, 2290, 123, 806, 128, 134, 812, 145, 817, 154, 2149, 821, 167, 171, 4596, 183, 830, 191, 194, 2071, 195, 4920, 831, 2223, 207, 3901, 211, 212, 213, 215, 224, 4782, 845, 846, 849, 850, 854, 247, 248, 2245, 255, 261, 264, 265, 1477, 270, 874, 876, 279, 882, 1930, 285, 286, 886, 2119, 2468, 887, 888, 4138, 297, 3844, 302, 893, 307, 308, 2155, 1431, 2312, 900, 1635, 906, 2799, 2128, 2918, 1363, 4251, 2622, 3333, 3474, 3614, 2732, 3166, 3151, 3088, 2883, 3318, 2645, 2733, 3213, 3782, 1844, 2523, 2520, 2997, 2681, 3035, 3279, 2764, 3480, 2787, 1808, 3101, 3689, 4147, 1762, 1976, 340, 1594, 2439, 348, 4498, 1518, 1782, 926, 357, 359, 932, 363, 369, 1873, 3780, 4140, 4001, 3709, 3834, 1752, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 3820, 4330, 1872, 3687, 4318, 375, 4210, 3860, 4212, 3695, 1851, 4504, 1910, 1428, 4323, 4422, 4259, 1176, 3711, 4365, 4383, 3969, 4128, 3802, 3863, 3821, 4171, 3824, 4462, 3760, 3753, 2783, 3880, 3943, 4163, 4178, 4199, 3724, 3670, 4482, 3692, 4430, 4316, 3645, 3690, 3589, 3730, 4426, 3851, 4429, 1335, 1717, 1997, 1975, 4280, 4006, 3900, 4298, 4388, 1341, 1350, 1909, 4412, 4407, 4281, 4167, 1893, 3585, 4015, 1747, 4286, 3826, 1473, 1914, 3984, 4495, 4184, 3977, 1707, 4074, 4003, 3915, 1410, 1498, 940, 4131, 4357, 1925, 1466, 1611, 1530, 4168, 4245, 4075, 3987, 1679, 4306, 3869, 3768, 393, 2265, 3618, 4433, 947, 399, 401, 402, 4139, 1352, 406, 415, 418, 420, 4919, 431, 4044, 976, 433, 434, 435, 442, 3873, 3411, 3985, 987, 1485, 2262, 457, 458, 4425, 466, 467, 468, 1468, 474, 1008, 1012, 1016, 4518, 1697, 490, 3616, 2247, 2302, 499, 500, 501, 509, 2110, 512, 1797, 520, 525, 3966, 1038, 537, 1041, 3683, 2165, 542, 4331, 3129, 1044, 4351, 3453, 1047, 1323, 4301, 557, 3738, 559, 1270, 3857, 1056, 2186, 1057, 1059, 565, 566, 3981, 567, 3620, 4002, 3666, 3939, 1221, 1397, 1437, 4337, 4268, 3938, 4292, 4215, 3750, 3633, 4070, 3592, 1827, 3839, 4395, 3855, 3665, 1624, 2395, 1818, 586, 587, 1903, 1080, 1081, 1082, 589, 1084, 1085, 594, 596, 4439, 3997, 1962, 1087, 4777, 606, 607, 610, 1094, 4389, 1603, 1095, 616, 618, 622, 1104, 4536, 3706, 2481, 3100, 3200, 3621, 4179, 1432, 4381, 643, 1115, 644, 2307, 2477, 652, 657, 658, 3994, 4467, 661, 663, 665, 4600, 1137, 1933, 4840, 1140, 678, 680, 683, 686, 692, 693, 696, 2081, 2280, 698, 1400, 4197, 1532, 1854, 706, 711, 712, 4570, 714, 1841, 1314, 4096, 2249, 726, 1846, 2385, 1318, 733, 3651, 1165, 4839, 4968, 4684, or 1454.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X³ of SEQ ID NO: 5014 is a basic amino acid residue. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 739, 4177, 1289, 740, 741, 18, 745, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 23, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 34, 35, 36, 37, 38, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 45, 756, 46, 48, 1952, 758, 49, 3122, 2551, 3718, 3484, 3577, 759, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 52, 760, 53, 762, 4659, 54, 3925, 55, 3654, 56, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 63, 64, 768, 771, 65, 66, 67, 68, 3816, 2599, 2706, 2399, 74, 3865, 1549, 1361, 2453, 3882, 3713, 1942, 75, 1312, 4501, 76, 77, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 82, 4065, 83, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 1180, 92, 785, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 794, 795, 104, 105, 106, 1849, 108, 4736, 1579, 110, 1906, 113, 1444, 1344, 116, 802, 117, 118, 2158, 121, 803, 804, 1463, 805, 122, 2058, 124, 125, 127, 4994, 807, 132, 809, 810, 133, 1978, 812, 135, 136, 137, 138, 813, 4673, 140, 815, 1326, 141, 142, 143, 144, 145, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 151, 152, 153, 154, 155, 819, 820, 157, 821, 159, 160, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 180, 826, 827, 181, 828, 182, 183, 4641, 829, 184, 185, 186, 187, 188, 189, 830, 191, 192, 193, 194, 195, 196, 1391, 197, 2223, 200, 201, 202, 203, 204, 205, 832, 833, 206, 834, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 215, 1896, 1522, 3490, 838, 2241, 217, 218, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 226, 227, 230, 231, 842, 232, 233, 235, 844, 236, 237, 2150, 851, 852, 853, 1536, 240, 854, 242, 243, 244, 245, 246, 247, 855, 4634, 249, 250, 251, 252, 253, 254, 255, 857, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 869, 870, 271, 871, 872, 272, 874, 1252, 273, 1591, 275, 1980, 276, 876, 877, 277, 278, 279, 1892, 879, 1539, 880, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 282, 1799, 283, 1626, 1374, 287, 1620, 1290, 1354, 888, 291, 1956, 889, 292, 4324, 293, 4138, 891, 2224, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1515, 1617, 1961, 304, 306, 1589, 4370, 308, 309, 894, 3646, 4059, 1431, 1331, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 897, 898, 321, 322, 899, 1958, 2134, 324, 901, 325, 902, 326, 1491, 329, 330, 905, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 2492, 1762, 4472, 1472, 1529, 4057, 1976, 4507, 1583, 338, 911, 1711, 340, 912, 2013, 341, 1594, 4440, 917, 344, 918, 919, 921, 922, 347, 349, 351, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 925, 1782, 926, 927, 3610, 357, 358, 359, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 1211, 1873, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 1359, 1734, 3650, 1910, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 4125, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 390, 391, 4406, 4341, 1480, 395, 1714, 1422, 396, 2265, 397, 3618, 4433, 1177, 3898, 398, 949, 950, 399, 951, 400, 1965, 2345, 4471, 952, 402, 2475, 403, 404, 4139, 1482, 3602, 4434, 3721, 1592, 1519, 1352, 4202, 4409, 1977, 1917, 407, 408, 1631, 1684, 409, 3889, 958, 959, 412, 960, 414, 415, 961, 1905, 416, 963, 417, 3675, 1833, 3974, 420, 421, 965, 966, 969, 970, 422, 1897, 4754, 423, 4133, 3830, 972, 424, 973, 427, 1708, 4141, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 434, 1606, 979, 2604, 2895, 436, 3448, 1692, 983, 3862, 4055, 4358, 984, 985, 1664, 4045, 3854, 3682, 2491, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 987, 988, 450, 990, 451, 452, 991, 992, 1728, 994, 995, 454, 1696, 998, 3116, 1869, 456, 1386, 999, 3879, 2698, 1001, 461, 1447, 462, 464, 4425, 1645, 1231, 1468, 472, 473, 4725, 476, 1273, 1007, 1744, 1488, 1659, 477, 1604, 481, 4313, 482, 483, 1499, 484, 2513, 1016, 4073, 1777, 1458, 4274, 4539, 4528, 487, 1775, 4205, 1526, 1697, 1017, 2000, 489, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 491, 1948, 3699, 1735, 3792, 4290, 495, 4090, 2247, 496, 1019, 2012, 1803, 3642, 1322, 498, 1021, 501, 1022, 502, 1333, 503, 1023, 1890, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1029, 1366, 2112, 2124, 2376, 1261, 4027, 3478, 3763, 2959, 517, 3197, 1595, 3413, 1448, 518, 2057, 1675, 1797, 2148, 2420, 520, 2315, 523, 1999, 3759, 1215, 4122, 1730, 524, 526, 3966, 3911, 529, 3289, 1821, 530, 531, 1874, 1038, 536, 537, 3767, 1929, 1041, 1042, 3683, 542, 1338, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 544, 545, 546, 4240, 3580, 1046, 1047, 550, 2598, 551, 552, 3819, 1259, 4062, 2841, 1050, 3515, 4301, 557, 1052, 1053, 3738, 1567, 1270, 3857, 1055, 2198, 1257, 1238, 3662, 561, 562, 1058, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 572, 1912, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1451, 1654, 3934, 4080, 4352, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 1950, 1963, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 1559, 1250, 1555, 4114, 1818, 1075, 1076, 1077, 1704, 4448, 1078, 1079, 1786, 585, 3354, 1832, 3432, 2891, 2505, 1903, 1081, 1082, 4459, 1083, 1563, 590, 591, 1085, 594, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 600, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1087, 1088, 3888, 2324, 605, 1368, 3827, 4103, 606, 4549, 1090, 1571, 1091, 1438, 1092, 1093, 612, 1094, 3701, 4389, 613, 1603, 616, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1099, 1100, 1702, 2239, 1101, 1667, 1384, 623, 3700, 1788, 1600, 624, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4818, 4860, 2557, 2795, 2906, 3118, 4657, 4646, 4875, 4627, 4747, 1614, 1947, 4618, 4479, 3766, 632, 1104, 1105, 633, 635, 1813, 636, 2213, 3706, 1110, 640, 1111, 641, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 1114, 1766, 3221, 2643, 2739, 3920, 644, 1116, 645, 646, 2307, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2369, 2695, 3293, 650, 651, 1120, 652, 1121, 4909, 1122, 3264, 655, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3994, 1319, 4467, 1802, 1227, 1623, 661, 2364, 662, 663, 664, 1124, 1125, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 1135, 672, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 679, 1142, 1143, 681, 1145, 682, 685, 688, 3822, 689, 690, 691, 1147, 1601, 3905, 694, 695, 1414, 4793, 4575, 1150, 1795, 1372, 1695, 1866, 4115, 1719, 698, 2217, 1920, 699, 700, 1544, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1854, 1902, 1510, 2340, 4182, 706, 707, 708, 4476, 1245, 714, 1841, 4234, 1314, 4096, 717, 1155, 2249, 4217, 1156, 723, 1157, 1627, 725, 1159, 1953, 1160, 1201, 727, 3787, 4568, 3747, 730, 1846, 3815, 2005, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 734, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1628, 3705, 1195, 3859, 1164, 2394, 1165, 1166, 1745, 1973, 1168, 3807, 4307, 2303, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X⁶ of SEQ ID NO: 5014 is a basic amino acid residue. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 4884, 738, 4177, 1289, 740, 14, 743, 744, 17, 3477, 1548, 3051, 2982, 2877, 746, 19, 3036, 3426, 3073, 3169, 747, 3362, 2784, 4889, 21, 3192, 4942, 22, 1638, 748, 24, 749, 27, 1703, 1836, 28, 3660, 29, 750, 1640, 33, 35, 36, 2450, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 44, 45, 756, 47, 48, 1952, 3122, 2551, 3718, 3484, 3577, 759, 50, 1308, 3960, 1378, 2994, 3080, 2589, 3681, 51, 760, 2389, 762, 3925, 3654, 763, 4626, 59, 60, 4086, 1740, 1660, 62, 1966, 63, 2438, 768, 66, 67, 2197, 68, 3816, 2599, 2706, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 1312, 4501, 76, 1413, 775, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 1356, 2132, 4065, 1294, 1484, 85, 86, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 780, 1180, 92, 781, 782, 783, 2356, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 1936, 1590, 98, 99, 789, 790, 1298, 101, 1688, 791, 792, 2007, 102, 103, 104, 105, 107, 108, 1579, 110, 1906, 111, 798, 112, 799, 800, 2461, 1444, 801, 114, 115, 1344, 116, 802, 117, 118, 119, 121, 803, 1463, 1760, 124, 806, 126, 128, 807, 129, 131, 808, 2281, 133, 1978, 811, 812, 135, 136, 137, 138, 814, 140, 1326, 141, 142, 143, 2344, 816, 1634, 1302, 817, 818, 147, 148, 149, 150, 151, 154, 155, 819, 820, 156, 157, 2295, 158, 161, 162, 165, 822, 168, 169, 170, 823, 172, 1651, 173, 1483, 174, 825, 176, 178, 180, 827, 181, 828, 4911, 184, 185, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 197, 198, 199, 200, 201, 202, 203, 4775, 205, 832, 206, 834, 207, 208, 209, 210, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 2206, 215, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 225, 4751, 228, 229, 230, 231, 2448, 842, 232, 233, 4782, 234, 235, 238, 847, 239, 850, 851, 853, 1536, 240, 241, 242, 243, 244, 245, 246, 247, 4923, 4696, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 4966, 864, 263, 4970, 2318, 865, 2326, 264, 1241, 266, 1477, 867, 268, 868, 269, 270, 869, 870, 271, 871, 872, 272, 873, 4655, 4972, 1252, 1591, 875, 274, 275, 1980, 276, 876, 877, 2066, 277, 278, 280, 2323, 1892, 1539, 2214, 881, 882, 3601, 3877, 1930, 1460, 282, 1799, 284, 4553, 4772, 1626, 286, 1374, 1620, 1290, 1354, 887, 1956, 889, 4765, 292, 4324, 4138, 891, 296, 3903, 297, 3829, 3809, 4271, 3844, 1436, 300, 1617, 1961, 5010, 302, 304, 305, 2147, 1589, 4370, 307, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 318, 319, 322, 1958, 2454, 323, 324, 901, 1491, 328, 329, 330, 4820, 4484, 1756, 907, 4584, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 3804, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 4222, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 343, 344, 920, 921, 348, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 354, 1782, 927, 3610, 356, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 364, 1279, 365, 1543, 366, 367, 4049, 1633, 1722, 369, 1495, 1566, 373, 1211, 2494, 1726, 1442, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 4149, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 3902, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 2348, 377, 1395, 1584, 4093, 4453, 3778, 4210, 4009, 4264, 4339, 1738, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1336, 3894, 1554, 3576, 4314, 3695, 1850, 4362, 1815, 3656, 3638, 4454, 1443, 1661, 4504, 1359, 3650, 1305, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 1283, 3861, 3644, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 3992, 4423, 4253, 3748, 4119, 1297, 1299, 1954, 4450, 3990, 4029, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 4492, 4365, 4118, 3655, 3886, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 4470, 3941, 4348, 3587, 3818, 3814, 4350, 3821, 3929, 3824, 4465, 4494, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 3634, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 3627, 3777, 1371, 3685, 4482, 4258, 3812, 1581, 4124, 4508, 4500, 3652, 3972, 1309, 1528, 3717, 1217, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4329, 4410, 3703, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 4302, 3758, 4510, 3742, 1710, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1997, 1701, 4280, 4006, 1984, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 1380, 4185, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 1810, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3743, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 3826, 1992, 1656, 1837, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1562, 1847, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1410, 1823, 1498, 1329, 386, 940, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1859, 4183, 1403, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 3591, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1542, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 392, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 953, 401, 403, 955, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4409, 1977, 405, 1631, 1684, 409, 3889, 2117, 411, 413, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 1272, 971, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 978, 4400, 433, 1606, 980, 2604, 2895, 436, 3448, 2188, 438, 1692, 982, 2243, 439, 442, 3862, 4055, 4358, 2276, 985, 1664, 443, 4309, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3985, 3535, 1306, 4084, 3282, 1353, 1780, 448, 2031, 990, 991, 1485, 992, 1728, 993, 4703, 994, 1696, 997, 998, 3116, 1869, 456, 1386, 4778, 2040, 1000, 4981, 3879, 2698, 460, 1001, 461, 1447, 1002, 1003, 463, 464, 4425, 465, 1004, 466, 469, 1231, 1468, 470, 2496, 1005, 476, 1273, 1744, 1488, 1659, 4598, 1604, 479, 1013, 1014, 481, 4313, 1499, 1016, 4073, 1777, 2172, 485, 4274, 4599, 4796, 487, 4710, 1775, 4205, 1526, 1697, 2000, 488, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 3783, 3765, 1538, 3870, 491, 3699, 3792, 4290, 2074, 492, 494, 2421, 4090, 2012, 1803, 3642, 1322, 1020, 502, 1333, 504, 4805, 1890, 507, 3608, 1732, 511, 2397, 1864, 1816, 1531, 513, 3636, 514, 1699, 1027, 4987, 1366, 4664, 4950, 4027, 3478, 2959, 1293, 3197, 1595, 3413, 518, 4698, 1032, 1033, 1675, 1797, 4578, 4854, 2315, 521, 1999, 3759, 1215, 4122, 1730, 3966, 1035, 4973, 528, 3911, 3289, 1821, 530, 2426, 532, 1874, 533, 1038, 538, 539, 3767, 1929, 3683, 2100, 4853, 1338, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 548, 549, 2598, 552, 553, 3819, 1259, 4062, 554, 2841, 3515, 1433, 1323, 4301, 555, 558, 3738, 1567, 559, 1054, 1270, 3857, 2175, 1257, 1238, 3662, 561, 1058, 563, 4872, 2097, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 570, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 1912, 573, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 1409, 4195, 4223, 1540, 4455, 4512, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1071, 1814, 4443, 3761, 1346, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1705, 1861, 4120, 4417, 1292, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1712, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 4583, 1903, 1080, 4459, 589, 1563, 1084, 591, 592, 594, 595, 1858, 596, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 1412, 601, 4017, 4477, 1794, 602, 4263, 3072, 2009, 1754, 1088, 3888, 603, 604, 1368, 3827, 4103, 1571, 1438, 2069, 611, 1093, 612, 1094, 3701, 4389, 614, 5000, 615, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2473, 1423, 2771, 1339, 3875, 3070, 2015, 2557, 2795, 2906, 2103, 3299, 3118, 4838, 4965, 4605, 4576, 1103, 1614, 1947, 631, 4479, 3766, 1107, 635, 1813, 636, 2431, 637, 1109, 4577, 639, 3706, 1110, 640, 1111, 4581, 4644, 4734, 642, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1585, 1568, 1766, 3221, 2643, 2739, 4629, 3920, 4603, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4590, 648, 1117, 4800, 4724, 4674, 1119, 2965, 2695, 3293, 4722, 1121, 4784, 653, 1122, 3264, 655, 656, 657, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3537, 3994, 1319, 4467, 1623, 660, 4714, 4812, 1123, 664, 2138, 1126, 1128, 1129, 1130, 670, 1527, 671, 1772, 1133, 2196, 1136, 1137, 5005, 1933, 1731, 1793, 3342, 1140, 1141, 4525, 687, 3822, 1601, 1148, 693, 3905, 694, 1414, 1149, 4756, 4859, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2194, 1920, 4999, 1544, 703, 4031, 4305, 1636, 1393, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 4715, 704, 1493, 1902, 1152, 4824, 4182, 707, 708, 709, 4732, 4476, 1375, 713, 714, 715, 1841, 4234, 1154, 1314, 4096, 4895, 718, 719, 720, 2063, 1311, 721, 4903, 4885, 4217, 1627, 2116, 1158, 724, 5013, 4894, 1953, 1201, 3787, 729, 2485, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4976, 4294, 1582, 4587, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1805, 3705, 1195, 3859, 1164, 1165, 2351, 4835, 4571, 2423, 1745, 1973, 1168, 3807, 4307, 1169, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X³ of SEQ ID NO: 5014 is a basic amino acid residue and X⁶ of SEQ ID NO: 5014 is a basic amino acid residue. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 4177, 1289, 740, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 35, 36, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 45, 756, 48, 1952, 3122, 2551, 3718, 3484, 3577, 759, 3960, 1378, 2994, 3080, 2589, 3681, 760, 762, 3925, 3654, 60, 4086, 1740, 1660, 62, 1966, 63, 768, 66, 67, 68, 3816, 2599, 2706, 74, 3865, 1549, 1361, 2453, 3882, 3713, 1942, 1312, 4501, 76, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 4065, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 1180, 92, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 99, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 104, 105, 108, 1579, 110, 1906, 1444, 1344, 116, 802, 117, 118, 121, 803, 1463, 124, 807, 133, 1978, 812, 135, 136, 137, 138, 140, 1326, 141, 142, 143, 1634, 1302, 817, 818, 147, 148, 149, 151, 154, 155, 819, 820, 157, 165, 822, 168, 169, 170, 823, 1651, 173, 1483, 174, 825, 176, 180, 827, 181, 828, 184, 185, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 197, 200, 201, 202, 203, 205, 832, 206, 834, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 215, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 230, 231, 842, 232, 233, 235, 851, 853, 1536, 240, 242, 243, 244, 245, 246, 247, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 2326, 264, 1241, 266, 1477, 867, 869, 870, 271, 871, 872, 272, 1252, 1591, 275, 1980, 276, 876, 877, 277, 278, 1892, 1539, 3601, 3877, 1930, 1460, 282, 1799, 1626, 1374, 1620, 1290, 1354, 1956, 889, 292, 4324, 4138, 891, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1617, 1961, 304, 1589, 4370, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 322, 1958, 324, 901, 1491, 329, 330, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 4222, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 344, 921, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 1782, 927, 3610, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 367, 4049, 1633, 1722, 369, 1495, 1566, 1211, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4093, 4453, 3778, 4210, 4009, 4264, 4339, 1738, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1336, 3894, 1554, 3576, 4314, 3695, 4362, 1815, 3656, 3638, 4454, 1443, 1661, 1359, 3650, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 3748, 4119, 1297, 1299, 4450, 3990, 4029, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 4492, 4365, 4118, 3655, 3886, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 4470, 3941, 4348, 3587, 3818, 3814, 4350, 3821, 3929, 3824, 4465, 4494, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 3634, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 4124, 4508, 4500, 3652, 3972, 1309, 1528, 3717, 1217, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4329, 4410, 3703, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 4302, 3758, 4510, 3742, 1710, 1335, 1997, 1701, 4280, 4006, 1984, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 1380, 4185, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 1810, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 4125, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3743, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 1837, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1562, 1847, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 3591, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1542, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 403, 1482, 3602, 4434, 3721, 1592, 1519, 1352, 4409, 1977, 1631, 1684, 409, 3889, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 1606, 2604, 2895, 436, 3448, 1692, 3862, 4055, 4358, 985, 1664, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 990, 991, 992, 1728, 994, 1696, 998, 3116, 1869, 456, 1386, 3879, 2698, 1001, 461, 1447, 464, 4425, 1231, 1468, 476, 1273, 1744, 1488, 1659, 1604, 481, 4313, 1499, 1016, 4073, 1777, 4274, 487, 1775, 4205, 1526, 1697, 2000, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 3783, 3765, 491, 3699, 3792, 4290, 4090, 2012, 1803, 3642, 1322, 502, 1333, 1890, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1366, 4027, 3478, 2959, 3197, 1595, 3413, 518, 1675, 1797, 2315, 1999, 3759, 1215, 4122, 1730, 3966, 3911, 3289, 1821, 530, 1874, 1038, 3767, 1929, 3683, 1338, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 2598, 552, 3819, 1259, 4062, 2841, 3515, 4301, 3738, 1567, 1270, 3857, 1257, 1238, 3662, 561, 1058, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 1912, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 1409, 4195, 4223, 1540, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1814, 4443, 3761, 1346, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1705, 1861, 4120, 4417, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 1903, 4459, 1563, 591, 594, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1088, 3888, 1368, 3827, 4103, 1571, 1438, 1093, 612, 1094, 3701, 4389, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2771, 1339, 3875, 3070, 2557, 2795, 2906, 3118, 1614, 1947, 4479, 3766, 635, 1813, 636, 3706, 1110, 640, 1111, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1585, 1766, 3221, 2643, 2739, 3920, 2307, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2695, 3293, 1121, 1122, 3264, 655, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3994, 1319, 4467, 1623, 664, 1128, 1129, 1130, 670, 1527, 671, 1772, 5005, 1933, 1731, 1793, 3342, 3822, 1601, 3905, 694, 1414, 1795, 1372, 1695, 1866, 4115, 1719, 1920, 1544, 703, 4031, 4305, 1636, 1393, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1902, 4182, 707, 708, 4476, 714, 1841, 4234, 1314, 4096, 4217, 1627, 1953, 1201, 3787, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 3705, 1195, 3859, 1164, 1165, 1745, 1973, 1168, 3807, 4307, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X³ of SEQ ID NO: 5014 is K or R. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 4177, 1289, 740, 741, 18, 745, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 23, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 34, 35, 36, 37, 38, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 45, 756, 46, 48, 1952, 758, 49, 3122, 2551, 3718, 3484, 3577, 759, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 760, 53, 3925, 55, 3654, 56, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 63, 64, 768, 771, 65, 66, 67, 68, 3816, 2599, 2706, 74, 3865, 1549, 1361, 3882, 3713, 1942, 1312, 4501, 76, 77, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 82, 4065, 83, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 90, 91, 779, 1180, 92, 785, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 794, 795, 104, 105, 106, 1849, 108, 1579, 110, 1906, 113, 1444, 1344, 116, 802, 117, 118, 121, 803, 804, 1463, 805, 122, 124, 125, 127, 807, 132, 809, 810, 133, 1978, 812, 135, 136, 137, 138, 813, 140, 815, 1326, 141, 142, 143, 144, 145, 1634, 1302, 817, 146, 818, 147, 148, 149, 151, 152, 153, 154, 155, 819, 820, 157, 159, 160, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 826, 827, 181, 828, 182, 829, 184, 185, 186, 187, 188, 189, 830, 191, 192, 193, 194, 195, 196, 1391, 197, 200, 201, 202, 203, 204, 205, 832, 833, 206, 834, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 215, 1896, 1522, 3490, 838, 217, 218, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 226, 227, 230, 231, 842, 232, 233, 844, 236, 237, 851, 852, 853, 1536, 240, 854, 242, 243, 244, 245, 246, 247, 249, 250, 251, 252, 253, 254, 255, 857, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 264, 1241, 265, 266, 866, 1477, 267, 867, 869, 870, 271, 871, 872, 272, 1252, 273, 1591, 275, 1980, 276, 876, 877, 277, 278, 279, 1892, 1539, 880, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 282, 1799, 283, 1626, 1374, 287, 1620, 1290, 1354, 888, 291, 1956, 889, 292, 4324, 293, 4138, 891, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1515, 1617, 1961, 304, 306, 1589, 4370, 308, 309, 894, 3646, 4059, 1431, 1331, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 898, 321, 322, 899, 1958, 901, 325, 902, 326, 1491, 329, 330, 905, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 1762, 4472, 1472, 1529, 4057, 1976, 4507, 1583, 338, 911, 1711, 340, 912, 2013, 341, 4440, 917, 344, 918, 919, 921, 922, 347, 351, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 925, 1782, 926, 927, 3610, 357, 359, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 1211, 1873, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 1359, 1734, 3650, 1910, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 390, 391, 4406, 4341, 1480, 395, 1714, 1422, 396, 397, 3618, 4433, 1177, 3898, 398, 949, 950, 399, 951, 400, 1965, 4471, 952, 402, 2475, 403, 404, 4139, 1482, 3602, 4434, 3721, 1592, 1519, 1352, 4202, 4409, 1977, 1917, 407, 408, 1631, 1684, 409, 3889, 958, 959, 412, 960, 414, 415, 961, 1905, 416, 963, 417, 3675, 1833, 3974, 420, 421, 965, 966, 969, 970, 422, 1897, 423, 4133, 3830, 972, 424, 973, 427, 1708, 4141, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 434, 1606, 979, 2604, 2895, 436, 3448, 1692, 983, 3862, 4055, 4358, 984, 985, 1664, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 987, 988, 990, 451, 452, 991, 992, 1728, 994, 995, 454, 1696, 3116, 1869, 456, 1386, 999, 3879, 2698, 1001, 461, 1447, 462, 464, 4425, 1645, 1231, 1468, 472, 473, 476, 1273, 1007, 1744, 1488, 1659, 477, 1604, 481, 4313, 482, 483, 1499, 484, 1016, 4073, 1777, 1458, 4274, 487, 1775, 4205, 1526, 1697, 1017, 2000, 489, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 491, 1948, 3699, 1735, 3792, 4290, 495, 4090, 496, 2012, 1803, 3642, 1322, 498, 1021, 1022, 502, 1333, 503, 1023, 1890, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1029, 1366, 2112, 1261, 4027, 3478, 3763, 2959, 517, 3197, 1595, 3413, 1448, 518, 1675, 1797, 520, 1999, 3759, 1215, 4122, 1730, 524, 526, 3966, 3911, 529, 3289, 1821, 530, 531, 1874, 1038, 536, 537, 3767, 1929, 1041, 1042, 3683, 542, 1338, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 546, 4240, 3580, 1046, 1047, 550, 2598, 551, 552, 3819, 1259, 4062, 2841, 1050, 3515, 4301, 1052, 1053, 3738, 1567, 1270, 3857, 1055, 1257, 1238, 3662, 561, 562, 1058, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 572, 1912, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1451, 1654, 3934, 4080, 4352, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 1950, 1963, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 1559, 1250, 1555, 4114, 1818, 1075, 1076, 1077, 1704, 4448, 1078, 1079, 1786, 585, 3354, 1832, 3432, 2891, 2505, 1903, 1081, 1082, 4459, 1083, 1563, 590, 591, 1085, 594, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 600, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1087, 1088, 3888, 1368, 3827, 4103, 606, 1090, 1571, 1091, 1438, 1092, 1093, 612, 1094, 3701, 4389, 613, 1603, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1100, 1702, 1101, 1667, 1384, 623, 3700, 1788, 1600, 624, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4860, 2557, 2795, 2906, 3118, 1614, 1947, 4479, 3766, 632, 1104, 1105, 633, 1813, 636, 3706, 1110, 640, 1111, 641, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 1114, 1766, 3221, 2643, 2739, 3920, 644, 1116, 645, 646, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2369, 2695, 3293, 650, 651, 1120, 652, 1121, 3264, 655, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3994, 1319, 4467, 1802, 1227, 1623, 662, 663, 664, 1124, 1125, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 1135, 672, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 679, 1142, 1143, 681, 1145, 682, 685, 3822, 689, 690, 691, 1147, 1601, 3905, 694, 695, 1414, 1150, 1795, 1372, 1695, 1866, 4115, 1719, 698, 1920, 699, 700, 1544, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1854, 1902, 1510, 4182, 706, 707, 708, 4476, 1245, 714, 1841, 4234, 1314, 4096, 717, 1155, 4217, 1156, 723, 1157, 1627, 725, 1159, 1953, 1160, 1201, 727, 3787, 3747, 730, 1846, 3815, 2005, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 734, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1628, 3705, 1195, 3859, 1164, 1165, 1166, 1745, 1973, 1168, 3807, 4307, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X⁶ of SEQ ID NO: 5014 is K or R. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 738, 4177, 1289, 740, 14, 743, 744, 17, 3477, 1548, 3051, 2982, 2877, 746, 19, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 22, 1638, 748, 24, 749, 27, 1703, 1836, 28, 3660, 29, 750, 1640, 33, 35, 36, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 44, 45, 756, 47, 48, 1952, 3122, 2551, 3718, 3484, 3577, 1308, 3960, 1378, 2994, 3080, 2589, 3681, 51, 760, 762, 3925, 3654, 763, 59, 60, 4086, 1740, 1660, 62, 1966, 63, 2438, 768, 66, 67, 68, 3816, 2599, 2706, 72, 73, 74, 3865, 1549, 1361, 3882, 773, 3713, 1942, 1312, 4501, 76, 1413, 775, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 1356, 4065, 1294, 1484, 85, 86, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 780, 1180, 92, 781, 782, 783, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 1936, 1590, 98, 99, 789, 790, 1298, 1688, 791, 792, 2007, 102, 103, 104, 105, 107, 108, 1579, 1906, 111, 798, 112, 799, 800, 1444, 801, 114, 115, 1344, 116, 802, 117, 118, 119, 121, 803, 1463, 1760, 806, 126, 128, 807, 129, 131, 808, 133, 1978, 811, 812, 135, 136, 137, 138, 814, 140, 1326, 141, 142, 143, 2344, 816, 1634, 1302, 817, 818, 147, 148, 149, 150, 151, 154, 155, 819, 820, 156, 157, 158, 161, 162, 165, 822, 168, 169, 170, 823, 172, 1651, 173, 1483, 174, 825, 176, 178, 180, 827, 181, 828, 4911, 184, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 198, 199, 200, 201, 202, 203, 205, 832, 206, 834, 207, 208, 209, 210, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 225, 228, 229, 230, 231, 842, 232, 233, 234, 238, 847, 239, 850, 851, 853, 1536, 240, 241, 242, 243, 244, 245, 247, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 864, 263, 2318, 865, 2326, 264, 1241, 266, 1477, 867, 268, 868, 269, 270, 869, 870, 271, 871, 872, 272, 873, 1252, 1591, 875, 274, 275, 276, 876, 877, 277, 278, 280, 1892, 1539, 881, 3601, 3877, 1460, 282, 1799, 284, 1626, 286, 1374, 1620, 1290, 1354, 887, 1956, 889, 292, 4324, 4138, 891, 296, 3903, 297, 3829, 3809, 4271, 3844, 1436, 300, 1617, 1961, 302, 304, 305, 2147, 1589, 4370, 307, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 318, 319, 322, 1958, 323, 324, 901, 1491, 328, 329, 4484, 907, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 3804, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 3548, 3179, 3407, 3841, 3347, 3142, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 344, 920, 921, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 354, 1782, 927, 3610, 356, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 364, 1279, 365, 1543, 366, 367, 4049, 1633, 1722, 369, 1495, 1566, 373, 1211, 1726, 1442, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 4149, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 3902, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3687, 4318, 4243, 3866, 3704, 4172, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 1584, 4093, 4453, 4210, 4009, 4264, 4339, 1738, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1336, 3894, 3576, 4314, 3695, 1850, 4362, 1815, 3638, 4454, 1661, 4504, 1359, 3650, 1305, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 1283, 3861, 3644, 4259, 1418, 1176, 4216, 1421, 3992, 4423, 4253, 3748, 4119, 1297, 1954, 4450, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 4275, 4492, 4365, 4118, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 4470, 3941, 4348, 3587, 3818, 4350, 3821, 3929, 3824, 4465, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 3627, 3777, 1371, 3685, 4258, 3812, 1581, 4124, 4508, 4500, 3652, 3972, 1528, 3717, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 3758, 4510, 3742, 1710, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1997, 1701, 4280, 4006, 1984, 3833, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1324, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 3826, 1992, 1656, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1410, 1823, 1498, 1329, 386, 940, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1859, 4183, 1403, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 3937, 3801, 1787, 1214, 4483, 4201, 1845, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 953, 401, 403, 955, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4409, 1977, 405, 1631, 1684, 409, 3889, 2117, 411, 413, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 1272, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 978, 4400, 1606, 980, 2604, 2895, 436, 3448, 2188, 438, 1692, 442, 3862, 4055, 4358, 2276, 985, 1664, 443, 4309, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3985, 3535, 1306, 4084, 3282, 1780, 448, 990, 991, 1485, 992, 1728, 993, 994, 1696, 997, 3116, 1869, 456, 1386, 1000, 3879, 2698, 460, 1001, 461, 1447, 1002, 1003, 463, 464, 4425, 465, 1004, 466, 469, 1231, 1468, 470, 1005, 476, 1273, 1744, 1488, 1659, 1604, 479, 1013, 1014, 481, 4313, 1499, 1016, 4073, 1777, 485, 4274, 487, 1775, 4205, 1526, 1697, 2000, 488, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 4473, 4085, 4401, 3783, 3765, 1538, 3870, 491, 3699, 3792, 4290, 494, 2421, 4090, 2012, 1803, 3642, 1322, 1020, 502, 1333, 504, 1890, 507, 3608, 1732, 1864, 1816, 1531, 513, 3636, 514, 1699, 1027, 1366, 4950, 4027, 3478, 2959, 1293, 3197, 1595, 3413, 518, 1032, 1033, 1675, 1797, 2315, 521, 1999, 3759, 1215, 4122, 1730, 3966, 1035, 4973, 528, 3911, 3289, 1821, 530, 532, 1874, 533, 1038, 538, 539, 3767, 1929, 3683, 1338, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 548, 549, 2598, 552, 553, 3819, 1259, 4062, 554, 2841, 3515, 1433, 1323, 4301, 555, 558, 3738, 1567, 559, 1054, 1270, 3857, 2175, 1257, 1238, 3662, 561, 1058, 563, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 1912, 573, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 4195, 4223, 1540, 4455, 4512, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1814, 4443, 3761, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 1287, 1713, 1556, 1736, 1995, 1705, 1861, 4120, 4417, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1712, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 1903, 4459, 589, 1563, 1084, 591, 592, 594, 595, 1858, 596, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 1412, 4017, 4477, 1794, 602, 4263, 3072, 2009, 1754, 3888, 603, 604, 1368, 3827, 4103, 1571, 1438, 611, 1093, 612, 1094, 3701, 4389, 614, 615, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2473, 1423, 2771, 1339, 3875, 3070, 2015, 2557, 2795, 2906, 2103, 3299, 3118, 4576, 1103, 1614, 1947, 631, 4479, 3766, 1107, 635, 1813, 636, 2431, 637, 1109, 639, 3706, 1110, 640, 642, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1568, 1766, 3221, 2643, 2739, 3920, 647, 1801, 4279, 3762, 1637, 1509, 648, 1117, 1119, 2965, 2695, 3293, 4722, 1121, 653, 1122, 3264, 655, 656, 657, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3537, 3994, 1319, 4467, 1623, 660, 1123, 664, 1126, 1128, 1129, 1130, 670, 1527, 671, 1772, 1137, 5005, 1933, 1731, 1793, 3342, 1140, 1141, 687, 3822, 1601, 1148, 693, 3905, 694, 1414, 1149, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 1920, 4999, 1544, 703, 4031, 4305, 1636, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 4028, 3989, 704, 1493, 1902, 1152, 4182, 707, 708, 709, 4476, 1375, 713, 714, 1841, 4234, 1154, 1314, 4096, 718, 719, 720, 2063, 1311, 721, 4217, 1627, 1158, 1953, 1201, 3787, 729, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1805, 3705, 1195, 3859, 1164, 1165, 2351, 2423, 1745, 1973, 3807, 4307, 1169, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X³ of SEQ ID NO: 5014 is not D. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 2144, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 2167, 52, 760, 53, 2389, 4755, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2379, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 5009, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 4817, 2260, 1626, 2082, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2338, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 4937, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2345, 4471, 952, 953, 401, 402, 2475, 403, 404, 4758, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 4919, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 2055, 1692, 982, 2388, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 4874, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 1697, 1017, 2000, 4692, 4795, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4699, 4608, 4781, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2067, 1031, 2228, 1448, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2225, 4240, 3580, 4680, 1046, 548, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4603, 4762, 4819, 2221, 4636, 4992, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 4628, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 2275, 1166, 4968, 4912, 2423, 737, 1167, 4989, 4684, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X⁶ of SEQ ID NO: 5014 is not D. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 2167, 52, 760, 53, 2389, 4934, 4951, 4755, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4691, 107, 2440, 1849, 108, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 5009, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 4596, 2020, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 4914, 4947, 196, 1391, 197, 4534, 4726, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 268, 868, 269, 4668, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 2260, 285, 1626, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 2408, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 1635, 4820, 905, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2338, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 4057, 4937, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2343, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 401, 2475, 403, 404, 4758, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 2055, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 442, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 2142, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2210, 2247, 2478, 2047, 496, 4620, 4978, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 4699, 4608, 4781, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4805, 2065, 1890, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 2067, 1031, 2228, 1448, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2084, 2225, 4240, 3580, 4680, 1046, 548, 2062, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4577, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4603, 4762, 4819, 2221, 4636, 4992, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4541, 2200, 4580, 4858, 648, 649, 1117, 4780, 4800, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 653, 654, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4606, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 4879, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4642, 722, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 2024, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4628, 4294, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4835, 2259, 4571, 2275, 1166, 4968, 2250, 2423, 737, 1167, 4989, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X³ of SEQ ID NO: 5014 is not D and X⁶ of SEQ ID NO: 5014 is not D. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 2167, 52, 760, 53, 2389, 4755, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 2356, 784, 785, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4691, 107, 2440, 1849, 108, 797, 4736, 2509, 2018, 2227, 4787, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 5009, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 4914, 4947, 196, 1391, 197, 4534, 4726, 198, 199, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2448, 841, 842, 232, 233, 4782, 234, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 268, 868, 269, 4668, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 2260, 1626, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 311, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 1635, 4820, 905, 331, 4706, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4561, 333, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2338, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 4057, 4937, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2345, 4471, 952, 953, 401, 2475, 403, 404, 4758, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 2055, 1692, 982, 2388, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 1697, 1017, 2000, 4692, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2210, 2247, 2478, 2047, 496, 4620, 4978, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4699, 4608, 4781, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4805, 2065, 1890, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2067, 1031, 2228, 1448, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2225, 4240, 3580, 4680, 1046, 548, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 595, 4931, 2407, 1858, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4607, 4719, 1116, 645, 646, 4611, 2353, 4603, 4762, 4819, 2221, 4636, 4992, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4541, 2200, 4580, 4858, 648, 649, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 653, 654, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4738, 4811, 4570, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 4628, 4294, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4835, 2259, 2275, 1166, 4968, 2423, 737, 1167, 4989, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X³ of SEQ ID NO: 5014 is not E. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 52, 760, 53, 2389, 4934, 4951, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 2379, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 5009, 144, 145, 816, 4654, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 4911, 182, 4582, 4873, 4596, 2020, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4553, 4772, 4817, 2260, 285, 1626, 2082, 885, 286, 1374, 886, 2119, 2468, 287, 2408, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 303, 304, 305, 2452, 2147, 306, 2293, 1589, 893, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 2338, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 4937, 2048, 1976, 4507, 1583, 338, 2078, 2372, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2343, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 402, 2475, 403, 404, 4758, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 427, 1708, 4676, 428, 4141, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 442, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 2142, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 4795, 2480, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 1031, 2228, 1448, 518, 2057, 2305, 2133, 2061, 4526, 4617, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2084, 4240, 3580, 4680, 1046, 548, 2062, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4747, 1614, 1947, 2237, 630, 631, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4577, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 1117, 4780, 4800, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4606, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 4879, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4642, 722, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 730, 731, 2024, 1846, 2507, 2368, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 4571, 2275, 1166, 4968, 2250, 4912, 2423, 737, 1167, 4989, 4684, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X⁶ of SEQ ID NO: 5014 is not E. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 2144, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 2167, 52, 760, 53, 2389, 4934, 4951, 4755, 761, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 2379, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 4596, 2020, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 4817, 2260, 285, 1626, 2082, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 1620, 1290, 2425, 2482, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 890, 294, 295, 4138, 891, 2297, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 375, 2343, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 401, 402, 2475, 403, 404, 4758, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 421, 965, 966, 967, 4919, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 2188, 437, 438, 2055, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 2474, 442, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 453, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 4874, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4846, 4650, 4595, 2195, 4681, 2142, 487, 4710, 1775, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 4795, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 4699, 4608, 4781, 499, 2049, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 2067, 1031, 2228, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 4240, 3580, 4680, 1046, 548, 2062, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 1086, 601, 4017, 4477, 1794, 2483, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4577, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4603, 4762, 4819, 2221, 4636, 4992, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 1117, 4780, 4800, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 2456, 4606, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 677, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 718, 1155, 719, 720, 2063, 1311, 721, 4642, 722, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 2024, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4628, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 4571, 1166, 4968, 2250, 4912, 2423, 737, 1167, 4989, 4684, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

A VP capsid polypeptide may have a 581 to 589 region having a sequence of SEQ ID NO: 5014, wherein X³ of SEQ ID NO: 5014 is not E and X⁶ of SEQ ID NO: 5014 is not E. In some embodiments, the 581 to 589 region has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 52, 760, 53, 2389, 4934, 4951, 761, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 2379, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 144, 145, 816, 4654, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 4911, 182, 4582, 4873, 4596, 2020, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4689, 281, 878, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4553, 4772, 4817, 2260, 285, 1626, 2082, 885, 286, 1374, 886, 2119, 2468, 287, 1620, 1290, 2425, 2482, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 890, 294, 295, 4138, 891, 2297, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 303, 304, 305, 2452, 2147, 306, 2293, 1589, 893, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 2048, 1976, 4507, 1583, 338, 2078, 2372, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 375, 2343, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 402, 2475, 403, 404, 4758, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 3675, 1833, 3974, 419, 964, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 427, 1708, 4676, 428, 4141, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 2188, 437, 438, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 2474, 442, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 453, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4846, 4650, 4595, 2195, 4681, 2142, 487, 4710, 1775, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 4795, 2480, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 499, 2049, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 1031, 2228, 518, 2057, 2305, 2133, 2061, 4526, 4617, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1042, 3683, 2100, 4853, 2300, 2165, 540, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 4240, 3580, 4680, 1046, 548, 2062, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 1086, 601, 4017, 4477, 1794, 2483, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 4818, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4850, 1103, 4747, 1614, 1947, 2237, 630, 631, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4577, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 1117, 4780, 4800, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 2456, 4606, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 677, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 718, 1155, 719, 720, 2063, 1311, 721, 4642, 722, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 730, 731, 2024, 1846, 2507, 2368, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 4571, 1166, 4968, 2250, 4912, 2423, 737, 1167, 4989, 4684, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

RPE Tissue-Tropic AAV VP Capsid Polypeptides. Described herein are engineered AAV VP capsid polypeptides comprising a variant 581 to 589 region predicted to confer increased RPE tissue tropism compared to a wild type AAV VP capsid polypeptide (e.g., a wild type AAV5 capsid polypeptide of SEQ ID NO: 1), generated and selected using machine learning. In some embodiments, an RPE tissue-tropic engineered AAV VP capsid polypeptide may also have tropism for choroid tissue. TABLE 9 provides 581 to 589 region sequences predicted to confer RPE tissue tropism or preference.

TABLE 9
Additional Exemplary 581 to 589
Region Sequences for RPE Targeting
SEQ ID
NO   581 to 589 Region
4514 QTEFVCSGK
4515 TEINDTKST
4516 TNLPMEMIP
4517 HPDPTAEYA
4518 NHDVTPREY
4519 EPTACGVEI
4520 EAVQTAEHN
4521 DPNQCWMMN
4522 TWLELDMEC
4523 HATVFDENN
4524 TIPMHDQAK
4525 TWLDKHCVA
4526 PPTVTQCMH
4527 TVPCNGEHS
4528 NEHTDVQGE
4529 HATMCNQKS
4530 TGTVMQKAD
4531 TVPMKGMEE
4532 NMTHTQNEI
4533 DQTLCEEPP
4534 EHTIFGESG
4535 EVENKIYGH
4536 THGSVCRPD
4537 VATPECQAY
4538 GNEPDVQYN
4539 NEHSTGKAC
4540 NTDWLCDMN
4541 TNMMCNEGP
4542 EPDYKVAQP
4543 PETVGYKHC
4544 DTQFLDMVK
4545 NATMYVEER
4546 DVNPRGEAI
4547 GDNVTVEAP
4548 TITCQEARC
4549 SSHNLCCVT
4550 TATAHCMEG
4551 TPFADLCVC
4552 YTDSANNAI
4553 FQMQMHAYA
4554 TTDFAGMVQ
4555 THTCNWAEQ
4556 DALNREEAC
4557 TVENKSADA
4558 TVEMWNYCC
4559 IEPATPHCD
4560 THQNTFLTV
4561 HAVNTCEEQ
4562 MQNPFYEQT
4563 MEQKNETSG
4564 FVTDKEAVA
4565 TCTDIFHQA
4566 VTLMKDSAC
4567 ENEPGQTAC
4568 VYHCPSEED
4569 TTCWINNEG
4570 VQCVCLRNY
4571 YQDTFHEAN
4572 PEQTKACYA
4573 QATPCCEQP
4574 GNEACPKQI
4575 VEHTVCEIC
4576 TEQFAKNSA
4577 TIDVTHAAC
4578 PSTVNHCFT
4579 DHTPGGEPP
4580 TNTPASHDA
4581 TILMKHASQ
4582 EESQTVLIY
4583 SEIASHKLT
4584 HAQMQHCYV
4585 DADTWVMMC
4586 NGTSAPCML
4587 YICPSHNLN
4588 TVEIWNHDT
4589 MILTHTDVK
4590 TNLPDHMSY
4591 ATGQKEMIC
4592 NATFKNEMP
4593 NYQFCNEAA
4594 CQTVHYCPI
4595 NEVIAYCRH
4596 EFDPPNRYH
4597 TVLEMWMMC
4598 MVQATHCSI
4599 NEDVYHSEC
4600 TTVNLNREP
4601 FIPATNAGS
4602 NHDTCNEGW
4603 TNEDQHCAI
4604 PTEQTNAEA
4605 TEPGDHCEY
4606 TVDQMYAIA
4607 TMQSVNKGA
4608 NTENEAHAQ
4609 HAQNREACN
4610 TVEPTFAGY
4611 TMVQHTKSI
4612 YTFQCNAEA
4613 EAQFNSEHT
4614 NQTPGDKDG
4615 EHFNPVEYT
4616 PNEQYGNWI
4617 PPVQVGFAS
4618 TGHMNCEYY
4619 LNTVCYDKY
4620 NQTACYKWD
4621 VAYQKVEPT
4622 VTPPTNQYC
4623 NETDVEMMK
4624 EATGCNESD
4625 VATQCSAER
4626 ATVMTHSAC
4627 TEHQFAQKS
4628 YGEETSMTC
4629 TMEQTHNEY
4630 IPCPTCYGH
4631 EACDGVKIH
4632 DAQCYGLPS
4633 TIEWMNEMY
4634 ETHVQYMPD
4635 HATIRGEHQ
4636 TNEMGVERY
4637 QTQAPDCYA
4638 TWFIYCMEH
4639 NEQYCEHIT
4640 LHCCTCKEY
4641 EFHVCYADN
4642 VTDAYGYEP
4643 TQCMWDNEN
4644 TIMQMHNEG
4645 TNDPLVMEC
4646 TEHCWMYTC
4647 EFQACSKYA
4648 TIQPFMASD
4649 GLPQCNEHR
4650 NETWVVCMK
4651 THDVRCFFA
4652 VLTNEEKDC
4653 ELTFHNEYP
4654 DTVNMYLRQ
4655 EVTVWHEHN
4656 CVTAEHNWI
4657 TEHAYVKAI
4658 SETHTCYGV
4659 ATHLVQMYQ
4660 PAQAWVQTC
4661 HAQATFEVC
4662 VHNAQVEMA
4663 DVENLCAQA
4664 PETVNHKHA
4665 NTCPKANEG
4666 VTFMMNQCK
4667 VMTPPNEYC
4668 EVQIYSEAP
4669 YTDAFANEH
4670 FALCCNEPQ
4671 FVTIYAEAC
4672 IATPPDEQC
4673 DTHWLCCEV
4674 TPGEYHMEC
4675 TATVECCRW
4676 LWLFHPFAK
4677 DITPACLHA
4678 PETWLGEPC
4679 YQADCDATP
4680 QNLDKSGAC
4681 NEYVTCQGD
4682 ATQMIWMQH
4683 HATNYVIES
4684 YTCESDREA
4685 NTFNEYAWL
4686 NTLNKNAYG
4687 TVESLNCCP
4688 TMIMWYKGA
4689 FAQPVYEGQ
4690 VEEATCFVT
4691 DATMIMYYQ
4692 NHTNWCESS
4693 PTEAITCQA
4694 ASDFICKEC
4695 EDQACNHSN
4696 ETGQNHMCP
4697 TVENWGMAQ
4698 PNENQHQYL
4699 NTEIACQLK
4700 VTQNACLRN
4701 GLDAIYQMK
4702 ATVNDYLRP
4703 MPCAQHALI
4704 ESDATCCTD
4705 TWLCPVEEP
4706 HACQQVEAA
4707 VQTADMQAS
4708 TVEYLVHMP
4709 EVTCNWAQY
4710 NFQVTHKQI
4711 HNTATNDMQ
4712 LNTMMVQIK
4713 VQYQENARP
4714 TSEAPHQYK
4715 VKPEFHNLY
4716 TTTVENEMG
4717 DMQNTNHAI
4718 VETVTDAQC
4719 TMQYAWMSP
4720 NATVFEACN
4721 TATFHYAWP
4722 TPPNDKEEN
4723 TMLNSGEFN
4724 TPEVMHNTA
4725 MVHATNADS
4726 EHTVANEAS
4727 NTNADVAER
4728 HNTNWCEEY
4729 IPVTFNNET
4730 TPNPTDMEI
4731 VEQMYNEPP
4732 VNEFYHQIW
4733 LVDQKNMMQ
4734 TINEFHMQS
4735 TMCFNGEYH
4736 DEHATQCYA
4737 TVNWRGEQA
4738 VPVNPGEHK
4739 VITQTNHEG
4740 VTPWCFEAC
4741 ENTCFYHFD
4742 AINAYNEEH
4743 VAQGFANEA
4744 ATQPTPMAH
4745 TAQNVTEFD
4746 PFQQFNEAI
4747 TFHAFIQYK
4748 TMQMTDQAH
4749 ETVRTGSNC
4750 VEWACTNEQ
4751 EPCPTHKAG
4752 NSEFDVARG
4753 MVTAEWADI
4754 LVHAFYEQR
4755 ATEPPGVES
4756 VECMQHEHY
4757 TFEMFNEGP
4758 LITLCYEFH
4759 MQLPVTMRG
4760 TMDCKWMQC
4761 NACTCNNEH
4762 TNEFMWEKA
4763 HEAQYNEHI
4764 MIGVTNHAP
4765 GEFVTHNLT
4766 ATQHIYDAA
4767 YTQYEVACP
4768 MQTDHMCQK
4769 CENLGVEFK
4770 TSDVAWEGH
4771 TVTAFYEIP
4772 FQTAPHQYC
4773 TVEQCSHAG
4774 ENEPPVTVI
4775 EIQDKHEAL
4776 SNQQCEEVI
4777 SQTIACREN
4778 MQTPSHKSA
4779 TEERDGNAC
4780 TPDMKGYQP
4781 NTESKGEAC
4782 EQTVFHRLC
4783 HIDVQCEPD
4784 TPVQNHHIC
4785 PSDALTFAI
4786 EQGAFCGEP
4787 DENWGVEYS
4788 EHVQCDAID
4789 PETFAGVQA
4790 ENEMCPMMN
4791 DKELCNESC
4792 TATPHQKLA
4793 VEHCYNEGF
4794 GETVHACKI
4795 NHTPTDQIA
4796 NEFVTHYQT
4797 TNLNYFHYA
4798 MQNADMTAI
4799 TEVINEASH
4800 TPDNLHEGY
4801 TADSKVEPN
4802 VEVQCNEQT
4803 GVQCNTLMI
4804 NTLNLVAKD
4805 NTPQLHNEI
4806 APTPTCCSA
4807 TITFCYKSD
4808 IIPPDVQMK
4809 EATVINDFY
4810 DVEPLVATC
4811 VQCPLYMHP
4812 TSEQKHEAS
4813 PVTPYGEEL
4814 THPMAYKEQ
4815 YAQPCTEFP
4816 DVHAKYMAH
4817 FQTINDKSA
4818 TDHWEMKPI
4819 TNEFQNMQY
4820 GYQPWHECI
4821 DHTQLVREA
4822 EVTADNHEN
4823 TIYPAGEAQ
4824 VLDNTHNEA
4825 VATPTCYGN
4826 VTPNEYLPG
4827 TGQATEMQN
4828 VEQCLVAAC
4829 VPMQCDVDA
4830 SETVWMKHA
4831 TILVCCQAY
4832 PILFHNETP
4833 VTECPVEQP
4834 DIIQCVLVT
4835 YQAPPHATC
4836 GSDACYKFQ
4837 TIPQNTAPV
4838 TDVQGHMCI
4839 YQCPPDRHA
4840 TVLCGERIH
4841 GPTAEACFC
4842 NEQSCTAHI
4843 TNLIMCMYV
4844 TSAPYVEEP
4845 HMLIYGNYH
4846 NETDCYASA
4847 TAEMVVHCA
4848 DGTPMVRYY
4849 TQMASYAEH
4850 TEVTFNLHQ
4851 TVEMTCMMY
4852 EHLCNTKAA
4853 QHQAFHEAC
4854 PTTVFHDMP
4855 TAEMNYAIA
4856 HMTCFNEHA
4857 HHTPAGYYQ
4858 TNTPDGEDC
4859 VEEPTHSVQ
4860 TDKHGEMII
4861 VACNWGSLT
4862 TPPILCEMA
4863 YMPVNNEQI
4864 DIEFKCEHY
4865 LVLVPTDAA
4866 THLHICNPD
4867 MAQPGVFYA
4868 TITFVQEVC
4869 TDMPANASE
4870 TVLNCMEEN
4871 FQEDFYALI
4872 QTVVEHCPP
4873 EETAIPADC
4874 MQEPPDMYY
4875 TEHFHNMPK
4876 TELNRGEDI
4877 TPVWQNEGK
4878 TATIRDEDY
4879 VRDSLEART
4880 ETNACDART
4881 TIPPANEHA
4882 SATFPNEYA
4883 EPVPDYEHG
4884 AADTVHMQY
4885 VTFIEHLNQ
4886 TGLIFAEMG
4887 HVEFIGSAY
4888 TIQCPCEAY
4889 AEGVTHAII
4890 EPNVTVAAS
4891 NTVEPDNQA
4892 NWLVEWKAD
4893 TILPVYEHP
4894 VTVMIHAIC
4895 VSMQMHAKC
4896 TITFLCEED
4897 STQKCYEHG
4898 TWLVCCNKS
4899 TSTVENMDP
4900 MIEPCGMLQ
4901 TECCNGESD
4902 IATVHCMMK
4903 VTEMVHAAY
4904 NEQHTVEMR
4905 NECFKVEHD
4906 QILMKCETV
4907 HATFNCEVQ
4908 TEEMLVCPP
4909 TQHALDMAR
4910 TVFLHAHIA
4911 EEQGEKATI
4912 YSAVQDEER
4913 AWVATCNDQ
4914 EHNSTYEFD
4915 ENEMMQNDT
4916 TVLVHGMEN
4917 TTFAKNEGC
4918 TMGVQCMEC
4919 LTEPLDRAA
4920 EIDPACRHT
4921 VTCQNEAAC
4922 PFTVAYEGN
4923 ETDAFHAYA
4924 VRLNFCEFD
4925 AITDKNEGC
4926 YHCPFGMQP
4927 YAEQFTAKI
4928 ENTALNDCG
4929 DITNLCESC
4930 ERLPWVQCD
4931 SITCPGESY
4932 TDTVFPMDR
4933 DRLNFCEHC
4934 ATDAPCEYG
4935 TKLYHYMET
4936 SETCKYAIC
4937 HTVCCEFEG
4938 NTPFHDCYG
4939 FAQITEKHA
4940 MHTSLVEPC
4941 TICPFDENG
4942 AEPQKHEAC
4943 HSEQNGEPR
4944 TPQNLNHAH
4945 TVHTCLEAG
4946 GPESPVNEN
4947 EHQFTCEAC
4948 GSHAWMQVT
4949 TMQMCFKYA
4950 PILPCKEHC
4951 ATDNKNHSE
4952 TVHLCYADI
4953 ENDFINYGR
4954 TVLPNYEHA
4955 LVTNACVEI
4956 THQPFCKHA
4957 PEQWYGSAI
4958 WVTMHQCCK
4959 MEQATWECC
4960 TATFQCCYQ
4961 VQDAIYCYA
4962 ERDACLEIT
4963 TVEMFAKHY
4964 ENETHYKDI
4965 TENPFHEQP
4966 ETSKPHYGC
4967 IVTNKNECC
4968 YQTWPGRDS
4969 NIVLCNEHT
4970 ETVSTHAIY
4971 DQCATQNAI
4972 EVVQNHMIP
4973 QAVHCKEAC
4974 ENEFTCCYK
4975 EWLNNSAHA
4976 YGDAYHAST
4977 EVLACDKEG
4978 NQTDFAQQC
4979 TSENMIESP
4980 DATFQDCYA
4981 MQYQVHAAP
4982 MQTMCNDKY
4983 TPVIFNEVG
4984 ATQNIMAGN
4985 TEQMCSKYA
4986 NEQWCYKHP
4987 NYTVIHYEA
4988 FQCPSGERA
4989 YSTCPNECN
4990 TVLPMIEER
4991 THNTFGYAC
4992 TNEVTCQKT
4993 SKPPGSEQS
4994 DQHCLWEAC
4995 TNMATDEYC
4996 TEEQIGPAC
4997 TGEMFNKSS
4998 TNFQADEPR
4999 VIQQFKEAC
5000 STVSYHNEA
5001 NLLPDVERG
5002 EVQPGDKCY
5003 NEDVTPCEC
5004 TWPPWCNLI
5005 TVHACKNEF
5006 NTDWLTHEA
5007 EPDANYCYS
5008 QATSTNHDA
5009 DTQNVEMAA
5010 GLVAVHEEC
5011 PEQTCYEMT
5012 NWLDGDQAC
5013 VTTVMHAIN

In some embodiments, an RPE tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 75% sequence identity to any one of SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, an RPE tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 77.7% sequence identity to any one of SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, an RPE tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, an RPE tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having at least 88.8% sequence identity to any one of SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, an RPE tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having a sequence of any one of SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two amino acid substitutions relative to any one of SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two conservative amino acid substitutions relative to any one of SEQ ID NO: 4514-SEQ ID NO: 5013.

581 to 589 Regions for Ocular Tissue Targeting

In some embodiments, provided herein are AAV5 VP capsid polypeptide having at least one mutation in a 581 to 589 region, corresponding to residues 581 to 589 of AAV5 VP1, wherein said at least one mutation drives increased ocular tissue tropism. In some embodiments, the at least one mutation may comprise mutating one or more amino acid residues to positively charged amino acid residues (e.g., K, R, or H). In some embodiments, the at least one mutation may comprise mutating one or more negatively charged amino acid residues (e.g., E or D) to residues that are not negatively charged. In some embodiments, the 581 to 589 region comprises a sequence having at least 75% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, the 581 to 589 region comprises a sequence having at least 77.7% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, the 581 to 589 region comprises a sequence having at least 88.8% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, the 581 to 589 region comprises a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two amino acid substitutions relative to any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. In some embodiments, a retina tissue-tropic VP capsid polypeptide comprises a 581 to 589 region having one or two conservative amino acid substitutions relative to any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013.

Numbered Embodiments

The following embodiments recite non-limiting permutations of combinations of features disclosed herein. Other permutations of combinations of features are also contemplated. In particular, each of these numbered embodiments is contemplated as depending from or relating to every previous or subsequent numbered embodiment, independent of their order as listed. 1. A viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513. 2. The VP capsid polypeptide of embodiment 1, wherein the 581 to 589 region comprises a sequence of any one of SEQ ID NO: 2014-SEQ ID NO: 2513. 3. A viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 4514-SEQ ID NO: 5013. 4. The VP capsid polypeptide of embodiment 3, wherein the 581 to 589 region comprises a sequence of any one of SEQ ID NO: 4514-SEQ ID NO: 5013. 5. The VP capsid polypeptide of any one of embodiments 1-4, wherein the 581 to 589 region confers increased retinal pigment epithelium tissue-tropism compared to a wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1. 6. The VP capsid polypeptide of embodiment 5, wherein the retinal pigment epithelium tissue tropism is at least 1.5-fold, at least 2-fold, at least 2.5-fold, at least 3-fold, at least 3.5-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 75-fold, at least 100-fold, at least 200-fold, or at least 500-fold higher than the wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1. 7. The VP capsid polypeptide of any one of embodiments 1-6, wherein the 581 to 589 region confers increased choroid tissue-tropism compared to a wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1. 8. The VP capsid polypeptide of embodiment 7, wherein the choroid tissue tropism is at least 1.5-fold, at least 2-fold, at least 2.5-fold, at least 3-fold, at least 3.5-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 75-fold, at least 100-fold, at least 200-fold, or at least 500-fold higher than the wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1. 9. The VP capsid polypeptide of any one of embodiments 5-8, wherein the 581 to 589 region further confers increased retina tissue tropism compared to a wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1. 10. The VP capsid polypeptide of any one of embodiments 1-9, wherein the 581 to 589 region confers decreased photoreceptor tissue-tropism compared to a wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1. 11. The VP capsid polypeptide of any one of embodiments 1-10, wherein the VP capsid polypeptide comprises an amino acid sequence at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 98.5%, at least 99%, or at least 99.5% identical to SEQ ID NO: 1. 12. The VP capsid polypeptide of any one of embodiments 1-11, wherein the VP capsid polypeptide has a sequence of SEQ ID NO: 2, wherein residues 581 to 589 of SEQ ID NO: 2 (X¹X²X³X⁴X⁵X⁶X⁷X⁸X⁹) correspond to the 581 to 589 region. 13. The VP capsid polypeptide of any one of embodiments 1-12, wherein the VP capsid polypeptide is capable of assembling into a recombinant viral capsid. 14. The VP capsid polypeptide of any one of embodiments 1-13, comprising at least one amino acid substitution as compared to each of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, and SEQ ID NO: 8. 15. The VP capsid polypeptide of any one of embodiments 1-14, wherein the VP capsid polypeptide further comprises one or more mutations outside of the 581 to 589 region relative to a wild type VP capsid polypeptide of SEQ ID NO: 1. 16. The VP capsid polypeptide of any one of embodiments 1-15, wherein the 581 to 589 region confers on a recombinant viral capsid assembled from the VP capsid polypeptide improved stability compared to a wild type AAV capsid comprising a peptide of SEQ ID NO: 1. 17. The VP capsid polypeptide of any one of embodiments 1-16, wherein the 581 to 589 region confers lower toxicity upon administration to a subject compared to a wild type VP capsid polypeptide of SEQ ID NO: 1. 18. The VP capsid polypeptide of any one of embodiments 1-17, wherein the VP capsid polypeptide further comprises one or more mutations outside of the 581 to 589 region that contributes to reduced production of neutralizing antibodies relative to a wild type VP capsid polypeptide of SEQ ID NO: 1. 19. The VP capsid polypeptide of any one of embodiments 1-18, wherein the VP capsid polypeptide further comprises one or more mutations outside of the 581 to 589 region that improves manufacturability relative to a wild type VP capsid polypeptide of SEQ ID NO: 1. 20. A recombinant viral adeno-associated virus (rAAV) capsid comprising the VP capsid polypeptide of any one of embodiments 1-19, wherein the rAAV capsid preferentially targets retinal pigment epithelium tissue. 21. A recombinant viral adeno-associated virus (rAAV) capsid comprising the VP capsid polypeptide of any one of embodiments 1-19, wherein the rAAV capsid preferentially targets choroid tissue. 22. The rAAV capsid of embodiment 20 or embodiment 21, further comprising a VP2 polypeptide comprising the 581 to 589 region and a VP3 polypeptide comprising the 581 to 589 region. 23. A recombinant adeno-associated virus (rAAV), comprising the VP capsid polypeptide of any one of embodiments 1-19 assembled into a recombinant viral capsid and a payload encapsidated by the recombinant viral capsid. 24. The rAAV of embodiment 23, wherein the rAAV preferentially targets retinal pigment epithelium tissue. 25. The rAAV of embodiment 23 or embodiment 24, wherein the rAAV preferentially targets choroid tissue. 26. The rAAV of any one of embodiments 23-25, further comprising a VP2 polypeptide comprising the 581 to 589 region and a VP3 polypeptide comprising the 581 to 589 region. 27. The rAAV of any one of embodiments 23-26, wherein the payload encodes a therapeutic polynucleotide or a therapeutic peptide. 28. The rAAV of embodiment 27, wherein the payload encodes a guide RNA, a tRNA, a suppressor tRNA, a siRNA, a miRNA, an mRNA, a shRNA, a circular RNA, or an antisense oligonucleotide (ASO), a ribozyme, a DNAzyme, an aptamer, or any combination thereof. 29. The rAAV of embodiment 27, wherein the guide RNA is a CRISPR/Cas guide RNA or an ADAR guide RNA. 30. The rAAV of embodiment 27, wherein the payload encodes a component of a CRISPR/Cas system, an adenosine deaminase acting on RNA (ADAR) enzyme, a transcriptional activator, or a transcriptional repressor. 31. A pharmaceutical composition comprising the VP capsid polypeptide of any one of embodiments 1-19, the rAAV capsid of any one of embodiments 20-22, or the rAAV of any one of embodiments 23-30. 32. A method of delivering a payload to a retinal pigment epithelium tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013. 33. A method of delivering a payload to a retinal pigment epithelium tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises the VP capsid polypeptide of any one of embodiments 1-19. 34. A method of delivering a payload to a retinal pigment epithelium tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013. 35. A method of delivering a payload to a choroid tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises the VP capsid polypeptide of any one of embodiments 1-19. 36. A method of delivering a payload to a choroid tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013; and (ii) delivering the payload to the choroid tissue. 37. A method of delivering a payload to a retinal pigment epithelium tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide of any one of embodiments 1-19; and (ii) delivering the payload to the retinal pigment epithelium tissue. 38. A method of delivering a payload to a choroid tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide of any one of embodiments 1-19; and (ii) delivering the payload to the choroid tissue. 39. The method of any one of embodiments 36-38, comprising administering the rAAV via intravitreal administration. 40. The method of any one of embodiments 36-38, comprising administering the rAAV via subretinal injection, topical mucosal administration, or systemic administration. 41. The method of any one of embodiments 32-40, further comprising expressing a therapeutic polypeptide or a therapeutic polynucleotide encoded by the payload. 42. The method of any one of embodiments 32-41, further comprising producing a therapeutic effect upon expression of the payload. 43. The method of embodiment 42, wherein the therapeutic effect is produced upon administration of from 1×10⁵ to 5×10¹⁴ rAAVs. 44. The method of embodiment 42 or embodiment 43, comprising administering an amount of the rAAV sufficient to produce the therapeutic effect without producing a toxicity in the subject. 45. A method of treating a condition in a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013. 46. A method of treating a condition in a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises the VP capsid polypeptide of any one of embodiments 1-19. 47. The method of embodiment 45 or embodiment 46, further comprising expressing the payload in a retinal pigment epithelium tissue of the subject. 48. The method of any one of embodiments 45-47, further comprising expressing the payload in a choroid tissue of the subject. 49. The method of any one of embodiments 45-48, further comprising producing a therapeutic effect in the subject. 50. A method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013; and (ii) expressing the payload in a retinal pigment epithelium tissue of the subject, thereby treating the condition in the subject. 51. A method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises the VP capsid polypeptide of any one of embodiments 1-19; and (ii) expressing the payload in a retinal pigment epithelium tissue of the subject, thereby treating the condition in the subject. 52. A method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises the VP capsid polypeptide of any one of embodiments 1-19; and (ii) expressing the payload in a choroid tissue of the subject, thereby treating the condition in the subject. 53. A method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide of any one of embodiments 1-19; (ii) delivering the payload to a retinal pigment epithelium tissue of the subject; and (iii) producing a therapeutic effect in the retinal pigment epithelium tissue, thereby treating the condition. 54. A method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide of any one of embodiments 1-19; (ii) delivering the payload to a choroid tissue of the subject; and (iii) producing a therapeutic effect in the choroid tissue, thereby treating the condition. 55. The method of any one of embodiments 50-54, comprising administering the rAAV via intravitreal administration. 56. The method of any one of embodiments 50-54, comprising administering the rAAV via subretinal injection, topical mucosal administration, or systemic administration. 57. The method of any one of embodiments 45-56, wherein the condition is an ocular condition. 58. The method of embodiment 57, wherein the ocular condition is achromatopsia, macular degeneration, cataracts, choroideremia, glaucoma, optical neuropathy, Marfan syndrome, myopia, polypoidal choroidal vasculopathy, retinitis pigmentosa, Stargardt disease, Usher syndrome, Leber congenital amaurosis, Leber hereditary optical neuropathy, Uveal melanoma, or X-linked retinoschisis. 59. The method of embodiment 57 or embodiment 58, wherein the ocular condition is Stargardt disease. 60. The method of any one of embodiments 32-59, further comprising delivering the rAAV to a retinal pigment epithelium tissue with higher tissue tropism than a wild type AAV5 capsid comprising a peptide of SEQ ID NO: 1. 61. The method of any one of embodiments 39-53, further comprising delivering the rAAV to a retinal pigment epithelium tissue with higher tissue tropism than for photoreceptor tissue. 62. The method of any one of embodiments 39-54, comprising delivering the rAAV to a retinal pigment epithelium tissue with at least 2.5-fold, at least 3-fold, at least 3.5-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 75-fold, at least 100-fold, at least 200-fold, at least 500-fold higher, or at least 1000-fold higher tissue tropism than a wild type AAV5 capsid comprising a peptide of SEQ ID NO: 1. 63. The method of any one of embodiments 32-59, further comprising delivering the rAAV to a choroid tissue with higher tissue tropism than a wild type AAV5 capsid comprising a peptide of SEQ ID NO: 1. 64. The method of any one of embodiments 39-53, further comprising delivering the rAAV to a choroid tissue with higher tissue tropism than for photoreceptor tissue. 65. The method of any one of embodiments 39-54, comprising delivering the rAAV to a choroid tissue with at least 2.5-fold, at least 3-fold, at least 3.5-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 75-fold, at least 100-fold, at least 200-fold, at least 500-fold higher, or at least 1000-fold higher tissue tropism than a wild type AAV5 capsid comprising a peptide of SEQ ID NO: 1. 66. The method of any one of embodiments 39-65, comprising administering from 1×10⁵ to 5×10¹⁴ rAAVs. 67. The method of any one of embodiments 39-66, wherein the payload encodes a therapeutic protein, therapeutic polynucleotide, a guide RNA, a tRNA, a suppressor tRNA, a siRNA, a miRNA, an mRNA, a shRNA, a circular RNA, an antisense oligonucleotide (ASO), a ribozyme, a DNAzyme, an aptamer, or any combination thereof. 68. The method of embodiment 67, wherein the guide RNA is a CRISPR/Cas guide RNA or an ADAR guide RNA. 69. The method of embodiment 67, wherein the therapeutic protein is selected from the group consisting of CNGB3, NOS2A, CFH, CF, C2, C3, CFB, HTRA1/LOC, MMP-9, TIMP-3, SLC16A8, GEMIN4, CYP51A1, RIC1, TAPT1, TAF1A, WDR87, APE1, MIP, Cx50, GJA3, GJA8, CRYAA, CRYBB2, PRX, POLR3B, XRCC1, ZNF350, EPHA2, REP1, CALM2, MPP-7, Optineurin, LOX1, CYP1B1, CAV1/2, MYOC, PITX2, FOXC1, PAX6, LTBP2, Complex I, ND, OPA1, RPE65, FBN1, TGFBR2, MTHFR, MTR, MTRR, HGF, C-MET, UMODL1, MMP-1/2, CBS, IGF-1, UHRF1BP1L, PTPRR, PPFIA2, P4HA2, SERPING1, PEDF, ARMS2-HTRA1, FGD6, ABCG1, LOC387715, CETP, NRL, RDH12, PRPH2 (RDS), RHO, RPGR, SNRNP200, NR2E3, IMPDH1, CRX, HK1, IMPDH2, PRPF3, AGBL5, ABCA1, ABCA4, CRB1, USH2A, NRP1, ND4, RLBP1, PTEN, BAP1, GNAQ, GNA11, DDEF1, SF3B1, EIF1AX, CDKN2A, p14ARF, HERC2/OCA2, VEGF, and RS1. 70. The method of embodiment 67, wherein the therapeutic polynucleotide targets an mRNA encoding a protein selected from the group consisting of CNGB3, NOS2A, CFH, CF, C2, C3, CFB, HTRA1/LOC, MMP-9, TIMP-3, SLC16A8, GEMIN4, CYP51A1, RIC1, TAPT1, TAF1A, WDR87, APE1, MIP, Cx50, GJA3, GJA8, CRYAA, CRYBB2, PRX, POLR3B, XRCC1, ZNF350, EPHA2, REP1, CALM2, MPP-7, Optineurin, LOX1, CYP1B1, CAV1/2, MYOC, PITX2, FOXC1, PAX6, LTBP2, Complex I, ND, OPA1, RPE65, FBN1, TGFBR2, MTHFR, MTR, MTRR, HGF, C-MET, UMODL1, MMP-1/2, CBS, IGF-1, UHRF1BP1L, PTPRR, PPFIA2, P4HA2, SERPING1, PEDF, ARMS2-HTRA1, FGD6, ABCG1, LOC387715, CETP, NRL, RDH12, PRPH2 (RDS), RHO, RPGR, SNRNP200, NR2E3, IMPDH1, CRX, HK1, IMPDH2, PRPF3, AGBL5, ABCA1, ABCA4, CRB1, USH2A, NRP1, ND4, RLBP1, PTEN, BAP1, GNAQ, GNA11, DDEF1, SF3B1, EIF1AX, CDKN2A, p14ARF, HERC2/OCA2, VEGF, or RS1. 71. The method of embodiment 67, wherein the payload encodes a therapeutic polynucleotide targeting ABCA1, ABCA4, or CRB1 or a transgene encoding ABCA1, ABCA4, or CRB1. 72. The method of embodiment 67, wherein the payload encodes a component of a CRISPR/Cas system, an adenosine deaminase acting on RNA (ADAR) enzyme, a transcriptional activator, or a transcriptional repressor. 73. The method of embodiment 72, wherein the component of the CRISPR/Cas system comprises a Cas3, a Cas8, a Cas10, a Cas9, a Cas4, a Cas12, a Cas13, a guide RNA, or a combination thereof. 74. The method of embodiment 72, wherein the ADAR enzyme is ADAR1 or ADAR2. 75. The method of embodiment 72, wherein the transcriptional activator is VP64. 76. The method of embodiment 72, wherein the transcriptional repressor is KRAB. 77. The method of any one of embodiments 67-76, further comprising expressing a therapeutic polypeptide or a therapeutic polynucleotide encoded by the payload. 78. The method of any one of embodiments 67-77, comprising expressing the therapeutic polypeptide or the therapeutic polynucleotide at a higher level in a retinal pigment epithelium tissue compared to a wild type AAV5 capsid comprising a peptide of SEQ ID NO: 1. 79. The method of embodiment 78, comprising expressing the therapeutic polypeptide or the therapeutic polynucleotide in a retinal pigment epithelium tissue at a level that is at least 3-fold, at least 3.5-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 75-fold, at least 100-fold, at least 200-fold, at least 500-fold higher, or at least 1000-fold higher compared to the wild type AAV5 capsid. 80. The method of any one of embodiments 32-79, comprising producing a toxicity in the subject that is lower than a toxicity produced upon administration of a comparable number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1. 81. The method of any one of embodiments 32-80, comprising producing a toxicity in the subject that is lower than a toxicity produced upon administration of a number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1 sufficient to deliver a comparable number of payloads to a retinal pigment epithelium tissue. 82. The method of any one of embodiments 32-81, comprising producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1. 83. The method of any one of embodiments 32-82, comprising producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV2 capsids. 84. The method of any one of embodiments 32-83, comprising producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV8 capsids. 85. The method of any one of embodiments 32-84, comprising producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV9 capsids. 86. The method of any one of embodiments 32-85, comprising producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1 sufficient to deliver a comparable number of payloads to a retinal pigment epithelium tissue.

EXAMPLES

Below are examples of specific embodiments for carrying out the present invention. The examples are offered for illustrative purposes only and are not intended to limit the scope of the present invention in any way. Efforts have been made to ensure accuracy with respect to numbers used (e.g., amounts, temperatures, etc.), but some experimental error and deviation should, of course, be allowed for.

The practice of the present invention will employ, unless otherwise indicated, conventional methods of protein chemistry, biochemistry, recombinant DNA techniques and pharmacology, within the skill of the art. Such techniques are explained fully in the literature.

Example 1

Identification of 581 to 589 Region Sequences that Confer Ocular Tissue Tropism

This example describes identification of 581 to 589 region sequences that confer ocular tissue tropism. The high throughput capsid engineering system is schematized in FIG. 1.

Tissues were harvested and transducing capsid genes are labeled with unique molecular identifiers and barcodes. These variant sequences/unique molecular identifiers (UMIs)/barcodes were parameterized, and machine learning algorithms were used to identify deterministic features of specific tissue targeting/detargeting capsids.

FIG. 2A provides a side view (top panel) and top view (bottom panel) of key residues of known AAV capsids that have been shown to interact with target cells. FIG. 2B illustrates salient features of the AAV capsid library, showing the region of introduced diversity, with residue numbering corresponding to the numbering of amino acids in AAV5 VP1. The library plasmid includes the invariant rep and diversified cap coding sequences between AAV inverted terminal repeats (ITRs; a cis-packaging approach).

The recombinant AAV library was administered to two non-human primates (NHPs), one male and one female. The library was administered via bilateral intravitreal injection of 3.2×10¹² viral genomes in 50 μL per eye as follows. Animals were sedated/anesthetized to effect and placed in dorsal recumbency. Topical Proparacaine was applied to the eye. The conjunctival fornices were flushed with a 1:50 dilution of betadine solution/saline and the eyelid margins swabbed with undiluted 5% betadine solution. The eye was draped, and a wire eyelid speculum placed. A caliper was used to mark a spot 3.0 mm posterior to the limbus on the inferotemporal bulbar conjunctiva. The conjunctiva at the marked spot was swabbed with undiluted 5% betadine solution. Conjunctival forceps were used to fixate the globe position while a STACLEAR™ syringe with 31 g needle was inserted at the marked spot, through the sclera and advanced into the vitreous humor. The injection needle was positioned to face the posterior axis of the globe and 50 μL of AAV5 library was delivered into the vitreous by slowly depressing the syringe plunger. The needle was held in place for at least 30 seconds to lessen reflux of the injected material. Subsequently, the needle was removed and the episcleral tissues approximated to the site of insertion grasped with the conjunctival forceps to further lessen reflux of the injected material. An identical injection procedure was then performed on the contralateral eye.

Four weeks post-injection, the animals were euthanized, and tissues were collected for analysis. For the ocular dissections, both eyes first had a maximum volume of aqueous and vitreous humor collected. The retina was separated from the retinal pigment epithelium (RPE)/choroid. The RPE/choroid was frozen in liquid nitrogen as a stand-alone tissue. The retina was further dissected into 5 pieces; superior, inferior, temporal, nasal, central (including fovea and optic disc) and frozen in liquid nitrogen.

The frozen specimens were mechanically dissociated in TRIZOL™ Reagent using QIAGEN® GENTLEMACS™ as follows. Tissue was homogenized using a GENTLEMACS™ dissociator. The tissue was spun down at 3000×g for 2-3 minutes. A 15 ml MAXTRACT® QIAGEN® protocol was used to extract the AAV episomal DNA. Samples were added to MAXTRACT® High Density Tubes. Between 1 and 6 mL were added to 15 mL tubes and between 5 and 20 nM were added to 50 mL tubes, avoiding any insoluble material. In some instances, GLYCOBLUE™ was added as a co-precipitant. Lysis reagent and 0.2 mL chloroform per mL lysis reagent was added to each tube, and the tubes were capped and thoroughly mixed for at least 15 seconds to mix the organic and aqueous phases to form a pseudo-homogeneous suspension. Tubes were incubated at room temperature for 2 to 3 min. Following incubation, the samples were centrifuged at 1500×g for 5 min at 4° C. to separate the phases or until sample is completely phased (pink is no longer visible in the aqueous layer). The resulting sample contained three phases. The upper of the three phases was a colorless aqueous phase containing cellular RNA and AAV episomal DNA. The upper layer was transferred to a new tube by gently decanting into the new tube. For precipitation of RNA/episomal DNA from the aqueous phase, 0.5 mL of isopropanol was added per 1 mL of lysis reagent used previously and mixed thoroughly. The tubes were incubated at room temperature for 10 min and centrifuged at 4200×g for 10 to 15 min at 4° C. A swinging bucket rotor was used to pellet the RNA and episomal DNA to the bottom of the tube. Following centrifugation, the supernatant was carefully discarded without disrupting the pellet, which was visible as a gel-like white (or blue if co-precipitant was used) pellet at the bottom of the tube. At least 1 mL of freshly made 75% ethanol per 1 mL lysis reagent used previously was added. Samples were mixed by vortexing for a few seconds then centrifuged at 4200×g for 5 min at 4° C. The supernatant was discarded, and the remaining liquid was aspirated following a quick spin. The pellet, containing RNA, was briefly air-dried for about 5 minutes without completely drying the pellet. The RNA pellet was redissolved in 250 μL of RNase-free water prewarmed to 37° C. In some instances, the RNA was treated with 6 μL per 100 μL RNase Cocktail Enzyme Mix (THERMO FISHER SCIENTIFIC®; AM2286) at 37° C. for 30 min. to remove RNA. The treated mixture was purified with a Zymo DNA Clean and Concentrator kit-25 (D4033) following the manufacturer's protocol.

Next generation sequencing (NGS) of recovered AAV episomal DNA was performed using a semi-nested 3-round PCR amplification that appends unique molecular identifiers (UMIs) in the first round of PCR. The completed amplicon contained both UMIs and NGS adapters with dual indexes for sample demultiplexing. The first round of PCR was performed as follows. Four reactions were prepared per tissue sample. Each 100 μL PCR reaction contained 20 μL episomal DNA per reaction as a template. PCR cycling was performed (1. 98° C. for 30s; 2. 98° C. for 15s; 3. 66.6° C. annealing for 45s; 4. 72° C. for 45s; 5. Repeat steps 2-4 for 5 cycles; 6. 72° C. for 2 min). The amplified product was cleaned using CYTIVA® SERA-MAG™ Select bead clean-up following the manufacturer's protocol (1:1 bead:sample).

The second round of PCR was performed as follows. 23 μl of cleaned up PCR 1 reaction was used as a template. 2 μL of primers (10 μM) and 25 μL of 2× master mix Phusion polymerase with HF buffer (NEB, M0531L) was added per reaction. PCR cycling was performed (1. 98° C. for 30s; 2. 98° C. for 10s; 3. 62° C. for 30s; 4. 72° C. for 20s; 5. Repeat steps 2-4 for 18 cycles; 6. 72° C. for 5 min; 7. 4° C. hold). The amplified product was cleaned using CYTIVA® SERA-MAG™ Select bead clean-up following the manufacturer's protocol (0.75:1 bead:sample).

Quantitative PCR (qPCR) with SYBR was performed as follows. 4 μL of cleaned up PCR 2 reaction was used as a template. 1 μL of primers at 20 μL of master mix (containing SYBR) was added. PCR cycling was performed (1. 98° C. for 30s; 2. 98° C. for 10s; 3. 72° C. for 20s and plate read; 4. Repeat steps 2 and 3 for 29 more times; 5. 72° C. for 5m). Amplification and cycle threshold (Ct) values were recorded. Following determination of Ct values, qPCR was repeated as described above but with endpoint at 3-4 cycles above Ct value for each sample. The amplified product was cleaned using CYTIVA® SERA-MAG™ Select bead clean-up following the manufacturer's protocol (1.25:1 bead:sample).

The libraries were pooled and checked for quality. Presence of a 296 bp band for each sample was verified by gel electrophoresis. Samples were quantified on a QUBIT™ flex with High Sensitivity reagents, pooling equal amounts (in ng) together. A TAPESTATION™ automated electrophoresis system was used to confirm quality and quantify each pool. Samples were sequenced on an ISEQ™ for pooling and quality control of indexes. In some instances, depending on library diversity and depth of sequence desired, sequencing was performed on an ILLUMINA® HISEQ™ or NOVASEQ™.

To isolate the capsid variant sequence to use for all analyses, raw demultiplexed data were processed using the following procedure executed using NEXTFLOW™ and custom PYTHON® scripts. Paired end sequencing reads were merged using Fastp v0.21.0 and the following parameters: --correction -merge -average_qual 30. This removed reads with an average sequencing quality score <Q30 and corrected base calls using the read with the higher Phred quality score at that position. Capsid variant sequences were extracted by aligning with zero mismatches in the five nucleotide sequences flanking the variant sequence, and UMI sequences were isolated as the first 12 nucleotides of the read. Extracted variant sequences were then conservatively clustered within an edit distance of four to collapse/suppress error. The sequence at the center of each cluster (i.e., the consensus sequence) was then translated into its amino acid sequence, and data were filtered respect to sequence quality and abundance. Sequences were removed if containing one of the codons excluded from library synthesis (‘CTC’, ‘CTA’, ‘TTA’, ‘AGG’, ‘CGA’, ‘CGT’, ‘TAA’, ‘TAG’, ‘TGA’).

Analysis was performed using the R programming language, and the number of unique variant sequences within each tissue was determined, as shown in FIG. 4. Number of viral genomes recovered per mg from each tissue is shown in FIG. 3.

Enrichment of amino acid residues at each position in the 581 to 589 region (AAV5 VP1 581-589) was determined for the retina in comparison to various background amino acid frequencies, including all other eye tissues (FIG. 5A and FIG. 5B) or the aqueous/vitreous humor (FIG. 5C and FIG. 5D). FIG. 6A and FIG. 6B show heatmaps of amino acid enrichment and depletion at each residue position of the 581 to 589 region (581 to 589, corresponding to positions in the AAV5 VP1 sequence) for the two NHPs, as fold increased/decreased over the input viral library frequency (“ST2”). As seen in FIG. 5A-FIG. 5D, FIG. 6A, and FIG. 6B, positively charged amino acid residues (e.g., K and R) are favored for retinal tissue tropism.

Example 2

AAV5 Variants with Tissue Tropism in Eye Tissues

This example describes engineered AAV5 variants with ocular tissue tropism that are discovered using the methods and systems described in EXAMPLE 1.

Positively charged residues, including lysine (K), arginine (R), and histidine (H), were identified as promoting ocular tissue tropism when included in the VP capsid polypeptide 581 to 589 region. Accordingly, an ocular tissue-tropic VP capsid polypeptide may comprise a K, R, or H amino acid residue at one or more of X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, or X⁹ of SEQ ID NO: 2. Conversely, negatively charged residues, including aspartic acid (D) and glutamic acid (E), were identified as disfavoring ocular tissue tropism when included in the VP capsid polypeptide 581 to 589 region. Accordingly, an ocular tissue-tropic VP capsid polypeptide may comprise fewer D or E amino acid residues in the 581 to 589 region than a wild type VP capsid polypeptide (e.g., SEQ ID NO: 1), or D and E residues may be excluded from the 581 to 589 region entirely.

The present disclosure, thus, provides for rAAVs composed of engineered AAV5 VP1 capsid polypeptides having a SEQ ID NO: 2, wherein the X¹, X², X³, X⁴, X⁵, X⁶, X⁷, X⁸, and X⁹ are independently selected from A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, and V. Also encompassed herein are rAAVs composed of engineered AAV5 VP2 capsid polypeptides and engineered AAV5 VP3 capsid polypeptides having the 581 to 589 regions described herein at the regions in AAV5 VP2 (amino acid residues 445 to 453) and AAV5 VP3 (amino acid residues 389 to 397) corresponding to the amino acids in the AAV5 VP1 581 to 589 region.

From the primary screen described in EXAMPLE 1, certain generalizable trends were also observed for AAV5 variants with ocular tissue tropism. The presence of basic amino acid residues, including K, R, and H, in the 581 to 589 region was favorable for retina tissue tropism and enhanced capsid preference for retina tissue. Increasing the number of basic amino acid residues in the 581 to 589 region increased capsid preference for retina tissue. Basic residues had the largest favorable impact on retina tissue tropism when positioned at position X³ of the 581 to 589 region, with reference to SEQ ID NO: 2, followed by positions X⁶, X¹, and X⁴, in order of impact. Conversely, the presence of acidic amino acid residues, including D and E, in the 581 to 589 region was unfavorable for retina tissue tropism and decreased capsid preference for retina tissue. Furthermore, capsids with 581 to 589 regions containing two or more basic amino acid residues exhibited greater preference for retina tissue with fewer acidic amino acid residues. Increasing the number of acidic amino acid residues in a 581 to 589 region decreased preference for retina tissue in capsids with 581 to 589 regions containing two or more basic amino acid residues.

Example 3

Selection of Prospective Tissue-Tropic Capsid Variants for Secondary Screen

This example describes the selection of prospective tissue-tropic capsid variants for secondary screening. Prospective retinal pigment epithelium (RPE) tissue-tropic and retinal tissue-tropic AAV5 capsid polypeptide variants were identified using the primary screen described in EXAMPLE 1. An AAV5 capsid polypeptide variant was identified as a prospective tissue-tropic variant if it was found only in that tissue of a non-human primate (NHP) following intravitreal administration. Of the 218,937 AAV5 capsid polypeptide variants identified in retinal tissue, 218,803 AAV5 capsid polypeptide variants were found exclusively in retinal tissue, as shown in FIG. 7. From those variants, 1156 were found exclusively in retinal tissue across multiple replicates, of which 724 were found exclusively in retinal tissue in multiple NHPs. Prospective retinal tissue-tropic variants were prioritized for inclusion in the secondary screen if they were observed multiple times in retinal tissue. As shown in FIG. 8, variants with multiple observations (“y”), either in multiple NHPs or multiple replicates within a particular NHP, had higher predictive probabilities (“retina_score”) of exhibiting retina-specific tropism compared to variants having a single observation (“n”), thus providing additional support for their inclusion in the secondary screen. Sequences found exclusively in retinal tissue across multiple replicates, corresponding to AAV5 capsid polypeptide variants with 581 to 589 regions having sequences of SEQ ID NO: 738-SEQ ID NO: 1169, were selected as prospective retinal tissue-tropic AAV5 capsid polypeptide variants for inclusion in the secondary screen. Sequences found exclusively in retinal tissue across multiple NHPs, corresponding to AAV5 capsid polypeptide variants with 581 to 589 regions having sequences of SEQ ID NO: 14-SEQ ID NO: 737, were selected as prospective retinal tissue-tropic AAV5 capsid polypeptide variants for inclusion in the secondary screen. Additionally, observed tissue-unique prospective retina tissue-tropic AAV5 capsid polypeptide variants with 581 to 589 regions having sequences of SEQ ID NO: 1170-SEQ ID NO: 2013 were selected using machine learning for inclusion in the secondary screen. A total of 724 tissue-unique prospective retina tissue-tropic variants observed in multiple NHP were included in the secondary screen. A total of 432 tissue-unique prospective retina tissue-tropic variants observed in multiple replicates were included in the secondary screen. A total of 844 other observed prospective retina tissue-tropic variants, top-ranked by machine learning, but only observed in one replicate of one NHP, were included in the secondary screen.

As shown in FIG. 7, 2069 AAV5 capsid polypeptide variants were identified in RPE tissue and 2065 AAV5 capsid polypeptide variants were identified exclusively in RPE tissue. Observed RPE tissue-tropic AAV5 capsid polypeptide variants with 581 to 589 regions having sequences of SEQ ID NO: 2014-SEQ ID NO: 2513 were selected using machine learning for inclusion in the secondary screen. A total of 500 top ML-ranked tissue-unique prospective RPE tissue-tropic variants, having high predictive probability of being RPE-tropic and low predictive probability of being retina-tropic, were included in the secondary screen.

Additional prospective RPE tissue-tropic and retinal tissue-tropic engineered AAV5 capsid polypeptides to be included in the secondary screen were selected based on a machine learning analysis of the results of the primary screen performed in EXAMPLE 1. Synthetic AAV5 capsid polypeptide variants predicted to have retina tissue tropism or RPE tissue tropism were produced using input optimization through generative convolutional neural network (CNN) modeling; by sampling position weight matrices (PWMs) of amino acid frequencies for a tissue; or by sampling a uniform distribution of amino acid frequencies. These variants were then scored using the machine learning models trained using the observed capsid variants, with the top ML-ranked variants being selected for inclusion in the secondary screen. For retina tissue, synthetic sequences identified using input optimization had the highest predictive probabilities (“Average ML Score”) of having retina-specific tropism, as shown in FIG. 9. FIG. 9 shows the distributions of predicted probabilities of all variants with multiple observations in multiple NHPs or multiple replicates compared to all synthetic retina-tropic variants generated by machine learning, before secondary screen selection. FIG. 10 shows the distributions of predicted probabilities of the variants selected for inclusion in the secondary screen, categorized by how the variant was identified.

AAV5 capsid polypeptide variants with 581 to 589 regions having sequences of SEQ ID NO: 2514-SEQ ID NO: 3575 were generated using convolutional neural network (CNN) input optimization as prospective retina tissue-tropic and selected for inclusion in the secondary screen. AAV5 capsid polypeptide variants with 581 to 589 regions having sequences of SEQ ID NO: 3576-SEQ ID NO: 4510 were generated by sampling PWMs, followed by scoring these sequences and selecting high-ranking sequences as prospective retina tissue-tropic for inclusion in the secondary screen. AAV5 capsid polypeptide variants with 581 to 589 regions having sequences of SEQ ID NO: 4511-SEQ ID NO: 4513 were generated by sampling a uniform distribution, followed by scoring these sequences as retina tissue-tropic for inclusion in the secondary screen. When selecting sequences for further screening, variants generated from sampling PWMs and variants generated from sampling a uniform distribution were considered together. A total of 2000 synthetic prospective retina tissue-tropic variants were included in the secondary screen, including 1062 input optimized sequences, 935 sequences from sampling PWMs, and 3 sequences identified from uniform distribution sampling.

AAV5 capsid polypeptide variants with 581 to 589 regions having sequences of SEQ ID NO: 4514-SEQ ID NO: 5013 were generated by sampling PWMs, followed by scoring these sequences and selecting high-ranking sequences as prospective RPE tissue-tropic for inclusion in the secondary screen. A total of 500 synthetic prospective RPE tissue-tropic variants were included in the secondary screen.

Example 4

Secondary Screen to Identify Ocular Tissue-Tropic Engineered AAV Capsids

This example describes a secondary screen to identify ocular tissue-tropic engineered AAV capsids. Prospective tissue-tropic capsids identified from an in vivo primary screen, through machine learning, or both, such as the retina tissue-tropic and RPE tissue-tropic capsids identified in EXAMPLE 3, are introduced into an in vivo secondary screen to confirm tissue-tropic behavior of the identified capsids. The secondary screen includes capsids observed in the primary screen in RPE, choroid, retina, or combinations thereof. The barcoded secondary screen capsid library, including wild type AAV controls, is injected into a non-human primate (NHP) by intravitreal injection. Following injection, ocular tissues, including RPE/choroid, retina, vitreous humor, aqueous humor, and optic nerve, are isolated from the NHP, and the barcoded sequences are quantified. RPE and choroid tissues are isolated and analyzed together.

To identify RPE-targeting capsids in the functional screen, two versions of every candidate capsid in the library are encoded. The first version includes a payload sequence under transcriptional control of a universal promoter (e.g., CAG). The second version includes a payload sequence under transcriptional control of an RPE-specific promoter (e.g., BEST1). Capsids that infect RPE will show RNA expression from both the RPE-specific and universal promoters, whereas capsids infecting other cells will show expression from the CAG promoter and lack expression from the BEST1 promoter. Capsids found in RPE/choroid tissue that express from both the RPE-specific and universal promoters are identified as RPE tissue-tropic capsids. Capsids found in retina tissue are identified as retina tissue-tropic capsids.

Example 5

Treatment of an Eye Disease or Condition with an AAV5-Derived Virion Encapsidating a Therapeutic Payload

This example describes treatment of an ocular disease or condition with a variant AAV5-derived virion having any one of the engineered ocular tissue-tropic variant AAV5 VP capsid polypeptides disclosed herein, wherein the variant AAV5 virion encapsidates a therapeutic payload. Polynucleotide sequence encoding for AAV Rep, an AAV5-derived variant Cap and helper proteins and a therapeutic payload are transfected in cells to produce variant AAV5 virions, where the polynucleotide sequence encoding for the variant AAV5 Cap comprises at least one mutation in a 581 to 589 region, corresponding to residues 581 to 589 in the VP1 capsid polypeptide, and where the polynucleotide sequence encodes for a variant AAV5 Cap comprising a 581 to 589 region that confers retinal tissue tropism, photoreceptor cell targeting, retinal pigment epithelial cell targeting, or combinations thereof. The 581 to 589 region has a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. Each such variant is detargeted for vitreous humor and aqueous humor. The therapeutic payload is a guide RNA or miRNA targeting an mRNA encoded for by a gene implicated in the ocular disease or condition, or the therapeutic payload is a transgene. The variant AAV5 virion encapsidating the payload is administered to a subject. The subject is a human or non-human animal. The route of administration is an intravitreal route of administration. The intravitreal route of administration is intravitreal injection. Upon administration to the subject, the variant AAV5 virions encapsidating the therapeutic payload exhibit enhanced ocular tissue tropism as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, a lower dose of the variant AAV5 virions encapsidating the therapeutic payload is administered as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, at least one symptom of the ocular disease or condition is alleviated, or the subject is cured.

Example 6

Treatment of Macular Degeneration with an AAV5-Derived Virion Encapsidating a Therapeutic Payload

This example describes treatment of wet age-related macular degeneration with a variant AAV5-derived virion having any one of the engineered ocular tissue-tropic variant AAV5 VP capsid polypeptides disclosed herein, wherein the variant AAV5 virion encapsidates a therapeutic payload. Polynucleotide sequence encoding for AAV Rep, an AAV5-derived variant Cap and helper proteins and a therapeutic payload are transfected in cells to produce variant AAV5 virions, where the polynucleotide sequence encoding for the variant AAV5 Cap comprises at least one mutation in a 581 to 589 region, corresponding to residues 581 to 589 in the VP1 capsid polypeptide, and where the polynucleotide sequence encodes for a variant AAV5 Cap comprising a 581 to 589 region conferring retinal tissue targeting, retinal pigment epithelial cell targeting, or both. The 581 to 589 region has a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. Each such variant is detargeted for vitreous humor and aqueous humor. The therapeutic payload is a guide RNA targeting an mRNA encoded for by a gene implicated in wet age-related macular degeneration, or the therapeutic payload is a transgene. The mRNA targeted by the guide RNA is an mRNA encoded for by a NOS2A, CFH, CF, C2, C3, CFB, HTRA1/LOC, MMP-9, TIMP-3, or SLC16A8 gene. The transgene is a gene encoding for an anti-VEGF antibody. The variant AAV5 virion encapsidating the payload is administered to a subject. The subject is a human or non-human animal. The route of administration is an intravitreal route of administration. The intravitreal route of administration is intravitreal injection. Upon administration to the subject, the variant AAV5 virions encapsidating the therapeutic payload exhibit enhanced ocular tissue tropism compared with wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, a lower dose of the variant AAV5 virions encapsidating the therapeutic payload is administered as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, at least one symptom of wet age-related macular degeneration is alleviated, or the subject is cured.

Example 7

Treatment of Glaucoma with an AAV5-Derived Virion Encapsidating a Therapeutic Payload

This example describes treatment of glaucoma with a variant AAV5-derived virion having any one of the engineered ocular tissue-tropic variant AAV5 VP capsid polypeptides disclosed herein, wherein the variant AAV5 virion encapsidates a therapeutic payload. Polynucleotide sequence encoding for AAV Rep, an AAV5-derived variant Cap and helper proteins and a therapeutic payload are transfected in cells to produce variant AAV5 virions, where the polynucleotide sequence encoding for the variant AAV5 Cap comprises at least one mutation in a 581 to 589 region, corresponding to residues 581 to 589 in the VP1 capsid polypeptide, and where the polynucleotide sequence encodes for a variant AAV5 Cap comprising a 581 to 589 region that confers retinal tissue targeting, retinal pigment epithelial cell targeting, or both. The 581 to 589 region has a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. Each such variant is detargeted for vitreous humor and aqueous humor. The therapeutic payload is a guide RNA targeting an mRNA encoded for by a gene implicated in glaucoma, or the therapeutic payload is a transgene. The mRNA targeted by the guide RNA is an mRNA encoded for by a CALM2, MPP-7, Optineurin, LOX1, CYP1B1, CAV1/2, MYOC, PITX2, FOXC1, PAX6, CYP1B1, or LTBP2 gene. The transgene is optineurin. The variant AAV5 virion encapsidating the payload is administered to a subject. The subject is a human or non-human animal. The route of administration is an intravitreal route of administration. The intravitreal route of administration is intravitreal injection. Upon administration to the subject, the variant AAV5 virions encapsidating the therapeutic payload exhibit enhanced ocular tissue tropism as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, a lower dose of the variant AAV5 virions encapsidating the therapeutic payload is administered as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, at least one symptom of glaucoma is alleviated, or the subject is cured.

Example 8

Treatment of Retinitis Pigmentosa with an AAV5-Derived Virion Encapsidating a Therapeutic Payload

This example describes treatment of retinitis pigmentosa with a variant AAV5-derived virion having any one of the engineered ocular tissue-tropic variant AAV5 VP capsid polypeptides disclosed herein, wherein the variant AAV5 virion encapsidates a therapeutic payload. Polynucleotide sequence encoding for AAV Rep, an AAV5-derived variant Cap and helper proteins and a therapeutic payload are transfected in cells to produce variant AAV5 virions, where the polynucleotide sequence encoding for the variant AAV5 Cap comprises at least one mutation in a 581 to 589 region, corresponding to residues 581 to 589 in the VP1 capsid polypeptide, and where the polynucleotide sequence encodes for a variant AAV5 Cap comprising a 581 to 589 region that confers retinal tissue targeting, retinal pigment epithelial cell targeting, or both. The 581 to 589 region has a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. Each such variant is detargeted for vitreous humor and aqueous humor. The therapeutic payload is a guide RNA targeting an mRNA encoded for by a gene implicated in the retinitis pigmentosa, or the therapeutic payload is a transgene. The mRNA targeted by the guide RNA is an mRNA encoded for by a NRL, RDH12, PRPH2 (RDS), RHO, RPGR, SNRNP200, NR2E3, IMPDH1, CRX, HK1, IMPDH2, SNRNP200, PRPF3, or AGBL5 gene. The transgene is a NRL, RDH12, PRPH2 (RDS), RHO, RPGR, SNRNP200, NR2E3, IMPDH1, CRX, HK1, IMPDH2, SNRNP200, PRPF3, or AGBL5 gene. The variant AAV5 virion encapsidating the payload is administered to a subject. The subject is a human or non-human animal. The route of administration is an intravitreal route of administration. The intravitreal route of administration is intravitreal injection. Upon administration to the subject, the variant AAV5 virions encapsidating the therapeutic payload exhibit enhanced ocular tissue tropism as compared with wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, a lower dose of the variant AAV5 virions encapsidating the therapeutic payload is administered as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, at least one symptom of the retinitis pigmentosa is alleviated, or the subject is cured.

Example 9

Treatment of Stargardt Disease with an AAV5-Derived Virion Encapsidating a Therapeutic Payload

This example describes treatment of Stargardt disease with a variant AAV5-derived virion having any one of the engineered ocular tissue-tropic variant AAV5 VP capsid polypeptides disclosed herein, wherein the variant AAV5 virion encapsidates a therapeutic payload. Polynucleotide sequence encoding for AAV Rep, an AAV5-derived variant Cap and helper proteins and a therapeutic payload are transfected in cells to produce variant AAV5 virions, where the polynucleotide sequence encoding for the variant AAV5 Cap comprises at least one mutation in a 581 to 589 region, corresponding to residues 581 to 589 in the VP1 capsid polypeptide, and where the polynucleotide sequence encodes for a variant AAV5 Cap comprising a 581 to 589 region conferring retinal tissue targeting, retinal pigment epithelial cell targeting, or both. The 581 to 589 region has a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. Each such variant is detargeted for vitreous humor and aqueous humor. The therapeutic payload is a guide RNA targeting an mRNA encoded for by a gene implicated in Stargardt disease, or the therapeutic payload is a transgene. The mRNA targeted by the guide RNA is an mRNA encoded for by an ABCA1, ABCA4, or CRB1 gene. The transgene is ABCA1, ABCA4, or CRB1. The variant AAV5 virion encapsidating the payload is administered to a subject. The subject is a human or non-human animal. The route of administration is an intravitreal route of administration. The intravitreal route of administration is intravitreal injection. Upon administration to the subject, the variant AAV5 virions encapsidating the therapeutic payload exhibit enhanced ocular tissue tropism as compared wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, a lower dose of the variant AAV5 virions encapsidating the therapeutic payload is administered as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, at least one symptom of Stargardt disease is alleviated, or the subject is cured.

Example 10

Treatment of Uveal Melanoma with an AAV5-Derived Virion Encapsidating a Therapeutic Payload

This example describes treatment of uveal melanoma with a variant AAV5-derived virion having any one of the engineered ocular tissue-tropic variant AAV5 VP capsid polypeptides disclosed herein, wherein the variant AAV5 virion encapsidates a therapeutic payload. Polynucleotide sequence encoding for AAV Rep, an AAV5-derived variant Cap and helper proteins and a therapeutic payload are transfected in cells to produce variant AAV5 virions, where the polynucleotide sequence encoding for the variant AAV5 Cap comprises at least one mutation in a 581 to 589 region, corresponding to residues 581 to 589 in the VP1 capsid polypeptide, and where the polynucleotide sequence encodes for a variant AAV5 Cap comprising a 581 to 589 region that confers retinal tissue targeting, retinal pigment epithelial cell targeting, or both. The 581 to 589 region has a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. Each such variant is detargeted for vitreous humor and aqueous humor. The therapeutic payload is a guide RNA targeting an mRNA encoded for by a gene implicated in uveal melanoma, or the therapeutic payload is a transgene. The mRNA targeted by the guide RNA is an mRNA encoded for by a PTEN, BAP1, GNAQ, GNA11, DDEF1, SF3B1, EIF1AX, CDKN2A, p14ARF, a HERC2/OCA2 gene. The transgene is an anti gp100 protein. The variant AAV5 virion encapsidating the payload is administered to a subject. The subject is a human or non-human animal. The route of administration is an intravitreal route of administration. The intravitreal route of administration is intravitreal injection. Upon administration to the subject, the variant AAV5 virions encapsidating the therapeutic payload exhibit enhanced ocular tissue tropism as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, a lower dose of the variant AAV5 virions encapsidating the therapeutic payload is administered as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, at least one symptom of uveal melanoma is alleviated, a tumor size is reduced, or the subject is cured.

Example 11

Treatment of Optical Neuropathy with an AAV5-Derived Virion Encapsidating a Therapeutic Payload

This example describes treatment of optical neuropathy with a variant AAV5-derived virion having any one of the engineered ocular tissue-tropic variant AAV5 VP capsid polypeptides disclosed herein, wherein the variant AAV5 virion encapsidates a therapeutic payload. Polynucleotide sequence encoding for AAV Rep, an AAV5-derived variant Cap and helper proteins and a therapeutic payload are transfected in cells to produce variant AAV5 virions, where the polynucleotide sequence encoding for the variant AAV5 Cap comprises at least one mutation in a 581 to 589 region, corresponding to residues 581 to 589 in the VP1 capsid polypeptide, and where the polynucleotide sequence encodes for a variant AAV5 Cap comprising a 581 to 589 region that confers retinal tissue targeting, retinal pigment epithelial cell targeting, or both. The 581 to 589 region has a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. Each such variant is detargeted for vitreous humor and aqueous humor. The therapeutic payload is a guide RNA targeting an mRNA encoded for by a gene implicated in optical neuropathy, or the therapeutic payload is a transgene. The mRNA targeted by the guide RNA is an mRNA encoded for by a Complex I, ND, OPA1, or RPE65 gene. The transgene is Complex I, ND, OPA1, or RPE65. The variant AAV5 virion encapsidating the payload is administered to a subject. The subject is a human or non-human animal. The route of administration is an intravitreal route of administration. The intravitreal route of administration is intravitreal injection. Upon administration to the subject, the variant AAV5 virions encapsidating the therapeutic payload exhibit enhanced ocular tissue tropism as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, a lower dose of the variant AAV5 virions encapsidating the therapeutic payload is administered as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, at least one symptom of ocular neuropathy is alleviated, or the subject is cured.

Example 12

Treatment of Usher Syndrome with an AAV5-Derived Virion Encapsidating a Therapeutic Payload

This example describes treatment of Usher syndrome with a variant AAV5-derived virion having any one of the engineered ocular tissue-tropic variant AAV5 VP capsid polypeptides disclosed herein, wherein the variant AAV5 virion encapsidates a therapeutic payload. Polynucleotide sequence encoding for AAV Rep, an AAV5-derived variant Cap and helper proteins and a therapeutic payload are transfected in cells to produce variant AAV5 virions, where the polynucleotide sequence encoding for the variant AAV5 Cap comprises at least one mutation in a 581 to 589 region, corresponding to residues 581 to 589 in the VP1 capsid polypeptide, and where the polynucleotide sequence encodes for a variant AAV5 Cap comprising a 581 to 589 region that confers retinal tissue targeting, retinal pigment epithelial cell targeting, or both. The 581 to 589 region has a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013, SEQ ID NO: 2514-SEQ ID NO: 4513, SEQ ID NO: 2014-SEQ ID NO: 2513, or SEQ ID NO: 4514-SEQ ID NO: 5013. Each such variant is detargeted for vitreous humor and aqueous humor. The therapeutic payload is a guide RNA targeting an mRNA encoded for by a gene implicated in Usher syndrome, or the therapeutic payload is a transgene. The mRNA targeted by the guide RNA is an mRNA encoded for by a ADGRV1, CEP250, CLRN1, MYO7A, PROM1, USH1C, USH1G, or USH2A gene. The transgene is ADGRV1, CEP250, CLRN1, MYO7A, PROM1, USH1C, USH1G, or USH2A. The variant AAV5 virion encapsidating the payload is administered to a subject. The subject is a human or non-human animal. The route of administration is an intravitreal route of administration. The intravitreal route of administration is intravitreal injection. Upon administration to the subject, the variant AAV5 virions encapsidating the therapeutic payload exhibit enhanced ocular tissue tropism as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, a lower dose of the variant AAV5 virions encapsidating the therapeutic payload is administered as compared to wild type AAV5 virions encapsidating the therapeutic payload. Upon administration to the subject, at least one symptom of Usher syndrome is alleviated, or the subject is cured.

Example 13

Singleplex Tertiary Screen to Validate Ocular Tissue-Tropic Engineered AAV Capsids

This example describes a tertiary screen, in singleplex, to identify ocular tissue-tropic engineered AAV capsids. Prospective tissue-tropic capsids identified from an in vivo secondary screen, through machine learning, or both, such as the retina tissue-tropic and RPE tissue-tropic capsids identified in EXAMPLE 4, are introduced into an in vivo tertiary screen, in singleplex, to confirm tissue-tropic behavior of the identified capsids when individually dosed in NHP. The tertiary screen includes capsids observed in the secondary screen in RPE, choroid, retina, or combinations thereof. The tertiary screen capsid library is injected into a non-human primate (NHP) by intravitreal injection. Following injection, ocular tissues, including RPE/choroid, retina, vitreous humor, aqueous humor, and optic nerve, are isolated from the NHP, and the barcoded sequences are quantified. RPE and choroid tissues are isolated and analyzed together. Prospective tissue-tropic capsids are compared to control, wild-type AAV to identify superior variant capsids of the present disclosure that target various compartments of the eye (e.g., RPE tissue-tropic capsids or retina tissue-tropic capsids).

While the invention has been particularly shown and described with reference to a preferred embodiment and various alternate embodiments, it is understood by persons skilled in the relevant art that various changes in form and details can be made therein without departing from the spirit and scope of the invention.

Claims

1. A viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence of SEQ ID NO: 5014 and further comprises at least one substitution relative to SEQ ID NO: 9; andwherein the 581 to 589 region comprises one or more basic amino acid residues.

2. The VP capsid polypeptide of claim 1, wherein the 581 to 589 region comprises more basic amino acid residues than acidic amino acid residues.

3. The VP capsid polypeptide of claim 2, wherein the acidic amino acid residues are selected from the group consisting of D and E.

4. The VP capsid polypeptide of any one of claims 1-3, wherein the basic amino acid residues are selected from the group consisting of K, R, and H.

5. A viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581-589 region of the VP capsid polypeptide comprises a sequence of SEQ ID NO: 5014, wherein X1, X2, X3, X4, X5, or X6 of SEQ ID NO: 5014, or any combination thereof is K or R.

6. The VP capsid polypeptide of any one of claims 1-5, wherein X1 of SEQ ID NO: 5014 is K or R.

7. The VP capsid polypeptide of claim 4, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2343, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, or 1555.

8. The VP capsid polypeptide of any one of claims 1-5, wherein X2 of SEQ ID NO: 5014 is K or R.

9. The VP capsid polypeptide of claim 8, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 752, 2144, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 285, 1626, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 3646, 4059, 1431, 1331, 310, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 1959, 1840, 3736, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 2382, 3675, 1833, 3974, 419, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 3879, 2698, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 1019, 2012, 1803, 3642, 497, 1322, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 1675, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1050, 3515, 2219, 1433, 1323, 4301, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2324, 605, 1368, 3827, 4103, 606, 607, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 4879, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 3815, 2005, 1964, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, or 2250.

10. The VP capsid polypeptide of any one of claims 1-5, wherein X3 of SEQ ID NO: 5014 is K or R.

11. The VP capsid polypeptide of claim 10, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 4177, 1289, 740, 741, 18, 745, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 23, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 34, 35, 36, 37, 38, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 45, 756, 46, 48, 1952, 758, 49, 3122, 2551, 3718, 3484, 3577, 759, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 760, 53, 3925, 55, 3654, 56, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 63, 64, 768, 771, 65, 66, 67, 68, 3816, 2599, 2706, 74, 3865, 1549, 1361, 3882, 3713, 1942, 1312, 4501, 76, 77, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 82, 4065, 83, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 90, 91, 779, 1180, 92, 785, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 794, 795, 104, 105, 106, 1849, 108, 1579, 110, 1906, 113, 1444, 1344, 116, 802, 117, 118, 121, 803, 804, 1463, 805, 122, 124, 125, 127, 807, 132, 809, 810, 133, 1978, 812, 135, 136, 137, 138, 813, 140, 815, 1326, 141, 142, 143, 144, 145, 1634, 1302, 817, 146, 818, 147, 148, 149, 151, 152, 153, 154, 155, 819, 820, 157, 159, 160, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 826, 827, 181, 828, 182, 829, 184, 185, 186, 187, 188, 189, 830, 191, 192, 193, 194, 195, 196, 1391, 197, 200, 201, 202, 203, 204, 205, 832, 833, 206, 834, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 215, 1896, 1522, 3490, 838, 217, 218, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 226, 227, 230, 231, 842, 232, 233, 844, 236, 237, 851, 852, 853, 1536, 240, 854, 242, 243, 244, 245, 246, 247, 249, 250, 251, 252, 253, 254, 255, 857, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 264, 1241, 265, 266, 866, 1477, 267, 867, 869, 870, 271, 871, 872, 272, 1252, 273, 1591, 275, 1980, 276, 876, 877, 277, 278, 279, 1892, 1539, 880, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 282, 1799, 283, 1626, 1374, 287, 1620, 1290, 1354, 888, 291, 1956, 889, 292, 4324, 293, 4138, 891, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1515, 1617, 1961, 304, 306, 1589, 4370, 308, 309, 894, 3646, 4059, 1431, 1331, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 898, 321, 322, 899, 1958, 901, 325, 902, 326, 1491, 329, 330, 905, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 1762, 4472, 1472, 1529, 4057, 1976, 4507, 1583, 338, 911, 1711, 340, 912, 2013, 341, 4440, 917, 344, 918, 919, 921, 922, 347, 351, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 925, 1782, 926, 927, 3610, 357, 359, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 1211, 1873, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 1359, 1734, 3650, 1910, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 390, 391, 4406, 4341, 1480, 395, 1714, 1422, 396, 397, 3618, 4433, 1177, 3898, 398, 949, 950, 399, 951, 400, 1965, 4471, 952, 402, 2475, 403, 404, 4139, 1482, 3602, 4434, 3721, 1592, 1519, 1352, 4202, 4409, 1977, 1917, 407, 408, 1631, 1684, 409, 3889, 958, 959, 412, 960, 414, 415, 961, 1905, 416, 963, 417, 3675, 1833, 3974, 420, 421, 965, 966, 969, 970, 422, 1897, 423, 4133, 3830, 972, 424, 973, 427, 1708, 4141, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 434, 1606, 979, 2604, 2895, 436, 3448, 1692, 983, 3862, 4055, 4358, 984, 985, 1664, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 987, 988, 990, 451, 452, 991, 992, 1728, 994, 995, 454, 1696, 3116, 1869, 456, 1386, 999, 3879, 2698, 1001, 461, 1447, 462, 464, 4425, 1645, 1231, 1468, 472, 473, 476, 1273, 1007, 1744, 1488, 1659, 477, 1604, 481, 4313, 482, 483, 1499, 484, 1016, 4073, 1777, 1458, 4274, 487, 1775, 4205, 1526, 1697, 1017, 2000, 489, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 491, 1948, 3699, 1735, 3792, 4290, 495, 4090, 496, 2012, 1803, 3642, 1322, 498, 1021, 1022, 502, 1333, 503, 1023, 1890, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1029, 1366, 2112, 1261, 4027, 3478, 3763, 2959, 517, 3197, 1595, 3413, 1448, 518, 1675, 1797, 520, 1999, 3759, 1215, 4122, 1730, 524, 526, 3966, 3911, 529, 3289, 1821, 530, 531, 1874, 1038, 536, 537, 3767, 1929, 1041, 1042, 3683, 542, 1338, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 546, 4240, 3580, 1046, 1047, 550, 2598, 551, 552, 3819, 1259, 4062, 2841, 1050, 3515, 4301, 1052, 1053, 3738, 1567, 1270, 3857, 1055, 1257, 1238, 3662, 561, 562, 1058, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 572, 1912, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1451, 1654, 3934, 4080, 4352, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 1950, 1963, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 1559, 1250, 1555, 4114, 1818, 1075, 1076, 1077, 1704, 4448, 1078, 1079, 1786, 585, 3354, 1832, 3432, 2891, 2505, 1903, 1081, 1082, 4459, 1083, 1563, 590, 591, 1085, 594, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 600, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1087, 1088, 3888, 1368, 3827, 4103, 606, 1090, 1571, 1091, 1438, 1092, 1093, 612, 1094, 3701, 4389, 613, 1603, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1100, 1702, 1101, 1667, 1384, 623, 3700, 1788, 1600, 624, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4860, 2557, 2795, 2906, 3118, 1614, 1947, 4479, 3766, 632, 1104, 1105, 633, 1813, 636, 3706, 1110, 640, 1111, 641, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 1114, 1766, 3221, 2643, 2739, 3920, 644, 1116, 645, 646, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2369, 2695, 3293, 650, 651, 1120, 652, 1121, 3264, 655, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3994, 1319, 4467, 1802, 1227, 1623, 662, 663, 664, 1124, 1125, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 1135, 672, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 679, 1142, 1143, 681, 1145, 682, 685, 3822, 689, 690, 691, 1147, 1601, 3905, 694, 695, 1414, 1150, 1795, 1372, 1695, 1866, 4115, 1719, 698, 1920, 699, 700, 1544, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1854, 1902, 1510, 4182, 706, 707, 708, 4476, 1245, 714, 1841, 4234, 1314, 4096, 717, 1155, 4217, 1156, 723, 1157, 1627, 725, 1159, 1953, 1160, 1201, 727, 3787, 3747, 730, 1846, 3815, 2005, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 734, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1628, 3705, 1195, 3859, 1164, 1165, 1166, 1745, 1973, 1168, 3807, 4307, 1454, or 1781.

12. The VP capsid polypeptide of any one of claims 1-5, wherein X4 of SEQ ID NO: 5014 is K or R.

13. The VP capsid polypeptide of claim 12, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 739, 4177, 1289, 15, 743, 3477, 3051, 2982, 2877, 746, 3036, 3426, 3073, 3169, 3362, 2784, 3192, 1638, 25, 1703, 1836, 3660, 30, 32, 752, 1653, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 2633, 757, 1952, 3122, 2551, 3718, 2216, 3484, 3577, 1308, 1230, 3960, 2994, 3080, 2589, 3681, 51, 761, 3925, 3654, 763, 764, 57, 4086, 1740, 767, 772, 2599, 2706, 70, 3865, 1549, 1361, 3882, 1942, 1312, 4501, 1413, 3593, 4043, 1806, 3908, 4397, 1615, 2006, 3945, 2854, 3523, 3669, 1356, 777, 4065, 84, 1484, 778, 87, 3891, 4456, 4040, 4496, 2001, 1478, 1189, 1490, 1885, 2270, 1180, 786, 4458, 1970, 1590, 98, 1298, 101, 1688, 794, 107, 1849, 797, 1579, 111, 112, 113, 1444, 801, 114, 115, 119, 120, 122, 1760, 123, 124, 806, 125, 126, 127, 128, 129, 130, 134, 811, 814, 139, 1326, 144, 816, 1302, 150, 152, 821, 160, 161, 162, 1651, 1483, 179, 180, 183, 185, 187, 1391, 198, 199, 831, 204, 833, 207, 3901, 3312, 2649, 1301, 4386, 3028, 1896, 1522, 3490, 216, 218, 1612, 225, 228, 229, 234, 239, 849, 850, 1536, 241, 246, 248, 855, 249, 252, 253, 261, 4966, 864, 263, 4749, 2296, 1241, 866, 268, 868, 269, 270, 873, 874, 1252, 273, 1591, 274, 1980, 878, 1539, 3601, 3877, 1930, 1420, 1678, 1460, 1799, 1374, 1290, 1354, 290, 2391, 4324, 294, 4138, 3903, 892, 3829, 298, 3844, 1436, 300, 1515, 1617, 1961, 303, 1589, 893, 4370, 3646, 4059, 1331, 1558, 1552, 320, 1958, 1491, 1635, 332, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 2785, 3249, 3527, 3352, 2569, 4457, 2011, 3906, 1533, 1755, 1888, 4248, 1557, 3804, 1363, 1934, 1602, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 1852, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 2662, 2875, 3223, 2878, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 4472, 1472, 4057, 4507, 1711, 913, 916, 1594, 4440, 343, 918, 345, 348, 350, 1518, 3728, 3637, 3570, 3429, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 355, 1782, 928, 3610, 358, 4224, 1918, 1959, 1840, 3736, 4155, 1543, 4049, 1633, 1495, 372, 1873, 1726, 1748, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 4149, 1313, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 3979, 4461, 4113, 3817, 4232, 3902, 1857, 1904, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 3785, 3687, 4318, 4243, 3866, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 3296, 375, 1395, 1584, 4093, 3940, 3778, 4374, 4210, 4009, 4264, 4368, 1610, 4194, 4474, 4013, 4266, 1759, 1922, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3790, 3712, 1969, 934, 1790, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 3845, 4511, 3656, 1406, 1596, 4504, 1359, 1734, 3650, 1305, 1208, 1988, 4451, 1282, 4380, 1658, 1452, 1687, 3791, 4491, 4323, 4014, 1304, 1440, 4422, 3861, 1383, 3644, 3691, 4259, 1749, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 1297, 1586, 1251, 1299, 1954, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 3627, 3777, 1371, 3685, 1325, 1940, 4482, 4258, 3812, 1581, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1666, 1407, 4187, 1188, 1724, 1646, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 2561, 4442, 3900, 4298, 1203, 4441, 3628, 3725, 937, 4447, 3776, 3658, 4064, 1324, 1367, 3594, 3680, 1300, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 1546, 3613, 3273, 3452, 3525, 4105, 3835, 1263, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 4333, 3146, 4281, 4211, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 1471, 4176, 1232, 1989, 4125, 1741, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 3826, 1473, 1883, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1410, 1823, 1498, 1329, 386, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 3953, 4228, 4226, 4277, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 1859, 4183, 1408, 1403, 941, 4033, 3623, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 4322, 3991, 4106, 1641, 1570, 3978, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 4201, 1898, 1845, 1226, 1220, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1884, 1682, 4364, 4306, 3869, 3600, 3914, 1968, 1670, 3811, 1865, 3961, 1506, 4221, 1376, 1379, 3768, 4225, 945, 394, 1714, 1422, 3618, 4433, 1965, 4471, 954, 4139, 1482, 3721, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 3889, 413, 962, 418, 3675, 3974, 964, 420, 967, 968, 1897, 1272, 4133, 425, 4141, 430, 3749, 4044, 3590, 1944, 4126, 977, 4400, 1606, 980, 2604, 2895, 3448, 4563, 1692, 4055, 4358, 1664, 4309, 4045, 3854, 3682, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3985, 3535, 1306, 4084, 3282, 447, 1353, 1780, 449, 1485, 453, 1728, 454, 1696, 455, 3116, 1869, 457, 1386, 3879, 2698, 459, 1447, 4425, 1645, 467, 1488, 478, 1604, 1011, 4313, 4073, 4274, 1775, 2000, 2480, 1882, 1817, 1880, 1800, 4473, 3783, 3870, 1948, 3699, 1735, 3792, 4290, 492, 4090, 1019, 1803, 3642, 497, 500, 1333, 1890, 1024, 3608, 1864, 1531, 3636, 1699, 1028, 1366, 1030, 4027, 3478, 3763, 2959, 1293, 517, 3197, 1595, 3413, 2238, 1031, 1448, 1032, 1675, 1797, 3759, 1215, 4122, 3966, 528, 3911, 3289, 1821, 1874, 1037, 536, 1039, 3767, 3683, 540, 541, 1338, 1616, 1901, 1517, 2719, 3803, 4123, 4233, 3129, 3087, 3505, 4158, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 543, 4240, 3580, 2598, 4062, 2841, 1049, 3515, 1433, 1323, 4301, 1051, 3738, 1270, 3857, 1056, 3662, 1057, 3981, 1063, 568, 570, 3620, 1064, 4002, 3964, 3707, 3666, 1348, 4273, 4497, 1401, 4438, 1895, 1912, 3939, 4170, 4056, 1221, 1654, 1067, 3934, 4080, 4352, 574, 3739, 1565, 3950, 1397, 3716, 1569, 1465, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 4455, 4512, 3750, 3633, 4070, 4104, 4162, 4235, 4346, 1572, 4443, 3761, 1346, 3592, 1891, 4469, 1275, 577, 1963, 4129, 1296, 1360, 3733, 4111, 3993, 4108, 3949, 1556, 1435, 1424, 1830, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 4293, 1827, 3839, 3983, 4395, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1650, 4299, 1773, 2004, 1267, 1364, 4007, 3729, 3665, 3722, 1712, 1751, 3924, 3952, 1343, 4114, 1704, 4448, 1786, 3354, 586, 3432, 2891, 587, 1903, 2077, 1080, 1563, 2274, 595, 2559, 2590, 2738, 4478, 4069, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 4017, 4477, 1794, 4263, 3072, 2199, 3888, 604, 605, 1368, 3827, 4103, 607, 1571, 1438, 3701, 4389, 4897, 1603, 2154, 1715, 4369, 1652, 1733, 4218, 1798, 621, 1667, 1384, 3700, 1788, 1600, 1102, 1423, 2771, 1339, 3070, 2557, 2795, 2906, 3299, 3118, 4779, 2028, 1614, 1947, 630, 4479, 3766, 1106, 634, 1108, 635, 638, 3706, 3735, 3390, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1585, 3221, 2643, 2739, 3920, 1801, 4279, 2502, 1117, 2965, 2695, 3293, 3264, 2076, 657, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 667, 1133, 1134, 673, 1933, 1731, 1793, 3342, 683, 1146, 687, 3822, 1601, 692, 3905, 1414, 696, 1695, 4115, 701, 1544, 702, 703, 4031, 2010, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 1532, 1493, 1854, 1510, 705, 1153, 4476, 1375, 712, 1245, 715, 4234, 1154, 1314, 4096, 720, 1311, 721, 722, 4217, 726, 3815, 2005, 1964, 1262, 4480, 4294, 1582, 3439, 2833, 4287, 4509, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 1195, 3859, 3807, 4307, 1454, or 1781.

14. The VP capsid polypeptide of any one of claims 1-5, wherein X5 of SEQ ID NO: 5014 is K or R.

15. The VP capsid polypeptide of claim 14, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 2498, 4177, 742, 16, 17, 18, 745, 3477, 1548, 2982, 3426, 3073, 3169, 747, 3362, 4942, 23, 28, 2038, 3660, 750, 31, 32, 1640, 34, 37, 4925, 1205, 4288, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3688, 4320, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 1225, 3178, 3006, 3252, 2991, 2642, 2519, 3363, 2633, 42, 755, 44, 756, 46, 1952, 758, 2410, 2551, 3718, 1308, 1230, 3960, 1378, 2589, 3681, 760, 53, 4951, 4591, 762, 3925, 55, 3654, 763, 60, 61, 4086, 1740, 766, 1966, 63, 2041, 64, 769, 770, 2384, 771, 65, 772, 2197, 68, 3816, 69, 2599, 70, 3865, 1549, 3882, 75, 4501, 76, 774, 1413, 776, 3757, 3593, 4043, 4397, 4415, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 1356, 81, 82, 4065, 83, 84, 1294, 87, 3891, 4456, 4040, 1189, 1490, 90, 92, 782, 94, 1831, 1867, 4458, 1936, 100, 792, 2007, 4556, 795, 104, 106, 1849, 2509, 110, 1906, 798, 2359, 2461, 4864, 1344, 116, 120, 121, 803, 1463, 805, 1760, 123, 124, 806, 127, 2085, 130, 132, 809, 1978, 134, 813, 139, 815, 1326, 141, 142, 145, 4816, 1302, 817, 146, 818, 148, 149, 4546, 150, 153, 156, 157, 163, 164, 166, 169, 823, 824, 1483, 175, 177, 178, 179, 826, 827, 182, 183, 829, 184, 185, 190, 191, 192, 2361, 195, 1391, 197, 2223, 201, 202, 4775, 1334, 837, 3901, 3312, 212, 4386, 3028, 213, 1446, 214, 215, 1896, 3490, 217, 219, 223, 225, 2088, 4542, 226, 227, 230, 843, 844, 237, 845, 239, 849, 852, 1536, 854, 244, 245, 248, 855, 251, 253, 255, 257, 858, 860, 262, 863, 4535, 865, 264, 1241, 265, 1477, 267, 867, 1252, 273, 275, 1980, 277, 281, 1892, 879, 1539, 881, 1295, 282, 285, 1626, 2082, 1374, 1620, 4564, 289, 887, 888, 889, 4324, 293, 4138, 296, 3903, 892, 3829, 298, 301, 302, 1589, 4370, 2342, 309, 4059, 310, 1779, 1558, 1552, 317, 320, 898, 321, 2016, 2134, 324, 325, 327, 1635, 4484, 1756, 4609, 332, 4635, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3214, 3163, 2541, 3090, 3097, 3462, 3037, 3419, 2780, 2931, 1276, 2789, 3228, 2657, 3189, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3102, 3466, 3461, 2788, 2660, 3344, 2720, 3379, 2826, 3249, 3527, 4460, 3352, 4319, 3906, 4248, 3804, 1363, 1404, 4349, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3782, 3629, 3578, 3885, 4081, 1764, 1852, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 4222, 1504, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3909, 4269, 3019, 1415, 3020, 2748, 2646, 2787, 2760, 3158, 3170, 2703, 3494, 3404, 2675, 2749, 3341, 3355, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 2875, 3223, 2878, 1808, 2951, 3519, 2579, 2853, 3387, 3401, 3007, 3568, 3152, 3367, 3358, 336, 3290, 3550, 3309, 2613, 2765, 1355, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 1622, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 1464, 3560, 3236, 2730, 3572, 1607, 909, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 3002, 2338, 4472, 1472, 1529, 4507, 1583, 340, 912, 2013, 913, 2277, 1594, 4440, 917, 343, 344, 345, 346, 350, 351, 4498, 3637, 3570, 3429, 4091, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4034, 2820, 3912, 3287, 1218, 1190, 4145, 354, 3610, 4224, 1840, 3736, 1770, 4155, 932, 363, 1279, 2156, 1722, 368, 1566, 370, 4967, 372, 1211, 2494, 1726, 1748, 1191, 4039, 4411, 4506, 4270, 4156, 3780, 1550, 3899, 1181, 3919, 1639, 3664, 4189, 4001, 3799, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 1605, 4408, 4149, 3741, 3893, 1280, 1983, 3979, 3817, 1489, 4214, 3902, 1857, 1904, 3820, 3789, 4252, 4330, 4082, 3785, 3687, 4243, 3704, 4172, 4315, 1192, 2769, 2678, 3296, 2343, 4093, 4453, 3940, 3778, 4374, 4339, 4368, 4194, 4474, 4013, 1771, 1759, 3860, 3832, 1381, 4356, 1233, 4212, 3858, 1198, 3611, 1919, 1819, 3790, 1969, 4247, 1790, 3894, 1554, 3576, 4314, 1851, 1850, 4511, 3656, 3638, 1406, 1443, 1661, 4504, 3831, 4435, 1208, 1988, 3849, 1835, 4380, 4024, 4491, 4323, 4014, 1511, 1981, 1676, 1547, 1383, 3644, 3691, 4259, 1176, 4216, 1924, 1387, 4423, 1256, 4119, 1251, 3990, 4029, 4097, 3890, 3796, 4343, 1202, 4413, 4384, 3808, 3892, 3926, 3756, 4405, 4109, 1210, 4492, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3784, 4470, 4010, 4334, 3821, 4171, 3824, 3631, 4494, 1320, 1204, 1223, 1284, 1685, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4100, 4327, 3634, 3617, 4445, 4303, 1370, 3838, 1187, 3615, 3746, 3935, 1941, 4419, 1171, 3670, 3777, 936, 3685, 1325, 1940, 4482, 4258, 3812, 4124, 4508, 4500, 3652, 3972, 1630, 4421, 1172, 4026, 2740, 3125, 3546, 4513, 4340, 1763, 1487, 3589, 3907, 4041, 3851, 4077, 4187, 1193, 1196, 1724, 1717, 1200, 1975, 1613, 4006, 3653, 3833, 1593, 4442, 3900, 4388, 1820, 4317, 4249, 3628, 3794, 4447, 3776, 3658, 1377, 4011, 4272, 3594, 4185, 3686, 3696, 1350, 4230, 3853, 4244, 1909, 3897, 1546, 3273, 3452, 3525, 4105, 3835, 383, 1263, 1492, 3856, 3586, 1175, 4144, 1224, 1199, 3667, 2778, 4412, 1507, 3146, 4281, 1179, 3843, 3740, 1388, 1474, 1342, 1471, 4176, 1741, 1508, 4378, 1212, 4015, 1207, 3698, 3825, 4231, 3806, 3896, 3963, 4286, 3743, 4130, 3605, 4173, 4265, 1246, 1737, 3826, 1473, 1992, 1883, 1656, 3671, 4063, 1847, 4239, 3915, 1265, 1498, 1329, 3874, 4261, 1791, 3579, 4359, 4131, 4297, 4357, 4046, 3788, 4169, 1925, 4228, 4101, 1889, 1369, 4088, 4019, 1194, 3772, 3850, 1315, 1530, 1859, 4183, 1408, 4033, 3623, 1928, 1459, 1765, 4004, 3591, 3967, 4168, 3957, 3878, 3980, 3958, 4051, 3798, 4032, 3991, 4106, 1641, 4464, 3813, 4257, 3846, 4345, 1787, 1214, 4483, 4201, 1220, 3867, 3640, 3916, 1209, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3883, 4326, 4092, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3987, 3583, 3647, 389, 4304, 3793, 1937, 3996, 3800, 4367, 4099, 1390, 4364, 4306, 1278, 1672, 1542, 1915, 3600, 3948, 3811, 1362, 4276, 1445, 1721, 1632, 3607, 1317, 1778, 1668, 391, 4406, 4341, 1480, 393, 394, 395, 946, 3618, 4433, 1177, 947, 950, 400, 4471, 401, 402, 954, 3602, 4434, 3721, 1825, 4202, 4409, 406, 1631, 1684, 3889, 410, 412, 2352, 1905, 417, 418, 3675, 1833, 3974, 419, 964, 420, 421, 969, 4733, 1272, 971, 423, 3830, 973, 426, 1708, 428, 4141, 3749, 1619, 975, 4044, 3590, 1706, 4400, 979, 2895, 3448, 438, 982, 2433, 983, 442, 3862, 2435, 443, 4309, 4045, 3854, 3682, 444, 445, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3599, 3775, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 3694, 446, 3985, 3535, 4084, 3282, 988, 2107, 990, 451, 452, 453, 992, 993, 1696, 996, 3116, 1386, 999, 458, 3879, 460, 461, 462, 2339, 1003, 4425, 1645, 1004, 466, 2328, 468, 1231, 1468, 2496, 473, 474, 2108, 1273, 1007, 1744, 1659, 478, 1009, 1012, 4313, 482, 1499, 484, 2513, 2205, 4592, 1458, 4274, 2122, 4905, 4205, 2000, 488, 1894, 3917, 3616, 4311, 4085, 4401, 1310, 3783, 1538, 3870, 1948, 3699, 1735, 3792, 2202, 4090, 2378, 2012, 3642, 1020, 2302, 4665, 4781, 500, 1022, 1023, 4686, 505, 507, 508, 509, 1025, 1732, 1816, 3636, 1028, 516, 1366, 4572, 2489, 1261, 4027, 3763, 2959, 1293, 3197, 1448, 1032, 519, 2420, 522, 3759, 1215, 4122, 1730, 524, 526, 3966, 1035, 527, 528, 529, 530, 531, 1036, 532, 533, 536, 537, 3767, 1929, 1041, 3683, 1043, 4906, 542, 1338, 1796, 4331, 4332, 4466, 3803, 3087, 3505, 1449, 1044, 4414, 3453, 3254, 544, 546, 1045, 547, 4240, 3580, 4680, 549, 550, 2598, 551, 3819, 1259, 4062, 554, 1049, 1050, 1433, 555, 1052, 1053, 3738, 3857, 2089, 1056, 2193, 1257, 1238, 3662, 1059, 1060, 4203, 3981, 1303, 4116, 567, 569, 3620, 4002, 3679, 3707, 4497, 4438, 1264, 3939, 4170, 4056, 1271, 1451, 1654, 3934, 4080, 4352, 574, 3739, 1565, 1419, 3950, 3716, 1465, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4164, 3630, 4229, 4292, 4215, 1729, 4223, 4455, 4512, 3633, 4070, 4104, 4162, 4443, 3761, 1587, 3592, 1891, 4469, 1963, 4129, 1360, 3949, 1861, 4120, 1292, 4293, 3839, 3983, 3928, 4295, 3715, 3855, 3609, 1990, 4007, 3722, 1624, 3924, 3952, 580, 2003, 1343, 582, 4114, 1818, 1704, 4448, 584, 1078, 1786, 585, 1832, 586, 2891, 587, 4936, 1082, 4459, 2113, 590, 2308, 593, 1858, 597, 2738, 4150, 3260, 3481, 4439, 1268, 4050, 3377, 4424, 3492, 1412, 4477, 4263, 3072, 2009, 3888, 3827, 4103, 1438, 609, 610, 611, 3701, 4389, 613, 4369, 617, 1921, 1373, 1870, 4218, 1099, 1702, 4801, 623, 3700, 1788, 625, 4878, 1423, 1339, 3875, 628, 2557, 2906, 2029, 4876, 1103, 631, 4479, 3766, 632, 1104, 1105, 634, 4651, 1108, 1813, 636, 638, 641, 4581, 1112, 2164, 3735, 3390, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 4398, 1269, 3624, 4481, 1432, 3295, 1568, 1766, 2643, 2739, 4760, 1115, 3920, 644, 645, 646, 4279, 3762, 1637, 1509, 2200, 1117, 4780, 2965, 2695, 650, 651, 653, 654, 655, 658, 4035, 2910, 3391, 2808, 3676, 2852, 3284, 3537, 1319, 4467, 1802, 1227, 660, 4812, 2364, 1124, 1125, 665, 4917, 1127, 1129, 1132, 1133, 2236, 673, 4557, 1136, 1139, 678, 4737, 4531, 679, 680, 1144, 681, 4525, 2415, 685, 2445, 3822, 690, 691, 1601, 4621, 3905, 695, 1149, 696, 2027, 2160, 1795, 1372, 4115, 2194, 1920, 4031, 1393, 1277, 1400, 4402, 4157, 4028, 704, 1902, 1510, 4182, 1153, 4476, 2053, 710, 1375, 715, 4096, 717, 1155, 719, 1311, 722, 4217, 1156, 723, 1157, 1627, 4566, 1158, 724, 725, 1953, 1201, 3787, 3747, 1846, 3815, 1822, 1537, 1318, 4294, 733, 734, 3439, 2833, 4505, 4267, 3697, 4112, 2967, 3651, 1805, 1163, 3859, 2275, 737, 1167, 1745, 3807, or 4307.

16. The VP capsid polypeptide of any one of claims 1-5, wherein X6 of SEQ ID NO: 5014 is K or R.

17. The VP capsid polypeptide of claim 16, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 738, 4177, 1289, 740, 14, 743, 744, 17, 3477, 1548, 3051, 2982, 2877, 746, 19, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 22, 1638, 748, 24, 749, 27, 1703, 1836, 28, 3660, 29, 750, 1640, 33, 35, 36, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 44, 45, 756, 47, 48, 1952, 3122, 2551, 3718, 3484, 3577, 1308, 3960, 1378, 2994, 3080, 2589, 3681, 51, 760, 762, 3925, 3654, 763, 59, 60, 4086, 1740, 1660, 62, 1966, 63, 2438, 768, 66, 67, 68, 3816, 2599, 2706, 72, 73, 74, 3865, 1549, 1361, 3882, 773, 3713, 1942, 1312, 4501, 76, 1413, 775, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 1356, 4065, 1294, 1484, 85, 86, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 780, 1180, 92, 781, 782, 783, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 1936, 1590, 98, 99, 789, 790, 1298, 1688, 791, 792, 2007, 102, 103, 104, 105, 107, 108, 1579, 1906, 111, 798, 112, 799, 800, 1444, 801, 114, 115, 1344, 116, 802, 117, 118, 119, 121, 803, 1463, 1760, 806, 126, 128, 807, 129, 131, 808, 133, 1978, 811, 812, 135, 136, 137, 138, 814, 140, 1326, 141, 142, 143, 2344, 816, 1634, 1302, 817, 818, 147, 148, 149, 150, 151, 154, 155, 819, 820, 156, 157, 158, 161, 162, 165, 822, 168, 169, 170, 823, 172, 1651, 173, 1483, 174, 825, 176, 178, 180, 827, 181, 828, 4911, 184, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 198, 199, 200, 201, 202, 203, 205, 832, 206, 834, 207, 208, 209, 210, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 225, 228, 229, 230, 231, 842, 232, 233, 234, 238, 847, 239, 850, 851, 853, 1536, 240, 241, 242, 243, 244, 245, 247, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 864, 263, 2318, 865, 2326, 264, 1241, 266, 1477, 867, 268, 868, 269, 270, 869, 870, 271, 871, 872, 272, 873, 1252, 1591, 875, 274, 275, 276, 876, 877, 277, 278, 280, 1892, 1539, 881, 3601, 3877, 1460, 282, 1799, 284, 1626, 286, 1374, 1620, 1290, 1354, 887, 1956, 889, 292, 4324, 4138, 891, 296, 3903, 297, 3829, 3809, 4271, 3844, 1436, 300, 1617, 1961, 302, 304, 305, 2147, 1589, 4370, 307, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 318, 319, 322, 1958, 323, 324, 901, 1491, 328, 329, 4484, 907, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 3804, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 3548, 3179, 3407, 3841, 3347, 3142, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 344, 920, 921, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 354, 1782, 927, 3610, 356, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 364, 1279, 365, 1543, 366, 367, 4049, 1633, 1722, 369, 1495, 1566, 373, 1211, 1726, 1442, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 4149, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 3902, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3687, 4318, 4243, 3866, 3704, 4172, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 1584, 4093, 4453, 4210, 4009, 4264, 4339, 1738, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1336, 3894, 3576, 4314, 3695, 1850, 4362, 1815, 3638, 4454, 1661, 4504, 1359, 3650, 1305, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 1283, 3861, 3644, 4259, 1418, 1176, 4216, 1421, 3992, 4423, 4253, 3748, 4119, 1297, 1954, 4450, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 4275, 4492, 4365, 4118, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 4470, 3941, 4348, 3587, 3818, 4350, 3821, 3929, 3824, 4465, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 3627, 3777, 1371, 3685, 4258, 3812, 1581, 4124, 4508, 4500, 3652, 3972, 1528, 3717, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 3758, 4510, 3742, 1710, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1997, 1701, 4280, 4006, 1984, 3833, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1324, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 3826, 1992, 1656, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1410, 1823, 1498, 1329, 386, 940, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1859, 4183, 1403, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 3937, 3801, 1787, 1214, 4483, 4201, 1845, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 953, 401, 403, 955, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4409, 1977, 405, 1631, 1684, 409, 3889, 2117, 411, 413, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 1272, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 978, 4400, 1606, 980, 2604, 2895, 436, 3448, 2188, 438, 1692, 442, 3862, 4055, 4358, 2276, 985, 1664, 443, 4309, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3985, 3535, 1306, 4084, 3282, 1780, 448, 990, 991, 1485, 992, 1728, 993, 994, 1696, 997, 3116, 1869, 456, 1386, 1000, 3879, 2698, 460, 1001, 461, 1447, 1002, 1003, 463, 464, 4425, 465, 1004, 466, 469, 1231, 1468, 470, 1005, 476, 1273, 1744, 1488, 1659, 1604, 479, 1013, 1014, 481, 4313, 1499, 1016, 4073, 1777, 485, 4274, 487, 1775, 4205, 1526, 1697, 2000, 488, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 4473, 4085, 4401, 3783, 3765, 1538, 3870, 491, 3699, 3792, 4290, 494, 2421, 4090, 2012, 1803, 3642, 1322, 1020, 502, 1333, 504, 1890, 507, 3608, 1732, 1864, 1816, 1531, 513, 3636, 514, 1699, 1027, 1366, 4950, 4027, 3478, 2959, 1293, 3197, 1595, 3413, 518, 1032, 1033, 1675, 1797, 2315, 521, 1999, 3759, 1215, 4122, 1730, 3966, 1035, 4973, 528, 3911, 3289, 1821, 530, 532, 1874, 533, 1038, 538, 539, 3767, 1929, 3683, 1338, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 548, 549, 2598, 552, 553, 3819, 1259, 4062, 554, 2841, 3515, 1433, 1323, 4301, 555, 558, 3738, 1567, 559, 1054, 1270, 3857, 2175, 1257, 1238, 3662, 561, 1058, 563, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 1912, 573, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 4195, 4223, 1540, 4455, 4512, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1814, 4443, 3761, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 1287, 1713, 1556, 1736, 1995, 1705, 1861, 4120, 4417, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1712, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 1903, 4459, 589, 1563, 1084, 591, 592, 594, 595, 1858, 596, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 1412, 4017, 4477, 1794, 602, 4263, 3072, 2009, 1754, 3888, 603, 604, 1368, 3827, 4103, 1571, 1438, 611, 1093, 612, 1094, 3701, 4389, 614, 615, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2473, 1423, 2771, 1339, 3875, 3070, 2015, 2557, 2795, 2906, 2103, 3299, 3118, 4576, 1103, 1614, 1947, 631, 4479, 3766, 1107, 635, 1813, 636, 2431, 637, 1109, 639, 3706, 1110, 640, 642, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1568, 1766, 3221, 2643, 2739, 3920, 647, 1801, 4279, 3762, 1637, 1509, 648, 1117, 1119, 2965, 2695, 3293, 4722, 1121, 653, 1122, 3264, 655, 656, 657, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3537, 3994, 1319, 4467, 1623, 660, 1123, 664, 1126, 1128, 1129, 1130, 670, 1527, 671, 1772, 1137, 5005, 1933, 1731, 1793, 3342, 1140, 1141, 687, 3822, 1601, 1148, 693, 3905, 694, 1414, 1149, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 1920, 4999, 1544, 703, 4031, 4305, 1636, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 4028, 3989, 704, 1493, 1902, 1152, 4182, 707, 708, 709, 4476, 1375, 713, 714, 1841, 4234, 1154, 1314, 4096, 718, 719, 720, 2063, 1311, 721, 4217, 1627, 1158, 1953, 1201, 3787, 729, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1805, 3705, 1195, 3859, 1164, 1165, 2351, 2423, 1745, 1973, 3807, 4307, 1169, 1454, or 1781.

18. The VP capsid polypeptide of claim 1, wherein X7 of SEQ ID NO: 5014 is R.

19. The VP capsid polypeptide of claim 18, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 740, 15, 742, 743, 17, 22, 24, 1836, 32, 36, 2450, 39, 752, 753, 1998, 3059, 2519, 757, 48, 1952, 50, 52, 760, 2389, 54, 2346, 58, 4086, 1660, 1966, 768, 2402, 772, 71, 72, 2453, 3882, 775, 1806, 3669, 1356, 2132, 81, 84, 85, 87, 4040, 88, 1885, 782, 783, 784, 785, 94, 788, 2173, 98, 2007, 102, 113, 799, 4848, 1444, 4821, 2329, 115, 119, 2290, 123, 806, 128, 134, 812, 145, 817, 154, 2149, 821, 167, 171, 4596, 183, 830, 191, 194, 2071, 195, 4920, 831, 2223, 207, 3901, 211, 212, 213, 215, 224, 4782, 845, 846, 849, 850, 854, 247, 248, 2245, 255, 261, 264, 265, 1477, 270, 874, 876, 279, 882, 1930, 285, 286, 886, 2119, 2468, 887, 888, 4138, 297, 3844, 302, 893, 307, 308, 2155, 1431, 2312, 900, 1635, 906, 2799, 2128, 2918, 1363, 4251, 2622, 3333, 3474, 3614, 2732, 3166, 3151, 3088, 2883, 3318, 2645, 2733, 3213, 3782, 1844, 2523, 2520, 2997, 2681, 3035, 3279, 2764, 3480, 2787, 1808, 3101, 3689, 4147, 1762, 1976, 340, 1594, 2439, 348, 4498, 1518, 1782, 926, 357, 359, 932, 363, 369, 1873, 3780, 4140, 4001, 3709, 3834, 1752, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 3820, 4330, 1872, 3687, 4318, 375, 4210, 3860, 4212, 3695, 1851, 4504, 1910, 1428, 4323, 4422, 4259, 1176, 3711, 4365, 4383, 3969, 4128, 3802, 3863, 3821, 4171, 3824, 4462, 3760, 3753, 2783, 3880, 3943, 4163, 4178, 4199, 3724, 3670, 4482, 3692, 4430, 4316, 3645, 3690, 3589, 3730, 4426, 3851, 4429, 1335, 1717, 1997, 1975, 4280, 4006, 3900, 4298, 4388, 1341, 1350, 1909, 4412, 4407, 4281, 4167, 1893, 3585, 4015, 1747, 4286, 3826, 1473, 1914, 3984, 4495, 4184, 3977, 1707, 4074, 4003, 3915, 1410, 1498, 940, 4131, 4357, 1925, 1466, 1611, 1530, 4168, 4245, 4075, 3987, 1679, 4306, 3869, 3768, 393, 2265, 3618, 4433, 947, 399, 401, 402, 4139, 1352, 406, 415, 418, 420, 4919, 431, 4044, 976, 433, 434, 435, 442, 3873, 3411, 3985, 987, 1485, 2262, 457, 458, 4425, 466, 467, 468, 1468, 474, 1008, 1012, 1016, 4518, 1697, 490, 3616, 2247, 2302, 499, 500, 501, 509, 2110, 512, 1797, 520, 525, 3966, 1038, 537, 1041, 3683, 2165, 542, 4331, 3129, 1044, 4351, 3453, 1047, 1323, 4301, 557, 3738, 559, 1270, 3857, 1056, 2186, 1057, 1059, 565, 566, 3981, 567, 3620, 4002, 3666, 3939, 1221, 1397, 1437, 4337, 4268, 3938, 4292, 4215, 3750, 3633, 4070, 3592, 1827, 3839, 4395, 3855, 3665, 1624, 2395, 1818, 586, 587, 1903, 1080, 1081, 1082, 589, 1084, 1085, 594, 596, 4439, 3997, 1962, 1087, 4777, 606, 607, 610, 1094, 4389, 1603, 1095, 616, 618, 622, 1104, 4536, 3706, 2481, 3100, 3200, 3621, 4179, 1432, 4381, 643, 1115, 644, 2307, 2477, 652, 657, 658, 3994, 4467, 661, 663, 665, 4600, 1137, 1933, 4840, 1140, 678, 680, 683, 686, 692, 693, 696, 2081, 2280, 698, 1400, 4197, 1532, 1854, 706, 711, 712, 4570, 714, 1841, 1314, 4096, 2249, 726, 1846, 2385, 1318, 733, 3651, 1165, 4839, 4968, 4684, or 1454.

20. The VP capsid polypeptide of claim 1, wherein: (a) X3 of SEQ ID NO: 5014 is a basic amino acid residue,(b) X6 of SEQ ID NO: 5014 is a basic amino acid residue, or(c) X3 of SEQ ID NO: 5014 is a basic amino acid residue and X6 of SEQ ID NO: 5014 is a basic amino acid residue.

21. The VP capsid polypeptide of claim 20, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 739, 4177, 1289, 740, 741, 18, 745, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 23, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 34, 35, 36, 37, 38, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 45, 756, 46, 48, 1952, 758, 49, 3122, 2551, 3718, 3484, 3577, 759, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 52, 760, 53, 762, 4659, 54, 3925, 55, 3654, 56, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 63, 64, 768, 771, 65, 66, 67, 68, 3816, 2599, 2706, 2399, 74, 3865, 1549, 1361, 2453, 3882, 3713, 1942, 75, 1312, 4501, 76, 77, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 82, 4065, 83, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 1180, 92, 785, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 794, 795, 104, 105, 106, 1849, 108, 4736, 1579, 110, 1906, 113, 1444, 1344, 116, 802, 117, 118, 2158, 121, 803, 804, 1463, 805, 122, 2058, 124, 125, 127, 4994, 807, 132, 809, 810, 133, 1978, 812, 135, 136, 137, 138, 813, 4673, 140, 815, 1326, 141, 142, 143, 144, 145, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 151, 152, 153, 154, 155, 819, 820, 157, 821, 159, 160, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 180, 826, 827, 181, 828, 182, 183, 4641, 829, 184, 185, 186, 187, 188, 189, 830, 191, 192, 193, 194, 195, 196, 1391, 197, 2223, 200, 201, 202, 203, 204, 205, 832, 833, 206, 834, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 215, 1896, 1522, 3490, 838, 2241, 217, 218, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 226, 227, 230, 231, 842, 232, 233, 235, 844, 236, 237, 2150, 851, 852, 853, 1536, 240, 854, 242, 243, 244, 245, 246, 247, 855, 4634, 249, 250, 251, 252, 253, 254, 255, 857, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 869, 870, 271, 871, 872, 272, 874, 1252, 273, 1591, 275, 1980, 276, 876, 877, 277, 278, 279, 1892, 879, 1539, 880, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 282, 1799, 283, 1626, 1374, 287, 1620, 1290, 1354, 888, 291, 1956, 889, 292, 4324, 293, 4138, 891, 2224, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1515, 1617, 1961, 304, 306, 1589, 4370, 308, 309, 894, 3646, 4059, 1431, 1331, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 897, 898, 321, 322, 899, 1958, 2134, 324, 901, 325, 902, 326, 1491, 329, 330, 905, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 2492, 1762, 4472, 1472, 1529, 4057, 1976, 4507, 1583, 338, 911, 1711, 340, 912, 2013, 341, 1594, 4440, 917, 344, 918, 919, 921, 922, 347, 349, 351, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 925, 1782, 926, 927, 3610, 357, 358, 359, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 1211, 1873, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 1359, 1734, 3650, 1910, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 4125, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 390, 391, 4406, 4341, 1480, 395, 1714, 1422, 396, 2265, 397, 3618, 4433, 1177, 3898, 398, 949, 950, 399, 951, 400, 1965, 2345, 4471, 952, 402, 2475, 403, 404, 4139, 1482, 3602, 4434, 3721, 1592, 1519, 1352, 4202, 4409, 1977, 1917, 407, 408, 1631, 1684, 409, 3889, 958, 959, 412, 960, 414, 415, 961, 1905, 416, 963, 417, 3675, 1833, 3974, 420, 421, 965, 966, 969, 970, 422, 1897, 4754, 423, 4133, 3830, 972, 424, 973, 427, 1708, 4141, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 434, 1606, 979, 2604, 2895, 436, 3448, 1692, 983, 3862, 4055, 4358, 984, 985, 1664, 4045, 3854, 3682, 2491, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 987, 988, 450, 990, 451, 452, 991, 992, 1728, 994, 995, 454, 1696, 998, 3116, 1869, 456, 1386, 999, 3879, 2698, 1001, 461, 1447, 462, 464, 4425, 1645, 1231, 1468, 472, 473, 4725, 476, 1273, 1007, 1744, 1488, 1659, 477, 1604, 481, 4313, 482, 483, 1499, 484, 2513, 1016, 4073, 1777, 1458, 4274, 4539, 4528, 487, 1775, 4205, 1526, 1697, 1017, 2000, 489, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 491, 1948, 3699, 1735, 3792, 4290, 495, 4090, 2247, 496, 1019, 2012, 1803, 3642, 1322, 498, 1021, 501, 1022, 502, 1333, 503, 1023, 1890, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1029, 1366, 2112, 2124, 2376, 1261, 4027, 3478, 3763, 2959, 517, 3197, 1595, 3413, 1448, 518, 2057, 1675, 1797, 2148, 2420, 520, 2315, 523, 1999, 3759, 1215, 4122, 1730, 524, 526, 3966, 3911, 529, 3289, 1821, 530, 531, 1874, 1038, 536, 537, 3767, 1929, 1041, 1042, 3683, 542, 1338, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 544, 545, 546, 4240, 3580, 1046, 1047, 550, 2598, 551, 552, 3819, 1259, 4062, 2841, 1050, 3515, 4301, 557, 1052, 1053, 3738, 1567, 1270, 3857, 1055, 2198, 1257, 1238, 3662, 561, 562, 1058, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 572, 1912, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1451, 1654, 3934, 4080, 4352, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 1950, 1963, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 1559, 1250, 1555, 4114, 1818, 1075, 1076, 1077, 1704, 4448, 1078, 1079, 1786, 585, 3354, 1832, 3432, 2891, 2505, 1903, 1081, 1082, 4459, 1083, 1563, 590, 591, 1085, 594, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 600, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1087, 1088, 3888, 2324, 605, 1368, 3827, 4103, 606, 4549, 1090, 1571, 1091, 1438, 1092, 1093, 612, 1094, 3701, 4389, 613, 1603, 616, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1099, 1100, 1702, 2239, 1101, 1667, 1384, 623, 3700, 1788, 1600, 624, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4818, 4860, 2557, 2795, 2906, 3118, 4657, 4646, 4875, 4627, 4747, 1614, 1947, 4618, 4479, 3766, 632, 1104, 1105, 633, 635, 1813, 636, 2213, 3706, 1110, 640, 1111, 641, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 1114, 1766, 3221, 2643, 2739, 3920, 644, 1116, 645, 646, 2307, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2369, 2695, 3293, 650, 651, 1120, 652, 1121, 4909, 1122, 3264, 655, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3994, 1319, 4467, 1802, 1227, 1623, 661, 2364, 662, 663, 664, 1124, 1125, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 1135, 672, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 679, 1142, 1143, 681, 1145, 682, 685, 688, 3822, 689, 690, 691, 1147, 1601, 3905, 694, 695, 1414, 4793, 4575, 1150, 1795, 1372, 1695, 1866, 4115, 1719, 698, 2217, 1920, 699, 700, 1544, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1854, 1902, 1510, 2340, 4182, 706, 707, 708, 4476, 1245, 714, 1841, 4234, 1314, 4096, 717, 1155, 2249, 4217, 1156, 723, 1157, 1627, 725, 1159, 1953, 1160, 1201, 727, 3787, 4568, 3747, 730, 1846, 3815, 2005, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 734, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1628, 3705, 1195, 3859, 1164, 2394, 1165, 1166, 1745, 1973, 1168, 3807, 4307, 2303, 1454, or 1781.

22. The VP capsid polypeptide of claim 20, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 4884, 738, 4177, 1289, 740, 14, 743, 744, 17, 3477, 1548, 3051, 2982, 2877, 746, 19, 3036, 3426, 3073, 3169, 747, 3362, 2784, 4889, 21, 3192, 4942, 22, 1638, 748, 24, 749, 27, 1703, 1836, 28, 3660, 29, 750, 1640, 33, 35, 36, 2450, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 44, 45, 756, 47, 48, 1952, 3122, 2551, 3718, 3484, 3577, 759, 50, 1308, 3960, 1378, 2994, 3080, 2589, 3681, 51, 760, 2389, 762, 3925, 3654, 763, 4626, 59, 60, 4086, 1740, 1660, 62, 1966, 63, 2438, 768, 66, 67, 2197, 68, 3816, 2599, 2706, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 1312, 4501, 76, 1413, 775, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 1356, 2132, 4065, 1294, 1484, 85, 86, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 780, 1180, 92, 781, 782, 783, 2356, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 1936, 1590, 98, 99, 789, 790, 1298, 101, 1688, 791, 792, 2007, 102, 103, 104, 105, 107, 108, 1579, 110, 1906, 111, 798, 112, 799, 800, 2461, 1444, 801, 114, 115, 1344, 116, 802, 117, 118, 119, 121, 803, 1463, 1760, 124, 806, 126, 128, 807, 129, 131, 808, 2281, 133, 1978, 811, 812, 135, 136, 137, 138, 814, 140, 1326, 141, 142, 143, 2344, 816, 1634, 1302, 817, 818, 147, 148, 149, 150, 151, 154, 155, 819, 820, 156, 157, 2295, 158, 161, 162, 165, 822, 168, 169, 170, 823, 172, 1651, 173, 1483, 174, 825, 176, 178, 180, 827, 181, 828, 4911, 184, 185, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 197, 198, 199, 200, 201, 202, 203, 4775, 205, 832, 206, 834, 207, 208, 209, 210, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 2206, 215, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 225, 4751, 228, 229, 230, 231, 2448, 842, 232, 233, 4782, 234, 235, 238, 847, 239, 850, 851, 853, 1536, 240, 241, 242, 243, 244, 245, 246, 247, 4923, 4696, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 4966, 864, 263, 4970, 2318, 865, 2326, 264, 1241, 266, 1477, 867, 268, 868, 269, 270, 869, 870, 271, 871, 872, 272, 873, 4655, 4972, 1252, 1591, 875, 274, 275, 1980, 276, 876, 877, 2066, 277, 278, 280, 2323, 1892, 1539, 2214, 881, 882, 3601, 3877, 1930, 1460, 282, 1799, 284, 4553, 4772, 1626, 286, 1374, 1620, 1290, 1354, 887, 1956, 889, 4765, 292, 4324, 4138, 891, 296, 3903, 297, 3829, 3809, 4271, 3844, 1436, 300, 1617, 1961, 5010, 302, 304, 305, 2147, 1589, 4370, 307, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 318, 319, 322, 1958, 2454, 323, 324, 901, 1491, 328, 329, 330, 4820, 4484, 1756, 907, 4584, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 3804, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 4222, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 343, 344, 920, 921, 348, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 354, 1782, 927, 3610, 356, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 364, 1279, 365, 1543, 366, 367, 4049, 1633, 1722, 369, 1495, 1566, 373, 1211, 2494, 1726, 1442, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 4149, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 3902, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 2348, 377, 1395, 1584, 4093, 4453, 3778, 4210, 4009, 4264, 4339, 1738, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1336, 3894, 1554, 3576, 4314, 3695, 1850, 4362, 1815, 3656, 3638, 4454, 1443, 1661, 4504, 1359, 3650, 1305, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 1283, 3861, 3644, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 3992, 4423, 4253, 3748, 4119, 1297, 1299, 1954, 4450, 3990, 4029, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 4492, 4365, 4118, 3655, 3886, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 4470, 3941, 4348, 3587, 3818, 3814, 4350, 3821, 3929, 3824, 4465, 4494, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 3634, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 3627, 3777, 1371, 3685, 4482, 4258, 3812, 1581, 4124, 4508, 4500, 3652, 3972, 1309, 1528, 3717, 1217, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4329, 4410, 3703, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 4302, 3758, 4510, 3742, 1710, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1997, 1701, 4280, 4006, 1984, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 1380, 4185, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 1810, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3743, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 3826, 1992, 1656, 1837, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1562, 1847, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1410, 1823, 1498, 1329, 386, 940, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1859, 4183, 1403, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 3591, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1542, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 392, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 953, 401, 403, 955, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4409, 1977, 405, 1631, 1684, 409, 3889, 2117, 411, 413, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 1272, 971, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 978, 4400, 433, 1606, 980, 2604, 2895, 436, 3448, 2188, 438, 1692, 982, 2243, 439, 442, 3862, 4055, 4358, 2276, 985, 1664, 443, 4309, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3985, 3535, 1306, 4084, 3282, 1353, 1780, 448, 2031, 990, 991, 1485, 992, 1728, 993, 4703, 994, 1696, 997, 998, 3116, 1869, 456, 1386, 4778, 2040, 1000, 4981, 3879, 2698, 460, 1001, 461, 1447, 1002, 1003, 463, 464, 4425, 465, 1004, 466, 469, 1231, 1468, 470, 2496, 1005, 476, 1273, 1744, 1488, 1659, 4598, 1604, 479, 1013, 1014, 481, 4313, 1499, 1016, 4073, 1777, 2172, 485, 4274, 4599, 4796, 487, 4710, 1775, 4205, 1526, 1697, 2000, 488, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 3783, 3765, 1538, 3870, 491, 3699, 3792, 4290, 2074, 492, 494, 2421, 4090, 2012, 1803, 3642, 1322, 1020, 502, 1333, 504, 4805, 1890, 507, 3608, 1732, 511, 2397, 1864, 1816, 1531, 513, 3636, 514, 1699, 1027, 4987, 1366, 4664, 4950, 4027, 3478, 2959, 1293, 3197, 1595, 3413, 518, 4698, 1032, 1033, 1675, 1797, 4578, 4854, 2315, 521, 1999, 3759, 1215, 4122, 1730, 3966, 1035, 4973, 528, 3911, 3289, 1821, 530, 2426, 532, 1874, 533, 1038, 538, 539, 3767, 1929, 3683, 2100, 4853, 1338, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 548, 549, 2598, 552, 553, 3819, 1259, 4062, 554, 2841, 3515, 1433, 1323, 4301, 555, 558, 3738, 1567, 559, 1054, 1270, 3857, 2175, 1257, 1238, 3662, 561, 1058, 563, 4872, 2097, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 570, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 1912, 573, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 1409, 4195, 4223, 1540, 4455, 4512, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1071, 1814, 4443, 3761, 1346, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1705, 1861, 4120, 4417, 1292, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1712, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 4583, 1903, 1080, 4459, 589, 1563, 1084, 591, 592, 594, 595, 1858, 596, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 1412, 601, 4017, 4477, 1794, 602, 4263, 3072, 2009, 1754, 1088, 3888, 603, 604, 1368, 3827, 4103, 1571, 1438, 2069, 611, 1093, 612, 1094, 3701, 4389, 614, 5000, 615, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2473, 1423, 2771, 1339, 3875, 3070, 2015, 2557, 2795, 2906, 2103, 3299, 3118, 4838, 4965, 4605, 4576, 1103, 1614, 1947, 631, 4479, 3766, 1107, 635, 1813, 636, 2431, 637, 1109, 4577, 639, 3706, 1110, 640, 1111, 4581, 4644, 4734, 642, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1585, 1568, 1766, 3221, 2643, 2739, 4629, 3920, 4603, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4590, 648, 1117, 4800, 4724, 4674, 1119, 2965, 2695, 3293, 4722, 1121, 4784, 653, 1122, 3264, 655, 656, 657, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3537, 3994, 1319, 4467, 1623, 660, 4714, 4812, 1123, 664, 2138, 1126, 1128, 1129, 1130, 670, 1527, 671, 1772, 1133, 2196, 1136, 1137, 5005, 1933, 1731, 1793, 3342, 1140, 1141, 4525, 687, 3822, 1601, 1148, 693, 3905, 694, 1414, 1149, 4756, 4859, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2194, 1920, 4999, 1544, 703, 4031, 4305, 1636, 1393, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 4715, 704, 1493, 1902, 1152, 4824, 4182, 707, 708, 709, 4732, 4476, 1375, 713, 714, 715, 1841, 4234, 1154, 1314, 4096, 4895, 718, 719, 720, 2063, 1311, 721, 4903, 4885, 4217, 1627, 2116, 1158, 724, 5013, 4894, 1953, 1201, 3787, 729, 2485, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4976, 4294, 1582, 4587, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1805, 3705, 1195, 3859, 1164, 1165, 2351, 4835, 4571, 2423, 1745, 1973, 1168, 3807, 4307, 1169, 1454, or 1781.

23. The VP capsid polypeptide of claim 20, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 4177, 1289, 740, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 35, 36, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 45, 756, 48, 1952, 3122, 2551, 3718, 3484, 3577, 759, 3960, 1378, 2994, 3080, 2589, 3681, 760, 762, 3925, 3654, 60, 4086, 1740, 1660, 62, 1966, 63, 768, 66, 67, 68, 3816, 2599, 2706, 74, 3865, 1549, 1361, 2453, 3882, 3713, 1942, 1312, 4501, 76, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 4065, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 1180, 92, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 99, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 104, 105, 108, 1579, 110, 1906, 1444, 1344, 116, 802, 117, 118, 121, 803, 1463, 124, 807, 133, 1978, 812, 135, 136, 137, 138, 140, 1326, 141, 142, 143, 1634, 1302, 817, 818, 147, 148, 149, 151, 154, 155, 819, 820, 157, 165, 822, 168, 169, 170, 823, 1651, 173, 1483, 174, 825, 176, 180, 827, 181, 828, 184, 185, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 197, 200, 201, 202, 203, 205, 832, 206, 834, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 215, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 230, 231, 842, 232, 233, 235, 851, 853, 1536, 240, 242, 243, 244, 245, 246, 247, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 2326, 264, 1241, 266, 1477, 867, 869, 870, 271, 871, 872, 272, 1252, 1591, 275, 1980, 276, 876, 877, 277, 278, 1892, 1539, 3601, 3877, 1930, 1460, 282, 1799, 1626, 1374, 1620, 1290, 1354, 1956, 889, 292, 4324, 4138, 891, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1617, 1961, 304, 1589, 4370, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 322, 1958, 324, 901, 1491, 329, 330, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 4222, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 344, 921, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 1782, 927, 3610, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 367, 4049, 1633, 1722, 369, 1495, 1566, 1211, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4093, 4453, 3778, 4210, 4009, 4264, 4339, 1738, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1336, 3894, 1554, 3576, 4314, 3695, 4362, 1815, 3656, 3638, 4454, 1443, 1661, 1359, 3650, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 3748, 4119, 1297, 1299, 4450, 3990, 4029, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 4492, 4365, 4118, 3655, 3886, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 4470, 3941, 4348, 3587, 3818, 3814, 4350, 3821, 3929, 3824, 4465, 4494, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 3634, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 4124, 4508, 4500, 3652, 3972, 1309, 1528, 3717, 1217, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4329, 4410, 3703, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 4302, 3758, 4510, 3742, 1710, 1335, 1997, 1701, 4280, 4006, 1984, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 1380, 4185, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 1810, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 4125, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3743, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 1837, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1562, 1847, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 3591, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1542, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 4031, 482, 3602, 4434, 3721, 1592, 1519, 1352, 4409, 1977, 1631, 1684, 409, 3889, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 1606, 2604, 2895, 436, 3448, 1692, 3862, 4055, 4358, 985, 1664, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 990, 991, 992, 1728, 994, 1696, 998, 3116, 1869, 456, 1386, 3879, 2698, 1001, 461, 1447, 464, 4425, 1231, 1468, 476, 1273, 1744, 1488, 1659, 1604, 481, 4313, 1499, 1016, 4073, 1777, 4274, 487, 1775, 4205, 1526, 1697, 2000, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 3783, 3765, 491, 3699, 3792, 4290, 4090, 2012, 1803, 3642, 1322, 502, 1333, 1890, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1366, 4027, 3478, 2959, 3197, 1595, 3413, 518, 1675, 1797, 2315, 1999, 3759, 1215, 4122, 1730, 3966, 3911, 3289, 1821, 530, 1874, 1038, 3767, 1929, 3683, 1338, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 2598, 552, 3819, 1259, 4062, 2841, 3515, 4301, 3738, 1567, 1270, 3857, 1257, 1238, 3662, 561, 1058, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 1912, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 1409, 4195, 4223, 1540, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1814, 4443, 3761, 1346, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1705, 1861, 4120, 4417, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 1903, 4459, 1563, 591, 594, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1088, 3888, 1368, 3827, 4103, 1571, 1438, 1093, 612, 1094, 3701, 4389, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2771, 1339, 3875, 3070, 2557, 2795, 2906, 3118, 1614, 1947, 4479, 3766, 635, 1813, 636, 3706, 1110, 640, 1111, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1585, 1766, 3221, 2643, 2739, 3920, 2307, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2695, 3293, 1121, 1122, 3264, 655, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3994, 1319, 4467, 1623, 664, 1128, 1129, 1130, 670, 1527, 671, 1772, 5005, 1933, 1731, 1793, 3342, 3822, 1601, 3905, 694, 1414, 1795, 1372, 1695, 1866, 4115, 1719, 1920, 1544, 703, 4031, 4305, 1636, 1393, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1902, 4182, 707, 708, 4476, 714, 1841, 4234, 1314, 4096, 4217, 1627, 1953, 1201, 3787, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 3705, 1195, 3859, 1164, 1165, 1745, 1973, 1168, 3807, 4307, 1454, or 1781.

24. The VP capsid polypeptide of any one of claims 20-23, wherein the basic residue is selected from the group consisting of K, R, and H.

25. The VP capsid polypeptide of any one of claims 20-24, wherein X3 of SEQ ID NO: 5014 is K or R.

26. The VP capsid polypeptide of claim 25, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 4177, 1289, 740, 741, 18, 745, 3477, 1548, 3051, 2982, 2877, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 23, 1638, 748, 1703, 1836, 3660, 29, 750, 1640, 33, 34, 35, 36, 37, 38, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 45, 756, 46, 48, 1952, 758, 49, 3122, 2551, 3718, 3484, 3577, 759, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 760, 53, 3925, 55, 3654, 56, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 63, 64, 768, 771, 65, 66, 67, 68, 3816, 2599, 2706, 74, 3865, 1549, 1361, 3882, 3713, 1942, 1312, 4501, 76, 77, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 3945, 2854, 3523, 3669, 82, 4065, 83, 1294, 1484, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 90, 91, 779, 1180, 92, 785, 786, 94, 95, 1831, 1867, 4458, 97, 1970, 1936, 1590, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 103, 794, 795, 104, 105, 106, 1849, 108, 1579, 110, 1906, 113, 1444, 1344, 116, 802, 117, 118, 121, 803, 804, 1463, 805, 122, 124, 125, 127, 807, 132, 809, 810, 133, 1978, 812, 135, 136, 137, 138, 813, 140, 815, 1326, 141, 142, 143, 144, 145, 1634, 1302, 817, 146, 818, 147, 148, 149, 151, 152, 153, 154, 155, 819, 820, 157, 159, 160, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 826, 827, 181, 828, 182, 829, 184, 185, 186, 187, 188, 189, 830, 191, 192, 193, 194, 195, 196, 1391, 197, 200, 201, 202, 203, 204, 205, 832, 833, 206, 834, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 215, 1896, 1522, 3490, 838, 217, 218, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 226, 227, 230, 231, 842, 232, 233, 844, 236, 237, 851, 852, 853, 1536, 240, 854, 242, 243, 244, 245, 246, 247, 249, 250, 251, 252, 253, 254, 255, 857, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 264, 1241, 265, 266, 866, 1477, 267, 867, 869, 870, 271, 871, 872, 272, 1252, 273, 1591, 275, 1980, 276, 876, 877, 277, 278, 279, 1892, 1539, 880, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 282, 1799, 283, 1626, 1374, 287, 1620, 1290, 1354, 888, 291, 1956, 889, 292, 4324, 293, 4138, 891, 3903, 297, 3829, 3809, 4271, 3844, 1436, 1515, 1617, 1961, 304, 306, 1589, 4370, 308, 309, 894, 3646, 4059, 1431, 1331, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 898, 321, 322, 899, 1958, 901, 325, 902, 326, 1491, 329, 330, 905, 4484, 1756, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 2979, 2542, 1762, 4472, 1472, 1529, 4057, 1976, 4507, 1583, 338, 911, 1711, 340, 912, 2013, 341, 4440, 917, 344, 918, 919, 921, 922, 347, 351, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 4145, 354, 925, 1782, 926, 927, 3610, 357, 359, 4224, 1918, 1959, 3736, 1770, 931, 4155, 364, 1279, 365, 1543, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 1211, 1873, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 1359, 1734, 3650, 1910, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1680, 4441, 3628, 3725, 1945, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 390, 391, 4406, 4341, 1480, 395, 1714, 1422, 396, 397, 3618, 4433, 1177, 3898, 398, 949, 950, 399, 951, 400, 1965, 4471, 952, 402, 2475, 403, 404, 4139, 1482, 3602, 4434, 3721, 1592, 1519, 1352, 4202, 4409, 1977, 1917, 407, 408, 1631, 1684, 409, 3889, 958, 959, 412, 960, 414, 415, 961, 1905, 416, 963, 417, 3675, 1833, 3974, 420, 421, 965, 966, 969, 970, 422, 1897, 423, 4133, 3830, 972, 424, 973, 427, 1708, 4141, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 4400, 434, 1606, 979, 2604, 2895, 436, 3448, 1692, 983, 3862, 4055, 4358, 984, 985, 1664, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3535, 1306, 4084, 3282, 1780, 987, 988, 990, 451, 452, 991, 992, 1728, 994, 995, 454, 1696, 3116, 1869, 456, 1386, 999, 3879, 2698, 1001, 461, 1447, 462, 464, 4425, 1645, 1231, 1468, 472, 473, 476, 1273, 1007, 1744, 1488, 1659, 477, 1604, 481, 4313, 482, 483, 1499, 484, 1016, 4073, 1777, 1458, 4274, 487, 1775, 4205, 1526, 1697, 1017, 2000, 489, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 491, 1948, 3699, 1735, 3792, 4290, 495, 4090, 496, 2012, 1803, 3642, 1322, 498, 1021, 1022, 502, 1333, 503, 1023, 1890, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 3636, 1699, 1027, 1029, 1366, 2112, 1261, 4027, 3478, 3763, 2959, 517, 3197, 1595, 3413, 1448, 518, 1675, 1797, 520, 1999, 3759, 1215, 4122, 1730, 524, 526, 3966, 3911, 529, 3289, 1821, 530, 531, 1874, 1038, 536, 537, 3767, 1929, 1041, 1042, 3683, 542, 1338, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 3720, 4351, 4414, 1673, 3453, 3254, 1649, 546, 4240, 3580, 1046, 1047, 550, 2598, 551, 552, 3819, 1259, 4062, 2841, 1050, 3515, 4301, 1052, 1053, 3738, 1567, 1270, 3857, 1055, 1257, 1238, 3662, 561, 562, 1058, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 572, 1912, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1451, 1654, 3934, 4080, 4352, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 1950, 1963, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1785, 1236, 4293, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 1559, 1250, 1555, 4114, 1818, 1075, 1076, 1077, 1704, 4448, 1078, 1079, 1786, 585, 3354, 1832, 3432, 2891, 2505, 1903, 1081, 1082, 4459, 1083, 1563, 590, 591, 1085, 594, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 600, 601, 4017, 4477, 1794, 4263, 3072, 2009, 1754, 1087, 1088, 3888, 1368, 3827, 4103, 606, 1090, 1571, 1091, 1438, 1092, 1093, 612, 1094, 3701, 4389, 613, 1603, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1100, 1702, 1101, 1667, 1384, 623, 3700, 1788, 1600, 624, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4860, 2557, 2795, 2906, 3118, 1614, 1947, 4479, 3766, 632, 1104, 1105, 633, 1813, 636, 3706, 1110, 640, 1111, 641, 642, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 1114, 1766, 3221, 2643, 2739, 3920, 644, 1116, 645, 646, 647, 1801, 4279, 3762, 1637, 1509, 1119, 2965, 2369, 2695, 3293, 650, 651, 1120, 652, 1121, 3264, 655, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 3994, 1319, 4467, 1802, 1227, 1623, 662, 663, 664, 1124, 1125, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 1135, 672, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 679, 1142, 1143, 681, 1145, 682, 685, 3822, 689, 690, 691, 1147, 1601, 3905, 694, 695, 1414, 1150, 1795, 1372, 1695, 1866, 4115, 1719, 698, 1920, 699, 700, 1544, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 1493, 1854, 1902, 1510, 4182, 706, 707, 708, 4476, 1245, 714, 1841, 4234, 1314, 4096, 717, 1155, 4217, 1156, 723, 1157, 1627, 725, 1159, 1953, 1160, 1201, 727, 3787, 3747, 730, 1846, 3815, 2005, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 734, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1628, 3705, 1195, 3859, 1164, 1165, 1166, 1745, 1973, 1168, 3807, 4307, 1454, or 1781.

27. The VP capsid polypeptide of any one of claims 20-24, wherein X6 of SEQ ID NO: 5014 is K or R.

28. The VP capsid polypeptide of claim 27, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 738, 4177, 1289, 740, 14, 743, 744, 17, 3477, 1548, 3051, 2982, 2877, 746, 19, 3036, 3426, 3073, 3169, 747, 3362, 2784, 21, 3192, 22, 1638, 748, 24, 749, 27, 1703, 1836, 28, 3660, 29, 750, 1640, 33, 35, 36, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 44, 45, 756, 47, 48, 1952, 3122, 2551, 3718, 3484, 3577, 1308, 3960, 1378, 2994, 3080, 2589, 3681, 51, 760, 762, 3925, 3654, 763, 59, 60, 4086, 1740, 1660, 62, 1966, 63, 2438, 768, 66, 67, 68, 3816, 2599, 2706, 72, 73, 74, 3865, 1549, 1361, 3882, 773, 3713, 1942, 1312, 4501, 76, 1413, 775, 1560, 4289, 3757, 3593, 3908, 4397, 4415, 3723, 3754, 4360, 3945, 2854, 3523, 3669, 1356, 4065, 1294, 1484, 85, 86, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 1490, 1885, 1926, 89, 780, 1180, 92, 781, 782, 783, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 1936, 1590, 98, 99, 789, 790, 1298, 1688, 791, 792, 2007, 102, 103, 104, 105, 107, 108, 1579, 1906, 111, 798, 112, 799, 800, 1444, 801, 114, 115, 1344, 116, 802, 117, 118, 119, 121, 803, 1463, 1760, 806, 126, 128, 807, 129, 131, 808, 133, 1978, 811, 812, 135, 136, 137, 138, 814, 140, 1326, 141, 142, 143, 2344, 816, 1634, 1302, 817, 818, 147, 148, 149, 150, 151, 154, 155, 819, 820, 156, 157, 158, 161, 162, 165, 822, 168, 169, 170, 823, 172, 1651, 173, 1483, 174, 825, 176, 178, 180, 827, 181, 828, 4911, 184, 186, 188, 189, 830, 192, 193, 194, 196, 1391, 198, 199, 200, 201, 202, 203, 205, 832, 206, 834, 207, 208, 209, 210, 835, 836, 1334, 3901, 3312, 2649, 1450, 4386, 3028, 1446, 1522, 3490, 217, 219, 1612, 220, 221, 222, 839, 223, 840, 224, 225, 228, 229, 230, 231, 842, 232, 233, 234, 238, 847, 239, 850, 851, 853, 1536, 240, 241, 242, 243, 244, 245, 247, 250, 251, 254, 255, 857, 256, 258, 259, 859, 260, 861, 862, 864, 263, 2318, 865, 2326, 264, 1241, 266, 1477, 867, 268, 868, 269, 270, 869, 870, 271, 871, 872, 272, 873, 1252, 1591, 875, 274, 275, 276, 876, 877, 277, 278, 280, 1892, 1539, 881, 3601, 3877, 1460, 282, 1799, 284, 1626, 286, 1374, 1620, 1290, 1354, 887, 1956, 889, 292, 4324, 4138, 891, 296, 3903, 297, 3829, 3809, 4271, 3844, 1436, 300, 1617, 1961, 302, 304, 305, 2147, 1589, 4370, 307, 3646, 4059, 1431, 1331, 312, 1779, 313, 896, 1558, 1552, 318, 319, 322, 1958, 323, 324, 901, 1491, 328, 329, 4484, 907, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2785, 3249, 3527, 4460, 3352, 2569, 4457, 2011, 4319, 3906, 1533, 1755, 4248, 1557, 3804, 1602, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 2869, 2610, 3298, 2775, 3108, 2603, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 3548, 3179, 3407, 3841, 3347, 3142, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3120, 3286, 2843, 3465, 3946, 2682, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 4269, 3487, 3489, 3019, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 1911, 908, 1935, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 3689, 2968, 1457, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 1762, 4472, 1529, 4057, 1976, 4507, 1583, 1711, 2013, 1594, 4440, 344, 920, 921, 4498, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 354, 1782, 927, 3610, 356, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 364, 1279, 365, 1543, 366, 367, 4049, 1633, 1722, 369, 1495, 1566, 373, 1211, 1726, 1442, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4506, 4156, 4036, 4030, 4016, 3899, 1247, 1855, 3919, 1244, 4140, 3930, 4117, 4189, 4001, 3643, 3619, 1240, 1575, 3871, 4135, 4408, 3604, 1274, 4149, 3741, 1938, 3709, 3622, 3834, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 4214, 3902, 1219, 1486, 1512, 1516, 4047, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3687, 4318, 4243, 3866, 3704, 4172, 1856, 3324, 2769, 2678, 1561, 3296, 377, 1395, 1584, 4093, 4453, 4210, 4009, 4264, 4339, 1738, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1185, 3932, 3858, 1198, 4192, 3611, 1919, 3790, 3712, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1336, 3894, 3576, 4314, 3695, 1850, 4362, 1815, 3638, 4454, 1661, 4504, 1359, 3650, 1305, 1648, 3831, 4435, 4451, 1993, 3849, 1718, 4068, 1835, 1425, 1428, 4380, 1658, 1452, 4024, 4072, 3791, 4491, 4323, 4014, 1304, 1511, 1981, 1676, 4422, 1283, 3861, 3644, 4259, 1418, 1176, 4216, 1421, 3992, 4423, 4253, 3748, 4119, 1297, 1954, 4450, 3711, 4344, 1578, 4384, 3892, 3674, 3595, 4405, 3973, 4109, 4159, 3744, 4387, 4275, 4492, 4365, 4118, 4278, 3751, 3678, 4353, 3175, 2970, 1228, 3534, 3437, 3406, 3641, 4470, 3941, 4348, 3587, 3818, 4350, 3821, 3929, 3824, 4465, 1398, 3828, 1284, 3773, 4209, 3014, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4163, 4486, 4178, 1643, 4152, 4445, 4303, 4284, 1213, 4382, 1399, 3714, 4487, 3615, 4018, 4420, 4121, 3724, 4282, 4310, 4488, 4127, 3670, 4052, 3627, 3777, 1371, 3685, 4258, 3812, 1581, 4124, 4508, 4500, 3652, 3972, 1528, 3717, 2740, 3125, 3546, 3842, 4404, 3690, 3962, 4136, 3589, 3907, 4153, 2707, 4180, 3923, 4444, 4361, 4394, 3758, 4510, 3742, 1710, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1997, 1701, 4280, 4006, 1984, 3833, 2561, 4442, 3900, 4298, 1761, 4388, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 3776, 3658, 4064, 4011, 4272, 4503, 1324, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 3998, 3686, 3696, 4463, 3853, 4244, 4083, 1909, 3897, 1546, 3613, 3273, 3452, 3525, 1229, 3835, 1234, 3970, 3856, 3586, 1175, 4321, 2778, 4412, 4407, 3823, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 3843, 1677, 1524, 1525, 1974, 1239, 4167, 3740, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1580, 4060, 1576, 1212, 3921, 1174, 4061, 4021, 3693, 3734, 1382, 3684, 3806, 3635, 3976, 3840, 4286, 3836, 4161, 3659, 3605, 4392, 4328, 1316, 4173, 4265, 1246, 1629, 1829, 3826, 1992, 1656, 1914, 1839, 3984, 3910, 4160, 4184, 4132, 4250, 1792, 3769, 1534, 4003, 1689, 1599, 1265, 1410, 1823, 1498, 1329, 386, 940, 1655, 3874, 4261, 3626, 3579, 1644, 3936, 4054, 4260, 4297, 4357, 4022, 4046, 1222, 1996, 3788, 3953, 4226, 4277, 4101, 3797, 4019, 3771, 3632, 1402, 4137, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1859, 4183, 1403, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1765, 3719, 3584, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 3978, 3965, 4464, 3813, 4154, 1365, 3846, 4345, 4379, 3603, 3937, 3801, 1787, 1214, 4483, 4201, 1845, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 3745, 3975, 4256, 4308, 4000, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 4005, 4092, 4372, 4283, 3805, 4151, 3982, 3597, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 4304, 3779, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 942, 1505, 1709, 3600, 3914, 3948, 1865, 1716, 3961, 1506, 4221, 1376, 1683, 4276, 1721, 1632, 3607, 1455, 1913, 1497, 1317, 1951, 1778, 3768, 4225, 1668, 390, 4406, 4341, 1480, 1714, 1422, 397, 3618, 4433, 1177, 3898, 398, 950, 400, 1965, 4471, 953, 401, 403, 955, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4409, 1977, 405, 1631, 1684, 409, 3889, 2117, 411, 413, 414, 415, 961, 1905, 416, 963, 3675, 1833, 3974, 965, 970, 1897, 1272, 4133, 3830, 972, 424, 427, 1708, 4141, 3749, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 978, 4400, 1606, 980, 2604, 2895, 436, 3448, 2188, 438, 1692, 442, 3862, 4055, 4358, 2276, 985, 1664, 443, 4309, 4045, 3854, 3682, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 3985, 3535, 1306, 4084, 3282, 1780, 448, 990, 991, 1485, 992, 1728, 993, 994, 1696, 997, 3116, 1869, 456, 1386, 1000, 3879, 2698, 460, 1001, 461, 1447, 1002, 1003, 463, 464, 4425, 465, 1004, 466, 469, 1231, 1468, 470, 1005, 476, 1273, 1744, 1488, 1659, 1604, 479, 1013, 1014, 481, 4313, 1499, 1016, 4073, 1777, 485, 4274, 487, 1775, 4205, 1526, 1697, 2000, 488, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 4473, 4085, 4401, 3783, 3765, 1538, 3870, 491, 3699, 3792, 4290, 494, 2421, 4090, 2012, 1803, 3642, 1322, 1020, 502, 1333, 504, 1890, 507, 3608, 1732, 1864, 1816, 1531, 513, 3636, 514, 1699, 1027, 1366, 4950, 4027, 3478, 2959, 1293, 3197, 1595, 3413, 518, 1032, 1033, 1675, 1797, 2315, 521, 1999, 3759, 1215, 4122, 1730, 3966, 1035, 4973, 528, 3911, 3289, 1821, 530, 532, 1874, 533, 1038, 538, 539, 3767, 1929, 3683, 1338, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 3720, 4351, 4414, 3453, 3254, 1649, 544, 4240, 3580, 1046, 548, 549, 2598, 552, 553, 3819, 1259, 4062, 554, 2841, 3515, 1433, 1323, 4301, 555, 558, 3738, 1567, 559, 1054, 1270, 3857, 2175, 1257, 1238, 3662, 561, 1058, 563, 1061, 4203, 1899, 3981, 1062, 1303, 4116, 1946, 3620, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 1401, 4438, 1895, 1264, 1912, 573, 3939, 4170, 4056, 1271, 1521, 1221, 1451, 3934, 4080, 4352, 1700, 3739, 1419, 1811, 3950, 1690, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3881, 3938, 4198, 4416, 4229, 4292, 4193, 4325, 4375, 4432, 4215, 3944, 4195, 4223, 1540, 4455, 4512, 1723, 3750, 4070, 4104, 4235, 1863, 4346, 1881, 1814, 4443, 3761, 1587, 3592, 576, 4469, 1275, 1950, 4129, 1296, 1551, 3733, 4111, 3993, 4108, 1287, 1713, 1556, 1736, 1995, 1705, 1861, 4120, 4417, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 3928, 4295, 3715, 3855, 3609, 4076, 4175, 3927, 1757, 4299, 1773, 1364, 1462, 4007, 3729, 3665, 3722, 1691, 1712, 1624, 1751, 1394, 3924, 3952, 581, 2003, 1559, 1250, 1555, 4114, 1818, 1076, 4448, 1078, 1786, 3354, 1832, 3432, 2891, 1903, 4459, 589, 1563, 1084, 591, 592, 594, 595, 1858, 596, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 4439, 3852, 3997, 3847, 4050, 3377, 4424, 4143, 4493, 3492, 1412, 4017, 4477, 1794, 602, 4263, 3072, 2009, 1754, 3888, 603, 604, 1368, 3827, 4103, 1571, 1438, 611, 1093, 612, 1094, 3701, 4389, 614, 615, 1332, 1715, 4369, 1652, 1541, 1921, 1733, 1373, 1870, 619, 4218, 1798, 1702, 1384, 3700, 1788, 1600, 624, 2473, 1423, 2771, 1339, 3875, 3070, 2015, 2557, 2795, 2906, 2103, 3299, 3118, 4576, 1103, 1614, 1947, 631, 4479, 3766, 1107, 635, 1813, 636, 2431, 637, 1109, 639, 3706, 1110, 640, 642, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 1269, 3095, 1286, 3624, 4481, 3511, 2735, 4381, 3295, 1568, 1766, 3221, 2643, 2739, 3920, 647, 1801, 4279, 3762, 1637, 1509, 648, 1117, 1119, 2965, 2695, 3293, 4722, 1121, 653, 1122, 3264, 655, 656, 657, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 3537, 3994, 1319, 4467, 1623, 660, 1123, 664, 1126, 1128, 1129, 1130, 670, 1527, 671, 1772, 1137, 5005, 1933, 1731, 1793, 3342, 1140, 1141, 687, 3822, 1601, 1148, 693, 3905, 694, 1414, 1149, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 1920, 4999, 1544, 703, 4031, 4305, 1636, 3810, 4452, 3677, 4227, 4402, 4157, 4197, 1337, 1253, 4028, 3989, 704, 1493, 1902, 1152, 4182, 707, 708, 709, 4476, 1375, 713, 714, 1841, 4234, 1154, 1314, 4096, 718, 719, 720, 2063, 1311, 721, 4217, 1627, 1158, 1953, 1201, 3787, 729, 3747, 730, 1846, 3815, 1964, 1822, 1262, 4480, 1537, 1291, 1318, 4294, 1582, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1805, 3705, 1195, 3859, 1164, 1165, 2351, 2423, 1745, 1973, 3807, 4307, 1169, 1454, or 1781.

29. The VP capsid polypeptide of any one of claims 1-28, wherein: (a) X3 of SEQ ID NO: 5014 is not D,(b) X6 of SEQ ID NO: 5014 is not D, or(c) X3 of SEQ ID NO: 5014 is not D and X6 of SEQ ID NO: 5014 is not D.

30. The VP capsid polypeptide of claim 29, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 2144, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 2167, 52, 760, 53, 2389, 4755, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2379, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 5009, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 4817, 2260, 1626, 2082, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2338, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 4937, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2345, 4471, 952, 953, 401, 402, 2475, 403, 404, 4758, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 4919, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 2055, 1692, 982, 2388, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 4874, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 1697, 1017, 2000, 4692, 4795, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4699, 4608, 4781, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2067, 1031, 2228, 1448, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2225, 4240, 3580, 4680, 1046, 548, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4603, 4762, 4819, 2221, 4636, 4992, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 4628, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 2275, 1166, 4968, 4912, 2423, 737, 1167, 4989, 4684, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

31. The VP capsid polypeptide of claim 29, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 2167, 52, 760, 53, 2389, 4934, 4951, 4755, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4691, 107, 2440, 1849, 108, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 5009, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 4596, 2020, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 4914, 4947, 196, 1391, 197, 4534, 4726, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 268, 868, 269, 4668, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 2260, 285, 1626, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 2408, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 1635, 4820, 905, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2338, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 4057, 4937, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2343, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 401, 2475, 403, 404, 4758, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 2055, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 442, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 2142, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2210, 2247, 2478, 2047, 496, 4620, 4978, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 4699, 4608, 4781, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4805, 2065, 1890, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 2067, 1031, 2228, 1448, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2084, 2225, 4240, 3580, 4680, 1046, 548, 2062, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4577, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4603, 4762, 4819, 2221, 4636, 4992, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4541, 2200, 4580, 4858, 648, 649, 1117, 4780, 4800, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 653, 654, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4606, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 4879, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4642, 722, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 2024, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4628, 4294, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4835, 2259, 4571, 2275, 1166, 4968, 2250, 2423, 737, 1167, 4989, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

32. The VP capsid polypeptide of claim 29, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 2167, 52, 760, 53, 2389, 4755, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 2356, 784, 785, 786, 94, 95, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4691, 107, 2440, 1849, 108, 797, 4736, 2509, 2018, 2227, 4787, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 5009, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 4914, 4947, 196, 1391, 197, 4534, 4726, 198, 199, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2448, 841, 842, 232, 233, 4782, 234, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 268, 868, 269, 4668, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 2260, 1626, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 311, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 1635, 4820, 905, 331, 4706, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4561, 333, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2338, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 4057, 4937, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2345, 4471, 952, 953, 401, 2475, 403, 404, 4758, 954, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 2055, 1692, 982, 2388, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 1697, 1017, 2000, 4692, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2210, 2247, 2478, 2047, 496, 4620, 4978, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4699, 4608, 4781, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4805, 2065, 1890, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2067, 1031, 2228, 1448, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2225, 4240, 3580, 4680, 1046, 548, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 595, 4931, 2407, 1858, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4607, 4719, 1116, 645, 646, 4611, 2353, 4603, 4762, 4819, 2221, 4636, 4992, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4541, 2200, 4580, 4858, 648, 649, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 653, 654, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4738, 4811, 4570, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 4628, 4294, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4835, 2259, 2275, 1166, 4968, 2423, 737, 1167, 4989, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

33. The VP capsid polypeptide of any one of claims 1-28, wherein: (a) X3 of SEQ ID NO: 5014 is not E,(b) X6 of SEQ ID NO: 5014 is not E, or(c) X3 of SEQ ID NO: 5014 is not E and X6 of SEQ ID NO: 5014 is not E.

34. The VP capsid polypeptide of claim 33, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 34, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 2072, 2034, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 52, 760, 53, 2389, 4934, 4951, 761, 4591, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 57, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 2140, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 2379, 81, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 4556, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 2075, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 123, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 4533, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 5009, 144, 145, 816, 4654, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 4911, 182, 4582, 4873, 4596, 2020, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 2218, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4939, 4689, 281, 878, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4553, 4772, 4817, 2260, 285, 1626, 2082, 885, 286, 1374, 886, 2119, 2468, 287, 2408, 1620, 1290, 2425, 2482, 4564, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2362, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 293, 890, 294, 295, 4138, 891, 2297, 2254, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 303, 304, 305, 2452, 2147, 306, 2293, 1589, 893, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 4609, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 2363, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 2338, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 4937, 2048, 1976, 4507, 1583, 338, 2078, 2372, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 2403, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2037, 352, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 371, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2510, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 2476, 3324, 2769, 2678, 1561, 3296, 375, 2343, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 1941, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 387, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 402, 2475, 403, 404, 4758, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 3675, 1833, 3974, 419, 964, 420, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 427, 1708, 4676, 428, 4141, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 4563, 2188, 437, 438, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 441, 2474, 442, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 2242, 453, 2286, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 1006, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1010, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 4720, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4639, 4846, 4623, 4650, 4595, 2195, 4681, 2142, 487, 2182, 4710, 1775, 2083, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 4795, 2480, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 499, 2049, 2404, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 1031, 2228, 1448, 518, 2057, 2305, 2133, 2061, 4526, 4617, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1041, 1042, 3683, 2100, 4853, 2300, 2165, 540, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 2121, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 2084, 4240, 3580, 4680, 1046, 548, 2062, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 2304, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 2256, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 2321, 1086, 601, 4017, 4477, 1794, 2483, 4776, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 2154, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 4818, 4860, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 2377, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4799, 4850, 1103, 4747, 1614, 1947, 2237, 630, 631, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 4827, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4577, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4548, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4516, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 1117, 4780, 4800, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 2191, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 674, 2456, 4606, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 1139, 677, 4840, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 2512, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 4652, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 4879, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 2414, 718, 1155, 719, 720, 2063, 1311, 4921, 721, 4642, 722, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 730, 731, 2024, 1846, 2507, 2368, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 4571, 2275, 1166, 4968, 2250, 4912, 2423, 737, 1167, 4989, 4684, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

35. The VP capsid polypeptide of claim 33, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 2469, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 2144, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 2167, 52, 760, 53, 2389, 4934, 4951, 4755, 761, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 2438, 2041, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 2379, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 2299, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4864, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 4791, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 144, 145, 816, 4654, 2125, 4663, 4810, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 2130, 4911, 182, 4582, 4873, 4596, 2020, 2189, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2090, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 4974, 4790, 4915, 2464, 4567, 4774, 4964, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 4535, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 2317, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4689, 281, 878, 2416, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4871, 4553, 4772, 4817, 2260, 285, 1626, 2082, 885, 286, 1374, 886, 2119, 2504, 2468, 287, 1620, 1290, 2425, 2482, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 890, 294, 295, 4138, 891, 2297, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 2060, 303, 304, 305, 2452, 2147, 4574, 4538, 306, 2293, 1589, 893, 4946, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 4943, 3002, 2986, 910, 2979, 2542, 2331, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 2048, 4887, 1976, 4507, 1583, 338, 2078, 2372, 2102, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 2439, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 375, 2343, 2348, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 1387, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 938, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 401, 402, 2475, 403, 404, 4758, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 413, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 2382, 3675, 1833, 3974, 419, 964, 421, 965, 966, 967, 4919, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 2109, 2380, 427, 1708, 4676, 428, 4141, 429, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 2188, 437, 438, 2055, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 2474, 442, 4900, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 453, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 4874, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 466, 2328, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2386, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4846, 4650, 4595, 2195, 4681, 2142, 487, 4710, 1775, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 4795, 2480, 2017, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 4752, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 4699, 4608, 4781, 499, 2049, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 2110, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 2067, 1031, 2228, 518, 4698, 4616, 2057, 2305, 2133, 2061, 4526, 4617, 1032, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 4693, 4604, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1042, 3683, 2100, 4853, 2300, 2165, 540, 2105, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 4240, 3580, 4680, 1046, 548, 2062, 549, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 4514, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 2436, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1071, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2185, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 1086, 601, 4017, 4477, 1794, 2483, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 2320, 2069, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 4855, 4847, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 2015, 4818, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4908, 4996, 4779, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4850, 1103, 4757, 4747, 1614, 1947, 2237, 630, 631, 4997, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4577, 4633, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 4629, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4603, 4762, 4819, 2221, 4636, 4992, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 1117, 4780, 4800, 2477, 4724, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 4714, 4979, 4812, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 2456, 4606, 4588, 4963, 4851, 4558, 4557, 4697, 4610, 4773, 4687, 4708, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 677, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 2141, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4690, 4859, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4732, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 718, 1155, 719, 720, 2063, 1311, 721, 4642, 722, 4833, 4903, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 2248, 730, 731, 2024, 1846, 2507, 2368, 1162, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 4927, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4628, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 4571, 1166, 4968, 2250, 4912, 2423, 737, 1167, 4989, 4684, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

36. The VP capsid polypeptide of claim 33, wherein the 581 to 589 region of the VP capsid polypeptide has a sequence of any one of SEQ ID NOs: 2498, 4884, 738, 739, 4177, 1289, 740, 14, 15, 741, 742, 743, 16, 744, 17, 18, 745, 3477, 1548, 3051, 2982, 2171, 2877, 746, 19, 20, 3036, 3426, 3073, 3169, 747, 2406, 3362, 2784, 4889, 21, 3192, 4942, 22, 23, 1638, 748, 24, 25, 749, 26, 27, 1703, 1836, 28, 2038, 2301, 3660, 29, 750, 30, 31, 32, 2095, 1640, 33, 35, 36, 37, 4742, 2450, 38, 4925, 39, 751, 752, 1653, 1205, 3795, 753, 4288, 4219, 2770, 2962, 4241, 4107, 2718, 3317, 4391, 4053, 3263, 2553, 3947, 2710, 2608, 3467, 2796, 2961, 2529, 3320, 2674, 2635, 3446, 3053, 3250, 3688, 1182, 1998, 4320, 3351, 2655, 3514, 2779, 3194, 3319, 3224, 3281, 3708, 2807, 3562, 3274, 3374, 3013, 3416, 2981, 3065, 2777, 3469, 2977, 2638, 2972, 3059, 2574, 3380, 4262, 3167, 3368, 2781, 3547, 3386, 1225, 2960, 3485, 3370, 3443, 2824, 754, 1467, 3327, 3178, 3006, 3252, 2991, 3470, 2888, 2572, 3418, 2642, 2519, 3363, 40, 2633, 41, 42, 43, 755, 2511, 44, 45, 756, 46, 757, 47, 48, 1952, 758, 2341, 2410, 49, 3122, 2551, 3718, 4806, 2216, 3484, 3577, 759, 2080, 50, 1308, 1230, 3960, 1378, 2994, 3080, 2589, 3681, 51, 4694, 2257, 52, 760, 53, 2389, 4934, 4951, 761, 762, 4659, 54, 2146, 3925, 55, 3654, 2087, 2346, 4766, 4682, 4984, 4744, 56, 763, 764, 4626, 4702, 58, 59, 60, 61, 4086, 1740, 1660, 765, 766, 62, 1966, 2032, 2499, 2332, 767, 63, 2096, 2181, 4913, 64, 768, 769, 770, 2384, 2402, 771, 65, 66, 2111, 67, 772, 2458, 2197, 68, 3816, 69, 2599, 2706, 2497, 70, 2234, 2183, 2399, 71, 4769, 2366, 72, 73, 74, 3865, 1549, 1361, 2453, 3882, 773, 3713, 1942, 75, 1312, 4501, 76, 77, 774, 1413, 775, 776, 78, 1560, 4289, 3757, 79, 3593, 4043, 1806, 3908, 4397, 1615, 4415, 3723, 2006, 3754, 1470, 4360, 80, 3945, 2854, 3523, 3669, 1356, 777, 2132, 2379, 82, 4065, 83, 84, 2030, 1294, 2413, 2064, 1484, 85, 4594, 86, 778, 87, 3891, 4456, 4040, 4496, 1982, 2001, 1478, 1189, 88, 1490, 1885, 1926, 89, 90, 91, 779, 2270, 780, 2161, 1180, 92, 781, 782, 783, 93, 2356, 784, 785, 786, 94, 95, 787, 788, 1831, 1867, 96, 4458, 97, 1970, 4656, 2173, 1936, 2349, 1590, 4585, 98, 99, 100, 789, 790, 1298, 101, 1688, 791, 792, 2007, 2070, 102, 793, 4632, 103, 794, 795, 104, 105, 106, 2229, 796, 4980, 4691, 107, 2440, 1849, 108, 2014, 797, 4736, 2509, 2018, 2227, 4787, 109, 1579, 110, 1906, 111, 2428, 798, 112, 2411, 113, 2359, 799, 4848, 800, 2461, 1444, 2313, 2350, 4579, 4821, 801, 114, 2329, 4834, 115, 1344, 116, 802, 117, 118, 119, 4929, 4677, 120, 2158, 121, 803, 804, 1463, 805, 122, 2139, 2290, 1760, 2465, 2424, 2058, 2230, 124, 4717, 806, 125, 126, 2370, 127, 4521, 128, 4971, 4994, 807, 2085, 129, 130, 131, 132, 4933, 808, 2336, 2026, 2204, 809, 810, 2281, 133, 1978, 134, 811, 812, 135, 136, 137, 138, 813, 814, 139, 4673, 140, 815, 1326, 141, 142, 143, 2344, 4544, 144, 145, 816, 4654, 4816, 1634, 1302, 817, 146, 818, 147, 148, 149, 4546, 150, 151, 152, 153, 154, 155, 819, 820, 156, 2149, 157, 2295, 821, 158, 159, 160, 161, 4631, 2441, 162, 163, 164, 165, 166, 822, 167, 168, 169, 170, 171, 823, 172, 4613, 824, 1651, 173, 1483, 174, 175, 825, 176, 177, 178, 179, 4624, 2170, 4809, 4520, 180, 826, 827, 181, 828, 4695, 4911, 182, 4582, 4873, 4596, 2020, 183, 4641, 829, 184, 185, 2244, 4647, 186, 187, 188, 189, 190, 2114, 830, 191, 192, 193, 194, 2071, 4615, 2361, 195, 4852, 2187, 4914, 4947, 196, 1391, 197, 4534, 4726, 4788, 198, 199, 4920, 831, 2240, 2223, 200, 201, 202, 203, 2106, 2503, 4775, 204, 205, 832, 833, 206, 834, 2232, 2294, 207, 2166, 208, 209, 210, 835, 836, 1334, 837, 3901, 3312, 2649, 1301, 211, 212, 1450, 4386, 3028, 213, 1446, 214, 2206, 215, 1896, 1522, 3490, 838, 216, 2241, 217, 218, 4653, 219, 1612, 220, 221, 222, 839, 223, 4953, 2360, 840, 224, 4928, 4741, 225, 2088, 4751, 5007, 4542, 226, 227, 4890, 4519, 4883, 228, 4786, 229, 230, 231, 2393, 2448, 841, 842, 232, 233, 4782, 234, 4962, 2269, 843, 235, 844, 236, 237, 4930, 845, 846, 238, 847, 4704, 239, 848, 849, 2150, 850, 851, 852, 853, 1536, 240, 854, 241, 242, 243, 244, 245, 246, 247, 248, 4923, 2245, 4696, 855, 4634, 856, 249, 250, 251, 252, 253, 254, 255, 857, 2115, 4880, 256, 257, 258, 259, 858, 859, 260, 261, 860, 861, 862, 262, 4966, 863, 864, 263, 4749, 4970, 2296, 2318, 865, 2326, 264, 1241, 265, 266, 866, 1477, 267, 867, 4977, 268, 868, 269, 4668, 5002, 270, 869, 870, 271, 871, 872, 272, 4822, 4709, 873, 4655, 4972, 2392, 874, 1252, 273, 1591, 4975, 875, 274, 2025, 275, 1980, 276, 876, 877, 2066, 277, 278, 279, 4670, 280, 2323, 2288, 2334, 4689, 281, 878, 1892, 879, 1539, 2214, 2215, 880, 2327, 881, 882, 4601, 883, 1295, 3601, 3877, 1930, 1420, 1678, 1460, 2306, 884, 282, 1799, 283, 284, 4988, 4553, 4772, 4817, 2260, 285, 1626, 2082, 885, 286, 1374, 886, 2119, 2468, 287, 1620, 1290, 2425, 2482, 4671, 2282, 288, 2354, 1354, 2033, 289, 887, 290, 888, 291, 1956, 2467, 889, 2357, 4547, 4765, 292, 4794, 2391, 4324, 890, 294, 295, 4138, 891, 2297, 296, 2224, 3903, 297, 892, 3829, 298, 299, 3809, 4271, 3844, 1436, 300, 1515, 1617, 4701, 2174, 301, 1961, 4649, 5010, 302, 303, 304, 305, 2452, 2147, 306, 2293, 1589, 893, 4370, 4841, 2342, 307, 308, 309, 894, 2246, 2155, 3646, 4059, 1431, 1331, 310, 311, 4836, 4948, 312, 895, 1779, 313, 314, 315, 316, 896, 1558, 1552, 317, 2312, 318, 319, 897, 320, 898, 321, 322, 899, 1958, 2022, 2016, 900, 2454, 323, 2427, 2134, 324, 901, 325, 902, 326, 2373, 4803, 2459, 1491, 327, 328, 903, 2463, 2264, 329, 330, 904, 1635, 4820, 905, 2506, 331, 4706, 2092, 4484, 1756, 906, 907, 4661, 2179, 4584, 332, 4907, 4635, 4529, 4683, 4523, 4561, 333, 2337, 3536, 2701, 2799, 3332, 3294, 3159, 3069, 2637, 3025, 2782, 3247, 3350, 2692, 2586, 3004, 3049, 2694, 2650, 3554, 2983, 3403, 3214, 3163, 2541, 3090, 3097, 3462, 1430, 2941, 3486, 2842, 3558, 3104, 3037, 3419, 2780, 2931, 1276, 2928, 2609, 3068, 3128, 2548, 2538, 2618, 2789, 3228, 2657, 3189, 2128, 2863, 3307, 3300, 2546, 3048, 3543, 2946, 2975, 3346, 3067, 2728, 2955, 3408, 3027, 3094, 3203, 2988, 2751, 2953, 2566, 2578, 2823, 3063, 3335, 3000, 3181, 3011, 3138, 3389, 2805, 3074, 2894, 3149, 2560, 3417, 3265, 3378, 2901, 2837, 2822, 2745, 3473, 3530, 3040, 2597, 3509, 3522, 3161, 2926, 3209, 3105, 3400, 2630, 2905, 2671, 2818, 2806, 2702, 2709, 2400, 3549, 3538, 2534, 2773, 2623, 3491, 3243, 3136, 2693, 3164, 3343, 2918, 2555, 2794, 2679, 3510, 3110, 2672, 3442, 2929, 3184, 3488, 2135, 4763, 3414, 3093, 2996, 3141, 3544, 3102, 2856, 2957, 3466, 3461, 2788, 2660, 3344, 3204, 2720, 3379, 2826, 1789, 2396, 2785, 3249, 3527, 4460, 3352, 2051, 2569, 4457, 2011, 4857, 2163, 4783, 4319, 3906, 1533, 1755, 1888, 4248, 1557, 2153, 3804, 1363, 1934, 1602, 1404, 4188, 1330, 4349, 3337, 3533, 2629, 3038, 2539, 3567, 3291, 3348, 3115, 3359, 2993, 3079, 3506, 2527, 2963, 2938, 2516, 3113, 1345, 2639, 3143, 3044, 2747, 3154, 3280, 3039, 2743, 2902, 3056, 2554, 2522, 3103, 3210, 3434, 2656, 4251, 4166, 4196, 3206, 3328, 2588, 3553, 2714, 3078, 3222, 3137, 3357, 2717, 2944, 3012, 3220, 3202, 2811, 3083, 3269, 3566, 2699, 2515, 3023, 2533, 3288, 3075, 3005, 2685, 3058, 2976, 2622, 3333, 3463, 2939, 3521, 3268, 3117, 2626, 2616, 3240, 2570, 3565, 2919, 3157, 2849, 3444, 2631, 3420, 2659, 3325, 3186, 2920, 3258, 3440, 3457, 3310, 2761, 3134, 2621, 3531, 2711, 2774, 2867, 2585, 3155, 2620, 3156, 2844, 3126, 3160, 2909, 3542, 3225, 2887, 3474, 3218, 2744, 2896, 3135, 3424, 3498, 3529, 2661, 2667, 2549, 2819, 2768, 2935, 3182, 2772, 3230, 3043, 2922, 3581, 3524, 2869, 2610, 3298, 2775, 3108, 2603, 3614, 2612, 2860, 3187, 3238, 3786, 4385, 3016, 3436, 2876, 2987, 3532, 3438, 3561, 3259, 2663, 2890, 3433, 3071, 3018, 2580, 2755, 3015, 2540, 3398, 2664, 2583, 2830, 2644, 2641, 3513, 2725, 2723, 3338, 3556, 2866, 2514, 2932, 2753, 2862, 2899, 2605, 2989, 3096, 3124, 2985, 2716, 3145, 3017, 2591, 2640, 3033, 1853, 3216, 3316, 3412, 2971, 3256, 3153, 3575, 3339, 2915, 2531, 3552, 3475, 3060, 3375, 2756, 3382, 2847, 2859, 3251, 3702, 3423, 2537, 2801, 3076, 2696, 3092, 3459, 3144, 3441, 2802, 3479, 2907, 3512, 3518, 3021, 2871, 3032, 2647, 2945, 3045, 2763, 3313, 3034, 3315, 3541, 2746, 2669, 2524, 3003, 2732, 3166, 3046, 3306, 2873, 3364, 3253, 3215, 3061, 2804, 2722, 2964, 2990, 2836, 4098, 4449, 3173, 2762, 3737, 2628, 3507, 2564, 3031, 2872, 3360, 2658, 2930, 2904, 3244, 3217, 3311, 3445, 2840, 3372, 2958, 3098, 3356, 3456, 3388, 2624, 3207, 2576, 2742, 2665, 2815, 3052, 3421, 2593, 3242, 2535, 2966, 2898, 2858, 2943, 2668, 2798, 3196, 2528, 2713, 3001, 2691, 2948, 2767, 2544, 3302, 2734, 2893, 2592, 2861, 3502, 2969, 2582, 3229, 2676, 2545, 3255, 3330, 2547, 3257, 2882, 3151, 3088, 2883, 3318, 2645, 2733, 2587, 3500, 3008, 2715, 2845, 3183, 2654, 3233, 3267, 2741, 2827, 2704, 3091, 2832, 2736, 3177, 3271, 2835, 2908, 3176, 2947, 3292, 3191, 2517, 3026, 3082, 3392, 3381, 2584, 2712, 3213, 3451, 2634, 3150, 2810, 3303, 2573, 3460, 2615, 3394, 2828, 3329, 4377, 4499, 3555, 2974, 3782, 3629, 3578, 3885, 2817, 3248, 2954, 3334, 3571, 3345, 3551, 3384, 3422, 1357, 1844, 2530, 2973, 4418, 4081, 3951, 1764, 1671, 1852, 334, 1843, 3449, 3185, 3399, 2786, 3055, 3472, 3397, 2601, 3564, 3277, 4373, 3548, 3179, 3407, 3841, 3347, 3142, 4255, 4431, 3241, 3077, 2700, 3147, 2648, 3283, 2829, 3278, 2581, 2536, 4363, 2848, 3410, 2797, 2523, 2520, 2721, 3496, 2571, 3198, 3219, 3030, 2673, 2921, 3837, 3301, 3322, 2705, 3239, 2949, 3369, 3396, 2892, 2897, 2766, 3174, 3297, 2550, 2889, 2933, 2793, 2627, 2677, 3119, 2596, 3226, 3172, 3089, 2868, 2839, 3942, 3120, 3286, 2843, 3465, 1564, 3946, 4222, 1504, 3999, 2682, 1875, 2865, 3539, 3168, 2864, 3308, 3557, 2940, 3109, 3503, 2625, 3455, 3114, 2595, 3331, 2978, 2518, 2521, 4079, 3024, 3573, 2952, 2653, 1769, 3180, 2813, 2652, 2600, 2816, 3201, 3188, 3270, 2997, 2992, 3009, 3520, 2936, 3275, 3165, 3447, 3131, 3305, 2809, 2792, 2729, 2814, 2619, 3266, 2825, 3066, 2857, 2998, 3064, 2681, 3035, 3279, 2764, 3480, 3127, 2912, 3010, 2607, 3211, 3111, 3041, 1573, 3909, 4269, 3487, 3489, 3019, 335, 1266, 1415, 2980, 3428, 2444, 3435, 3482, 3020, 2748, 2646, 2787, 2760, 2563, 3085, 3133, 3158, 3170, 2703, 3494, 2556, 2552, 3395, 3245, 3404, 2675, 2791, 2252, 4845, 1911, 4856, 908, 1935, 4711, 4728, 2460, 4517, 2749, 3341, 3355, 2575, 2942, 2886, 2758, 2594, 3495, 2884, 3516, 3042, 2737, 2923, 3563, 2855, 3476, 2611, 2937, 3383, 3497, 3402, 3162, 2662, 2875, 3223, 2878, 2079, 1808, 3285, 2757, 3057, 2951, 3519, 2579, 2853, 3387, 3401, 3493, 3393, 1608, 3365, 2885, 3574, 3081, 3007, 3568, 3152, 3367, 3358, 336, 2268, 3468, 3290, 3550, 3132, 2726, 2879, 3190, 3309, 2613, 2765, 3106, 1355, 3454, 2851, 2881, 3232, 3458, 3326, 3353, 2927, 3212, 2950, 3376, 3208, 3062, 3612, 3195, 3385, 2686, 2602, 3569, 3123, 2727, 1622, 2821, 2636, 2750, 2850, 3050, 2925, 3336, 3540, 2689, 3139, 2526, 3361, 3022, 3427, 3107, 3140, 3371, 3276, 2831, 3501, 2924, 3366, 3199, 3101, 3321, 3499, 2917, 2683, 2800, 2812, 3340, 3227, 3148, 3657, 4446, 1746, 1464, 1886, 2666, 3246, 3130, 3560, 3236, 2730, 3572, 1607, 3689, 2968, 1457, 1500, 909, 337, 1184, 3450, 2577, 2567, 2532, 3415, 2934, 2984, 2568, 4147, 3002, 2986, 910, 2979, 2542, 2492, 1762, 4472, 1472, 1529, 2319, 2131, 4057, 2048, 1976, 4507, 1583, 338, 2078, 2372, 339, 911, 1711, 340, 912, 2013, 913, 2277, 914, 341, 915, 4672, 4902, 916, 342, 1594, 4440, 917, 343, 344, 4559, 918, 2233, 919, 345, 920, 346, 921, 922, 347, 2226, 348, 2180, 2298, 349, 350, 2099, 2036, 351, 4808, 923, 924, 4498, 1518, 3728, 3637, 3570, 3429, 4091, 2870, 2995, 4338, 3205, 2880, 3261, 1994, 3968, 4291, 4204, 4071, 4034, 1742, 2820, 3912, 3287, 1218, 1190, 4145, 353, 2422, 354, 355, 925, 1782, 2184, 2261, 2490, 926, 927, 928, 4630, 2137, 3610, 356, 357, 4729, 358, 359, 4224, 1918, 1959, 1840, 3736, 2471, 1770, 929, 930, 931, 4155, 360, 361, 362, 932, 363, 364, 1279, 2289, 365, 1543, 366, 2156, 2472, 367, 4049, 1633, 1722, 368, 369, 1495, 1566, 370, 4967, 372, 373, 1211, 1873, 2101, 2494, 1726, 374, 1442, 933, 1748, 4142, 1434, 1358, 1191, 3732, 4110, 4039, 4411, 4506, 4270, 4156, 3780, 4036, 4030, 4016, 1550, 3899, 1247, 1855, 1181, 3919, 1639, 3664, 1244, 4140, 3930, 4117, 4189, 4001, 3799, 3643, 3619, 1240, 1686, 1479, 1307, 1575, 4296, 1665, 3871, 4135, 1605, 4408, 3604, 1274, 4149, 1313, 3741, 1938, 3709, 1727, 3893, 1280, 3622, 1784, 3834, 1752, 1983, 1743, 3979, 4461, 4113, 3817, 4232, 1340, 1489, 4214, 3902, 1857, 2316, 1904, 1219, 1486, 1512, 1481, 1516, 3820, 3789, 4252, 4047, 4330, 4082, 4094, 1574, 1248, 4078, 1872, 1426, 3785, 3687, 4318, 4243, 3866, 3704, 4172, 1621, 4315, 1192, 1513, 1856, 3324, 2769, 2678, 1561, 3296, 375, 2343, 376, 377, 1395, 1584, 4093, 4453, 3940, 3778, 4374, 4210, 4009, 4264, 4339, 4368, 1738, 378, 1610, 4194, 4474, 4013, 4266, 1771, 1759, 1922, 3860, 3832, 1349, 1381, 3663, 1642, 1185, 4356, 3932, 1233, 4212, 3858, 1198, 4192, 3611, 1919, 1819, 3790, 3712, 1969, 4095, 1887, 4468, 1720, 4247, 934, 1790, 2002, 1657, 1663, 1336, 3894, 1554, 1494, 1405, 3576, 4314, 3695, 1851, 1850, 4362, 1815, 3845, 4511, 3656, 3638, 1406, 1596, 4454, 1443, 1661, 935, 4504, 1359, 1734, 3650, 1910, 1305, 1648, 3831, 4435, 1208, 1988, 4451, 1993, 1986, 3849, 1718, 4068, 1835, 1425, 1428, 1282, 4380, 1658, 1452, 1687, 4024, 379, 4072, 3791, 4491, 4323, 4014, 1304, 1440, 1511, 1981, 1676, 1547, 4422, 1283, 3861, 1383, 3644, 3691, 4259, 1749, 1418, 1176, 4216, 1924, 1421, 3992, 4423, 4253, 1618, 1871, 1256, 3748, 4119, 1297, 1586, 1251, 1299, 1954, 4450, 3990, 4029, 4097, 3890, 3796, 1389, 3711, 4344, 1578, 1476, 4343, 1202, 4413, 4384, 3808, 1647, 1475, 3892, 3674, 1739, 3926, 3595, 1943, 3756, 4405, 3973, 4109, 4159, 3744, 4387, 1960, 4275, 3781, 1535, 1210, 4492, 4365, 4118, 3655, 3886, 4278, 4383, 4485, 1392, 3751, 3931, 3986, 3678, 1249, 4353, 4208, 3710, 4238, 4213, 3969, 4436, 3175, 4128, 2970, 1228, 3534, 3437, 3406, 3641, 3639, 3954, 4335, 3995, 3582, 4475, 3784, 4470, 4010, 3802, 3941, 4427, 4396, 4348, 3587, 3818, 3864, 3956, 3863, 3731, 3814, 4067, 4354, 4350, 4334, 3821, 1932, 3929, 4171, 1258, 3824, 3631, 4465, 4494, 1320, 1398, 3828, 1204, 1223, 1284, 1685, 3773, 4209, 3014, 4462, 4246, 4190, 4312, 4023, 3760, 3753, 1178, 3884, 2783, 4038, 3545, 2916, 3112, 2834, 3880, 3673, 4102, 4399, 4048, 3752, 4207, 1235, 3943, 4355, 4087, 4100, 4327, 4037, 4163, 3918, 4486, 1243, 3933, 4178, 1662, 1643, 4152, 3634, 3617, 4445, 4303, 1370, 3838, 4199, 4284, 1213, 4382, 1399, 1187, 3714, 1828, 4487, 3615, 1842, 1501, 3746, 4018, 4420, 3606, 4121, 3724, 3935, 4419, 4282, 1955, 1949, 4310, 4488, 1577, 4127, 1288, 1171, 3670, 4052, 3627, 3777, 936, 1371, 3685, 1325, 1940, 380, 4482, 4258, 3812, 1581, 1860, 4124, 4508, 4500, 3652, 3972, 1309, 1630, 1528, 3717, 1217, 3692, 4430, 3764, 4316, 4285, 3645, 3971, 4421, 1172, 4026, 2740, 3125, 3546, 1725, 1206, 3842, 4404, 3690, 3962, 4513, 4340, 4329, 4410, 3703, 4136, 1763, 1487, 3589, 3907, 4153, 2707, 3730, 4426, 4180, 4041, 3923, 4444, 3851, 4429, 4361, 1441, 4394, 4302, 3758, 4510, 3742, 1868, 4077, 1710, 1939, 1335, 1666, 1407, 4187, 1193, 1188, 1196, 1724, 1717, 1200, 1646, 1997, 1975, 1701, 4280, 1613, 4006, 1984, 1351, 3653, 3833, 1593, 2561, 4442, 3900, 4298, 1761, 4388, 1820, 1597, 4317, 4249, 1341, 1203, 1680, 4441, 3628, 3725, 1945, 937, 4206, 1588, 1439, 3794, 4447, 1838, 3776, 3658, 4064, 1377, 4011, 4272, 4503, 1324, 1367, 3594, 3680, 1300, 1750, 3913, 3774, 1877, 1987, 1862, 3998, 1380, 4185, 3686, 3696, 4463, 1350, 4008, 4230, 3853, 4244, 4083, 381, 1909, 3897, 1546, 382, 3613, 3273, 3452, 3525, 1229, 4105, 3835, 383, 1263, 1234, 3970, 1492, 3856, 3586, 1175, 4321, 4020, 4144, 1224, 1199, 3667, 2778, 4412, 4407, 1812, 1810, 3823, 1416, 1427, 1507, 1878, 4333, 3146, 4281, 4211, 1179, 3843, 1669, 1677, 1524, 1525, 1974, 384, 1979, 1456, 1239, 4167, 3740, 1876, 1388, 1967, 1474, 385, 1342, 1471, 4176, 1232, 1989, 4125, 1741, 1508, 1580, 4060, 4378, 1576, 1212, 1893, 3921, 3585, 1174, 1396, 4061, 4015, 1207, 3698, 3825, 3922, 4021, 4181, 1598, 1916, 1429, 4502, 4231, 1321, 4390, 3693, 3734, 1382, 3684, 1747, 3806, 3896, 3635, 1768, 4025, 3976, 3840, 3963, 4286, 1502, 3836, 4161, 3659, 3743, 4130, 3605, 1385, 1783, 4392, 4328, 1316, 4173, 4265, 1246, 1985, 1629, 1829, 1737, 3826, 1473, 1992, 1883, 1656, 1837, 1914, 1839, 1834, 3984, 4495, 3910, 4160, 3671, 4184, 4132, 4250, 1503, 1237, 1523, 1417, 4063, 1562, 3977, 1971, 1707, 1847, 1792, 3769, 4074, 1534, 4239, 4003, 3915, 1689, 1776, 1599, 1265, 1410, 1823, 1498, 1329, 939, 386, 940, 1655, 3874, 4261, 3626, 1791, 3579, 1644, 3936, 4054, 4260, 4359, 4131, 4297, 4357, 4022, 3770, 4046, 1222, 1996, 3788, 4169, 1925, 3953, 4228, 4226, 4277, 4101, 1889, 1369, 3797, 4088, 4019, 3771, 3632, 1402, 388, 1520, 1767, 1466, 1194, 4137, 1908, 1927, 1758, 3772, 3661, 4186, 4174, 1170, 3850, 1315, 1611, 1530, 1859, 2209, 4183, 1408, 1403, 941, 4033, 3623, 3596, 1461, 1848, 1173, 1928, 1459, 1765, 1826, 3719, 1931, 3584, 4004, 3591, 3967, 4168, 3957, 3878, 4165, 4191, 3980, 4058, 4200, 4336, 3958, 1260, 4051, 3798, 4032, 1774, 4322, 3991, 4106, 1641, 1570, 3978, 3965, 4464, 3813, 4154, 1365, 4257, 3846, 4345, 4379, 3603, 1693, 3937, 3801, 1787, 1214, 4483, 4201, 1898, 1845, 1226, 1220, 4245, 1347, 3867, 1900, 3640, 3916, 4089, 1209, 3745, 3988, 3975, 4236, 4075, 4146, 4256, 4308, 4000, 4148, 3588, 3868, 4403, 3883, 4326, 4393, 3895, 4237, 3955, 3727, 4005, 4092, 4372, 4283, 1553, 3805, 4151, 1281, 1681, 4489, 3982, 4437, 3597, 4342, 3872, 3987, 4490, 3876, 3668, 4300, 1679, 1242, 3598, 3583, 3647, 389, 4304, 3793, 3779, 1937, 1907, 4042, 3648, 3996, 3800, 4367, 4099, 1807, 3887, 4428, 1625, 1390, 1884, 1682, 4364, 4306, 3869, 1278, 1672, 942, 1505, 1542, 1709, 1915, 3600, 3914, 1968, 3948, 1670, 3811, 1865, 1362, 943, 1716, 3961, 1506, 4221, 1376, 944, 1683, 4276, 1445, 1721, 1632, 3607, 1328, 1455, 1913, 1497, 1317, 1951, 1778, 1379, 3768, 4225, 1668, 2383, 945, 390, 391, 4406, 4341, 1480, 392, 393, 394, 395, 1714, 1422, 396, 2043, 946, 2265, 397, 3618, 4433, 1177, 3898, 398, 2251, 947, 948, 2212, 949, 950, 399, 951, 400, 1965, 4640, 2129, 2345, 4471, 952, 953, 402, 2475, 403, 404, 4758, 955, 2437, 4139, 1482, 3602, 4434, 3721, 1592, 1825, 1698, 1519, 1352, 4202, 4409, 1977, 1917, 405, 406, 407, 408, 956, 2272, 957, 2267, 1631, 1684, 409, 2054, 3889, 958, 410, 2117, 411, 959, 412, 960, 2443, 4712, 4619, 2285, 414, 415, 961, 2352, 2417, 962, 1905, 416, 963, 417, 418, 3675, 1833, 3974, 419, 964, 421, 965, 966, 967, 968, 2365, 969, 970, 422, 1897, 2056, 2309, 4733, 1272, 4754, 2207, 971, 423, 4133, 3830, 4865, 972, 424, 973, 425, 2068, 4955, 426, 974, 427, 1708, 4676, 428, 4141, 430, 3749, 431, 1619, 975, 4044, 3590, 1944, 4126, 1923, 1706, 432, 976, 977, 978, 4867, 4400, 433, 434, 1606, 2143, 979, 435, 980, 2604, 2895, 981, 436, 3448, 4959, 2188, 437, 438, 1692, 982, 2388, 2433, 2243, 983, 2035, 2120, 4940, 439, 440, 2474, 442, 2052, 4764, 3862, 4055, 4358, 984, 2435, 4589, 2276, 2401, 985, 1664, 443, 2073, 2405, 986, 4309, 4045, 3854, 3682, 2491, 444, 445, 1972, 2688, 4366, 3425, 3231, 3649, 2759, 2724, 3873, 3755, 1216, 3599, 3775, 2754, 2606, 3471, 3234, 2565, 2803, 2562, 2684, 3411, 3405, 2690, 1255, 3694, 446, 3985, 3535, 1306, 4084, 3282, 447, 1353, 2168, 1780, 987, 988, 989, 2126, 448, 449, 2107, 450, 2031, 990, 451, 452, 991, 1485, 453, 992, 1728, 993, 4703, 994, 995, 454, 1696, 996, 2039, 455, 997, 998, 3116, 1869, 456, 4759, 2500, 4798, 2262, 4562, 457, 1386, 999, 458, 4768, 4982, 4778, 2040, 1000, 4981, 3879, 2698, 459, 460, 1001, 461, 1447, 462, 1002, 2042, 2339, 1003, 463, 464, 4425, 1645, 465, 1004, 467, 468, 469, 1231, 1468, 470, 471, 2496, 472, 473, 1005, 474, 475, 2108, 4725, 476, 1273, 1007, 1744, 1488, 1659, 477, 478, 4598, 1604, 4753, 2493, 479, 1008, 1009, 480, 1011, 1012, 1013, 1014, 481, 4313, 482, 483, 1499, 484, 1015, 4761, 2091, 2513, 1016, 4073, 1777, 2172, 485, 2205, 4592, 4545, 486, 1458, 4274, 2122, 4905, 5003, 4599, 4796, 2152, 4539, 4528, 4904, 4842, 4986, 4846, 4650, 4595, 2195, 4681, 2142, 487, 4710, 1775, 4205, 1526, 4586, 4602, 4518, 1697, 1017, 2000, 4692, 4795, 2480, 488, 2335, 489, 4969, 1894, 1882, 1817, 1880, 490, 1018, 3917, 3616, 4311, 1800, 4473, 4085, 4401, 1310, 3783, 3765, 1538, 3870, 491, 1948, 3699, 1735, 3792, 4290, 2074, 492, 2202, 5001, 2136, 493, 2211, 4532, 494, 2421, 495, 4090, 2378, 2104, 2210, 2247, 2478, 2047, 496, 4620, 4978, 4614, 1019, 2012, 1803, 3642, 497, 1322, 1020, 498, 1021, 2235, 2302, 2488, 4665, 4540, 5006, 499, 2049, 4685, 500, 501, 1022, 502, 1333, 503, 1023, 4686, 4804, 504, 4727, 505, 506, 4938, 4805, 2065, 1890, 4891, 1024, 507, 508, 509, 1025, 510, 1026, 3608, 1732, 511, 2397, 1864, 1816, 1531, 512, 513, 2451, 3636, 5012, 4892, 514, 1699, 4593, 1027, 4987, 515, 2495, 4660, 1028, 516, 1029, 2409, 1366, 2112, 2178, 2124, 2376, 5011, 4572, 4957, 4789, 4543, 4664, 4678, 2093, 4746, 2489, 4922, 2145, 1030, 4832, 4950, 1261, 4027, 3478, 3763, 2959, 1293, 2462, 517, 3197, 1595, 3413, 2238, 1031, 2228, 518, 2057, 2305, 2133, 2061, 4526, 4617, 1033, 2429, 2311, 1675, 4785, 1797, 519, 4578, 2271, 2466, 2148, 2420, 520, 4854, 2381, 2315, 2284, 4813, 521, 1034, 522, 523, 1999, 3759, 1215, 4122, 1730, 524, 525, 526, 3966, 4573, 5008, 1035, 527, 4973, 2508, 528, 3911, 529, 3289, 1821, 530, 531, 2426, 1036, 532, 1874, 533, 534, 1037, 535, 1038, 536, 1039, 537, 538, 539, 1040, 3767, 1929, 1042, 3683, 2100, 4853, 2300, 2165, 540, 541, 1043, 4906, 542, 1338, 2292, 2021, 1616, 1901, 1796, 1517, 4331, 4332, 4466, 2719, 3803, 4123, 4233, 1824, 3129, 3087, 3505, 4158, 4254, 1449, 1044, 3720, 4351, 4414, 1673, 3453, 3254, 2501, 1649, 543, 544, 545, 546, 1045, 547, 4240, 3580, 4680, 1046, 548, 2062, 1047, 550, 2598, 551, 552, 553, 3819, 1259, 4062, 1048, 554, 2841, 1049, 1050, 3515, 2219, 1433, 1323, 4301, 555, 556, 1051, 557, 558, 1052, 1053, 3738, 1567, 559, 1054, 1270, 3857, 1055, 2151, 560, 2175, 2089, 1056, 2198, 2193, 1257, 1238, 3662, 561, 2186, 1057, 4637, 562, 1058, 563, 4872, 2097, 564, 1059, 565, 566, 1060, 1061, 2231, 4203, 1899, 3981, 1062, 1303, 4116, 567, 1063, 568, 569, 570, 2367, 1946, 3620, 1064, 1514, 4002, 3679, 3964, 3707, 3666, 1348, 4273, 1804, 4497, 571, 1401, 4438, 1895, 1264, 572, 1912, 573, 3939, 4170, 4056, 1271, 1065, 1521, 1221, 1066, 1451, 1654, 1067, 3934, 4080, 4352, 574, 1700, 3739, 1565, 1419, 1811, 3950, 1690, 1397, 3716, 1569, 1465, 1437, 1674, 4337, 1285, 4268, 1183, 3726, 3881, 4134, 4347, 4012, 3938, 4066, 4198, 4416, 4164, 3630, 4229, 4292, 4193, 4325, 4375, 4371, 4432, 4215, 1753, 3944, 1409, 4195, 1729, 4223, 1540, 4455, 1068, 1069, 4512, 1723, 1070, 3750, 3633, 4070, 4104, 4162, 4235, 1863, 4346, 1881, 1814, 1572, 2418, 575, 4443, 3761, 1346, 1587, 1072, 3592, 576, 1891, 4469, 2430, 1275, 577, 1950, 1963, 4129, 1073, 1296, 1360, 1551, 3733, 4111, 3993, 4108, 3949, 1287, 1713, 1556, 1736, 1995, 1435, 1424, 1830, 1705, 1861, 1197, 1254, 4120, 1545, 4417, 1469, 1292, 2279, 1785, 1236, 4293, 1827, 3839, 3983, 4395, 1957, 2222, 578, 3928, 4295, 3715, 3855, 3609, 1990, 4076, 4175, 3927, 1757, 1650, 4299, 1773, 2004, 1267, 1364, 579, 1462, 1879, 4007, 3729, 3665, 3722, 1691, 1712, 1074, 1624, 1751, 1394, 3924, 3952, 580, 581, 2003, 1343, 2203, 1559, 1250, 1555, 582, 2395, 4114, 1818, 1075, 583, 1076, 1077, 1704, 4448, 584, 4882, 1078, 1079, 1786, 585, 3354, 1832, 586, 3432, 2891, 587, 588, 4583, 2505, 1903, 2077, 4936, 4658, 4830, 2446, 1080, 2278, 1081, 1082, 4459, 1083, 589, 1563, 1084, 2255, 2113, 590, 591, 1085, 592, 2308, 593, 594, 2274, 595, 4931, 2407, 1858, 596, 597, 598, 1453, 2559, 2590, 2738, 4478, 4069, 1809, 1327, 4150, 3260, 3481, 3672, 3625, 2008, 4439, 3852, 3997, 1411, 599, 3847, 4993, 1268, 4050, 3377, 4424, 1496, 4143, 4493, 3492, 1962, 1412, 2455, 600, 2457, 1086, 601, 4017, 4477, 1794, 2483, 2291, 602, 4263, 3072, 2009, 2199, 1754, 1087, 1088, 3888, 603, 604, 4777, 2324, 605, 1368, 3827, 4103, 606, 607, 1089, 2220, 4549, 1090, 1571, 1091, 1438, 608, 1092, 609, 610, 611, 1093, 612, 1094, 3701, 4389, 613, 4897, 1603, 614, 1095, 5000, 615, 616, 2263, 1332, 1715, 4369, 1652, 1096, 617, 1541, 618, 1921, 1733, 1373, 1870, 619, 4218, 1798, 2387, 1097, 1098, 1099, 1100, 620, 1702, 621, 622, 4801, 2398, 2239, 1101, 1667, 1384, 623, 4745, 3700, 1788, 1600, 624, 2098, 625, 4550, 4721, 4960, 4878, 2473, 4792, 4675, 1102, 1423, 626, 2771, 627, 1339, 3875, 628, 629, 3070, 4565, 2118, 4818, 2557, 2795, 2906, 2103, 4869, 2029, 3299, 3118, 4932, 4838, 4901, 4657, 4646, 4875, 4627, 4515, 4876, 4965, 4605, 4576, 2028, 4985, 4850, 1103, 4747, 1614, 1947, 2237, 630, 631, 4618, 4479, 3766, 632, 1104, 1105, 4886, 1106, 2432, 633, 1107, 4530, 634, 2371, 4651, 1108, 4536, 635, 1813, 636, 2431, 4866, 4991, 4814, 4560, 4956, 637, 4555, 1109, 4941, 4577, 2213, 638, 639, 3706, 1110, 640, 1111, 641, 4581, 4893, 4831, 2481, 4644, 4734, 2190, 4524, 4881, 4837, 4888, 4648, 642, 4807, 4896, 4868, 2374, 1112, 4823, 2164, 1113, 3735, 3390, 1694, 3431, 2838, 3483, 3464, 3848, 2558, 3314, 3086, 3029, 2956, 3517, 2651, 2914, 2680, 2632, 3121, 3100, 3528, 3526, 3084, 4220, 3304, 2846, 1186, 3235, 2903, 3559, 2687, 3409, 3237, 2900, 2999, 3349, 3171, 2752, 3262, 3504, 3047, 4376, 3193, 3430, 2525, 2670, 2911, 3508, 2776, 2697, 3200, 2790, 3323, 2543, 2874, 2614, 3904, 3373, 3054, 2617, 4242, 3621, 2708, 4179, 4398, 3959, 4935, 1269, 3095, 1286, 3624, 4481, 1432, 3511, 2735, 4381, 3295, 1585, 2390, 1568, 1114, 1766, 3221, 2643, 2739, 643, 4735, 4760, 1115, 4918, 4688, 3920, 644, 4723, 4949, 4748, 4607, 4719, 1116, 645, 646, 4611, 2353, 4645, 4998, 2307, 647, 1801, 4279, 3762, 1637, 1509, 4843, 4797, 4590, 4995, 4541, 2200, 4580, 4858, 648, 649, 2502, 1117, 4780, 4800, 4551, 4674, 1118, 1119, 2965, 2369, 2695, 3293, 650, 651, 4730, 4862, 4722, 4944, 1120, 652, 1121, 4983, 4784, 4877, 4643, 653, 654, 4909, 1122, 3264, 655, 2076, 4849, 656, 657, 2447, 658, 659, 4035, 2910, 3391, 2808, 3099, 2913, 3676, 2852, 3284, 2731, 1609, 2375, 2201, 3537, 3994, 1319, 4467, 1802, 1227, 1623, 660, 4844, 2086, 4770, 2192, 1123, 661, 2364, 662, 663, 664, 1124, 1125, 665, 2487, 4899, 2138, 1126, 666, 667, 4569, 4554, 4917, 2322, 1127, 1128, 1129, 668, 669, 1130, 670, 1131, 1527, 1132, 671, 1772, 2314, 1133, 1134, 2470, 1135, 672, 2236, 4716, 673, 4600, 2196, 2456, 4606, 4910, 2123, 1136, 1137, 2358, 5005, 2208, 4952, 4945, 1933, 1731, 1793, 675, 676, 3342, 1138, 677, 4597, 4870, 1140, 4990, 4954, 4916, 678, 1141, 4737, 4527, 2253, 4531, 679, 1142, 1143, 680, 4771, 1144, 4638, 681, 4705, 4525, 4522, 4898, 2325, 2415, 5004, 1145, 682, 683, 1146, 684, 685, 2445, 686, 687, 4861, 2157, 688, 3822, 689, 690, 4743, 691, 1147, 1601, 692, 1148, 693, 4537, 4825, 4625, 4621, 3905, 694, 695, 1414, 1149, 696, 2027, 2159, 4756, 4793, 4575, 2160, 4828, 4731, 4718, 4802, 4750, 1150, 2081, 2258, 697, 1795, 1372, 1695, 1866, 1151, 4115, 1719, 2280, 4662, 698, 2176, 2194, 2217, 1920, 699, 700, 701, 4999, 1544, 4739, 702, 703, 4031, 4305, 1636, 1393, 2010, 3810, 4452, 3677, 4227, 1277, 1400, 4402, 4157, 4197, 1337, 1253, 1532, 4028, 3989, 2449, 4715, 704, 2050, 1493, 1854, 1902, 1510, 1152, 4824, 705, 2340, 4182, 706, 2442, 2484, 707, 708, 709, 4667, 1153, 2412, 4476, 2053, 710, 1375, 711, 712, 713, 4829, 4738, 4811, 4570, 4961, 1245, 714, 2045, 4707, 715, 2169, 4713, 1841, 4234, 4924, 1154, 1314, 4096, 2023, 716, 717, 4895, 718, 1155, 719, 720, 2063, 1311, 721, 4642, 722, 4885, 4666, 2249, 4217, 1156, 723, 1157, 1627, 2116, 4566, 2287, 1158, 2330, 4826, 4622, 4740, 724, 4700, 725, 1159, 5013, 4894, 726, 2434, 1953, 1160, 1201, 727, 3787, 2046, 1161, 728, 729, 2485, 2044, 4568, 3747, 730, 731, 2024, 1846, 2507, 2368, 2019, 2333, 3815, 2005, 2266, 1964, 2347, 2385, 732, 2177, 2059, 4958, 1822, 4815, 1262, 2094, 4480, 1537, 1291, 2419, 1318, 2283, 4976, 4294, 2486, 4926, 1582, 2162, 733, 4587, 734, 735, 3439, 2833, 4287, 4509, 4505, 4267, 3697, 3272, 4112, 2967, 3651, 1991, 1805, 1628, 3705, 2479, 736, 1195, 4863, 1163, 3859, 1164, 2394, 1165, 2355, 2351, 4679, 4835, 2259, 4839, 4571, 1166, 4968, 2250, 4912, 2423, 737, 1167, 4989, 4684, 4669, 4552, 4612, 2127, 1745, 1973, 4767, 1168, 2273, 2310, 3807, 4307, 1169, 2303, 1454, or 1781.

37. The VP capsid polypeptide of claim 1, wherein X3, X6, and X1 of SEQ ID NO: 5014 are basic amino acid residues.

38. The VP capsid polypeptide of claim 1, wherein X3, X6, and X4 of SEQ ID NO: 5014 are basic amino acid residues.

39. The VP capsid polypeptide of claim 37 or claim 38, wherein X3, X6, X1, and X4 of SEQ ID NO: 5014 are basic amino acid residues.

40. A viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region of the VP capsid polypeptide comprises at least two basic amino acid residues and no more than one acidic amino acid residue.

41. The VP capsid polypeptide of claim 1, wherein the VP capsid polypeptide comprises one or more features selected from the group consisting of: (a) the 581 to 589 region comprises two or more basic amino acid residues,(b) X3, X6, X1, or X4 of SEQ ID NO: 5014, or any combination thereof are basic amino acid residues, and(c) the 581 to 589 region comprises no more than one acidic amino acid residue.

42. The VP capsid polypeptide of claim 41, wherein the VP capsid polypeptide comprises two or more of the features.

43. The VP capsid polypeptide of claim 41, wherein the VP capsid polypeptide comprises three of the features.

44. The VP capsid polypeptide of any one of claims 40-43, wherein the acidic amino acid residue is D or E.

45. The VP capsid polypeptide of any one of claims 37-44, wherein the basic amino acid residues are K, R, or H.

46. A viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013.

47. The VP capsid polypeptide of claim 46, wherein the 581 to 589 region comprises a sequence of any one of SEQ ID NO: 14-SEQ ID NO: 2013.

48. A viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 2514-SEQ ID NO: 4513.

49. The VP capsid polypeptide of claim 48, wherein the 581 to 589 region comprises a sequence of any one of SEQ ID NO: 2514-SEQ ID NO: 4513.

50. The VP capsid polypeptide of any one of claims 1-49, wherein the 581 to 589 region confers increased retina tissue tropism compared to a wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1.

51. The VP capsid polypeptide of claim 50, wherein the retina tissue tropism is at least 1.5-fold, at least 2-fold, at least 2.5-fold, at least 3-fold, at least 3.5-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 75-fold, at least 100-fold, at least 200-fold, or at least 500-fold higher than the wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1.

52. The VP capsid polypeptide of claim 50 or claim 51, wherein the 581 to 589 region further confers increased retinal pigment epithelium tissue tropism compared to a wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1.

53. The VP capsid polypeptide of any one of claims 1-52, wherein the 581 to 589 region confers decreased photoreceptor tissue-tropism compared to a wild type AAV5 VP capsid polypeptide of SEQ ID NO: 1.

54. The VP capsid polypeptide of claim 53, wherein the photoreceptor tissue comprises rod photoreceptor cells, cone photoreceptor cells, or a combination thereof.

55. The VP capsid polypeptide of any one of claims 1-54, wherein the VP capsid polypeptide comprises an amino acid sequence at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 98.5%, at least 99%, or at least 99.5% identical to SEQ ID NO: 1.

56. The VP capsid polypeptide of any one of claims 1-55, wherein the VP capsid polypeptide has a sequence of SEQ ID NO: 2, wherein residues 581 to 589 of SEQ ID NO: 2 (X1X2X3X4X5X6X7X8X9) correspond to the 581 to 589 region.

57. The VP capsid polypeptide of any one of claims 1-56, wherein the VP capsid polypeptide is capable of assembling into a recombinant viral capsid.

58. The VP capsid polypeptide of any one of claims 1-57, comprising at least one amino acid substitution as compared to each of SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, and SEQ ID NO: 8.

59. The VP capsid polypeptide of any one of claims 1-58, wherein the 581 to 589 region comprises a net positive charge at pH 7.4.

60. The VP capsid polypeptide of any one of claims 1-59, wherein the VP capsid polypeptide further comprises one or more mutations outside of the 581 to 589 region relative to a wild type VP capsid polypeptide of SEQ ID NO: 1.

61. The VP capsid polypeptide of any one of claims 1-60, wherein the 581 to 589 region confers on a recombinant viral capsid assembled from the VP capsid polypeptide improved stability compared to a wild type AAV capsid comprising a peptide of SEQ ID NO: 1.

62. The VP capsid polypeptide of any one of claims 1-61, wherein the 581 to 589 region confers lower toxicity upon administration to a subject compared to a wild type VP capsid polypeptide of SEQ ID NO: 1.

63. The VP capsid polypeptide of any one of claims 1-62, wherein the VP capsid polypeptide further comprises one or more mutations outside of the 581 to 589 region that contributes to reduced production of neutralizing antibodies relative to a wild type VP capsid polypeptide of SEQ ID NO: 1.

64. The VP capsid polypeptide of any one of claims 1-63, wherein the VP capsid polypeptide further comprises one or more mutations outside of the 581 to 589 region that improves manufacturability relative to a wild type VP capsid polypeptide of SEQ ID NO: 1.

65. A recombinant viral adeno-associated virus (rAAV) capsid comprising the VP capsid polypeptide of any one of claims 1-64, wherein the rAAV capsid preferentially targets retina tissue.

66. The rAAV capsid of claim 65, further comprising a VP2 polypeptide comprising the 581 to 589 region and a VP3 polypeptide comprising the 581 to 589 region.

67. A recombinant adeno-associated virus (rAAV), comprising the VP capsid polypeptide of any one of claims 1-64 assembled into a recombinant viral capsid and a payload encapsidated by the recombinant viral capsid.

68. The rAAV of claim 67, wherein the rAAV preferentially targets retina tissue.

69. The rAAV of claim 67 or claim 68, further comprising a VP2 polypeptide comprising the 581 to 589 region and a VP3 polypeptide comprising the 581 to 589 region.

70. The rAAV of any one of claims 67-69, wherein the payload encodes a therapeutic polynucleotide or a therapeutic peptide.

71. The rAAV of claim 70, wherein the payload encodes a guide RNA, a tRNA, a suppressor tRNA, a siRNA, a miRNA, an mRNA, a shRNA, a circular RNA, or an antisense oligonucleotide (ASO), a ribozyme, a DNAzyme, an aptamer, or any combination thereof.

72. The rAAV of claim 71, wherein the guide RNA is a CRISPR/Cas guide RNA or an ADAR guide RNA.

73. The rAAV of claim 71, wherein the payload encodes a component of a CRISPR/Cas system, an adenosine deaminase acting on RNA (ADAR) enzyme, a transcriptional activator, or a transcriptional repressor.

74. A pharmaceutical composition comprising the VP capsid polypeptide of any one of claims 1-64, the rAAV capsid of claim 65 or claim 66, or the rAAV of any one of claims 67-73.

75. A method of delivering a payload to a retina tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region comprising at least one substitution relative to SEQ ID NO: 9, and wherein the 581 to 589 region comprises one or more basic amino acid residues.

76. A method of delivering a payload to a retina tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513.

77. A method of delivering a payload to a retina tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises the VP capsid polypeptide of any one of claims 1-64.

78. A method of delivering a payload to a retina tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region comprising at least one substitution relative to SEQ ID NO: 9, and wherein the 581 to 589 region comprises one or more basic amino acid residues; and(ii) delivering the payload to the retina tissue.

79. A method of delivering a payload to a retina tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513; and(ii) delivering the payload to the retina tissue.

80. A method of delivering a payload to a retina tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises the VP capsid polypeptide of any one of claims 1-64; and(ii) delivering the payload to the retina tissue.

81. The method of any one of claims 78-80, comprising administering the rAAV via intravitreal administration.

82. The method of any one of claims 78-80, comprising administering the rAAV via subretinal injection, topical mucosal administration, or systemic administration.

83. The method of any one of claims 75-82, further comprising expressing a therapeutic polypeptide or a therapeutic polynucleotide encoded by the payload.

84. The method of any one of claims 75-83, further comprising producing a therapeutic effect upon expression of the payload.

85. The method of claim 84, wherein the therapeutic effect is produced upon administration of from 1×105 to 5×1014 rAAVs.

86. The method of claim 84 or claim 85, comprising administering an amount of the rAAV sufficient to produce the therapeutic effect without producing a toxicity in the subject.

87. A method of treating a condition in a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region comprising at least one substitution relative to SEQ ID NO: 9, and wherein the 581 to 589 region comprises one or more basic amino acid residues.

88. A method of treating a condition in a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513.

89. A method of treating a condition in a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises the VP capsid polypeptide of any one of claims 1-64.

90. The method of any one of claims 87-89, further comprising expressing the payload in a retina tissue of the subject.

91. The method of any one of claims 87-90, further comprising producing a therapeutic effect in the subject.

92. A method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region comprising at least one substitution relative to SEQ ID NO: 9, and wherein the 581 to 589 region comprises one or more basic amino acid residues; and(ii) expressing the payload in a retina tissue of the subject, thereby treating the condition in the subject.

93. A method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 14-SEQ ID NO: 2013 or SEQ ID NO: 2514-SEQ ID NO: 4513; and(ii) expressing the payload in a retina tissue of the subject, thereby treating the condition in the subject.

94. A method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises the VP capsid polypeptide of any one of claims 1-64; and(ii) expressing the payload in a retina tissue of the subject, thereby treating the condition in the subject.

95. A method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises the VP capsid polypeptide of any one of claims 1-64;(ii) delivering the payload to a retina tissue of the subject; and(iii) producing a therapeutic effect in the retina tissue, thereby treating the condition.

96. The method of any one of claims 92-95, comprising administering the rAAV via intravitreal administration.

97. The method of any one of claims 92-95, comprising administering the rAAV via subretinal injection, topical mucosal administration, or systemic administration.

98. The method of any one of claims 87-97, wherein the condition is an ocular condition.

99. The method of claim 98, wherein the ocular condition is achromatopsia, macular degeneration, cataracts, choroideremia, glaucoma, optical neuropathy, Marfan syndrome, myopia, polypoidal choroidal vasculopathy, retinitis pigmentosa, Stargardt disease, Usher syndrome, Leber congenital amaurosis, Leber hereditary optical neuropathy, Uveal melanoma, or X-linked retinoschisis.

100. The method of claim 98 or claim 99, wherein the ocular condition is Stargardt disease.

101. The method of any one of claims 76-100, further comprising delivering the rAAV to a retina tissue with higher tissue tropism than a wild type AAV5 capsid comprising a peptide of SEQ ID NO: 1.

102. The method of any one of claims 76-101, further comprising delivering the rAAV to a retina tissue with higher tissue tropism than for photoreceptor tissue.

103. The method of any one of claims 76-102, comprising delivering the rAAV to a retina tissue with at least 2.5-fold, at least 3-fold, at least 3.5-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 75-fold, at least 100-fold, at least 200-fold, at least 500-fold higher, or at least 1000-fold higher tissue tropism than a wild type AAV5 capsid comprising a peptide of SEQ ID NO: 1.

104. The method of any one of claims 76-103, comprising administering from 1×105 to 5×1014 rAAVs.

105. The method of any one of claims 76-104, wherein the payload encodes a therapeutic protein, therapeutic polynucleotide, a guide RNA, a tRNA, a suppressor tRNA, a siRNA, a miRNA, an mRNA, a shRNA, a circular RNA, an antisense oligonucleotide (ASO), a ribozyme, a DNAzyme, an aptamer, or any combination thereof.

106. The method of claim 105, wherein the guide RNA is a CRISPR/Cas guide RNA or an ADAR guide RNA.

107. The method of claim 105, wherein the therapeutic protein is selected from the group consisting of CNGB3, NOS2A, CFH, CF, C2, C3, CFB, HTRA1/LOC, MMP-9, TIMP-3, SLC16A8, GEMIN4, CYP51A1, RIC1, TAPT1, TAF1A, WDR87, APE1, MIP, Cx50, GJA3, GJA8, CRYAA, CRYBB2, PRX, POLR3B, XRCC1, ZNF350, EPHA2, REP1, CALM2, MPP-7, Optineurin, LOX1, CYP1B1, CAV1/2, MYOC, PITX2, FOXC1, PAX6, LTBP2, Complex I, ND, OPA1, RPE65, FBN1, TGFBR2, MTHFR, MTR, MTRR, HGF, C-MET, UMODL1, MMP-1/2, CBS, IGF-1, UHRF1BP1L, PTPRR, PPFIA2, P4HA2, SERPING1, PEDF, ARMS2-HTRA1, FGD6, ABCG1, LOC387715, CETP, NRL, RDH12, PRPH2 (RDS), RHO, RPGR, SNRNP200, NR2E3, IMPDH1, CRX, HK1, IMPDH2, PRPF3, AGBL5, ABCA1, ABCA4, CRB1, USH2A, NRP1, ND4, RLBP1, PTEN, BAP1, GNAQ, GNA11, DDEF1, SF3B1, EIF1AX, CDKN2A, p14ARF, HERC2/OCA2, VEGF, and RS1.

108. The method of claim 105, wherein the therapeutic polynucleotide targets an mRNA encoding a protein selected from the group consisting of CNGB3, NOS2A, CFH, CF, C2, C3, CFB, HTRA1/LOC, MMP-9, TIMP-3, SLC16A8, GEMIN4, CYP51A1, RIC1, TAPT1, TAF1A, WDR87, APE1, MIP, Cx50, GJA3, GJA8, CRYAA, CRYBB2, PRX, POLR3B, XRCC1, ZNF350, EPHA2, REP1, CALM2, MPP-7, Optineurin, LOX1, CYP1B1, CAV1/2, MYOC, PITX2, FOXC1, PAX6, LTBP2, Complex I, ND, OPA1, RPE65, FBN1, TGFBR2, MTHFR, MTR, MTRR, HGF, C-MET, UMODL1, MMP-1/2, CBS, IGF-1, UHRF1BP1L, PTPRR, PPFIA2, P4HA2, SERPING1, PEDF, ARMS2-HTRA1, FGD6, ABCG1, LOC387715, CETP, NRL, RDH12, PRPH2 (RDS), RHO, RPGR, SNRNP200, NR2E3, IMPDH1, CRX, HK1, IMPDH2, PRPF3, AGBL5, ABCA1, ABCA4, CRB1, USH2A, NRP1, ND4, RLBP1, PTEN, BAP1, GNAQ, GNA11, DDEF1, SF3B1, EIF1AX, CDKN2A, p14ARF, HERC2/OCA2, VEGF, or RS1.

109. The method of claim 105, wherein the payload encodes a therapeutic polynucleotide targeting ABCA1, ABCA4, or CRB1 or a transgene encoding ABCA1, ABCA4, or CRB1.

110. The method of claim 105, wherein the payload encodes a component of a CRISPR/Cas system, an adenosine deaminase acting on RNA (ADAR) enzyme, a transcriptional activator, or a transcriptional repressor.

111. The method of claim 110, wherein the component of the CRISPR/Cas system comprises a Cas3, a Cas8, a Cas10, a Cas9, a Cas4, a Cas12, a Cas13, a guide RNA, or a combination thereof.

112. The method of claim 110, wherein the ADAR enzyme is ADAR1 or ADAR2.

113. The method of claim 110, wherein the transcriptional activator is VP64.

114. The method of claim 110, wherein the transcriptional repressor is KRAB.

115. The method of any one of claims 105-114, further comprising expressing a therapeutic polypeptide or a therapeutic polynucleotide encoded by the payload.

116. The method of any one of claims 105-115, comprising expressing the therapeutic polypeptide or the therapeutic polynucleotide at a higher level in a retina tissue compared to a wild type AAV5 capsid comprising a peptide of SEQ ID NO: 1.

117. The method of claim 116, comprising expressing the therapeutic polypeptide or the therapeutic polynucleotide in a retina tissue at a level that is at least 3-fold, at least 3.5-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 20-fold, at least 50-fold, at least 75-fold, at least 100-fold, at least 200-fold, at least 500-fold higher, or at least 1000-fold higher compared to the wild type AAV5 capsid.

118. The method of any one of claims 76-117, comprising producing a toxicity in the subject that is lower than a toxicity produced upon administration of a comparable number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1.

119. The method of any one of claims 76-118, comprising producing a toxicity in the subject that is lower than a toxicity produced upon administration of a number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1 sufficient to deliver a comparable number of payloads to a retina tissue.

120. The method of any one of claims 76-119, comprising producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1.

121. The method of any one of claims 76-120, comprising producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV2 capsids.

122. The method of any one of claims 76-121, comprising producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV8 capsids.

123. The method of any one of claims 76-122, comprising producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a comparable number of wild type AAV9 capsids.

124. The method of any one of claims 76-123, comprising producing a concentration of neutralizing antibodies in the subject that is lower than a concentration of neutralizing antibodies produced upon administration of a number of wild type AAV5 capsids comprising a VP capsid polypeptide of SEQ ID NO: 1 sufficient to deliver a comparable number of payloads to a retina tissue.

125. The rAAV capsid of claim 65 or 66, the rAAV of any one of claims 67 to 73, or the pharmaceutical composition of claim 74 for use as a medicament.

126. The rAAV capsid of claim 65 or 66, the rAAV of any one of claims 67 to 73, or the pharmaceutical composition of claim 74 for use in a method of treating an ocular condition.

127. The rAAV capsid, rAAV or pharmaceutical composition for use of claim 126, wherein the ocular condition is achromatopsia, macular degeneration, cataracts, choroideremia, glaucoma, optical neuropathy, Marfan syndrome, myopia, polypoidal choroidal vasculopathy, retinitis pigmentosa, Stargardt disease, Usher syndrome, Leber congenital amaurosis, Leber hereditary optical neuropathy, Uveal melanoma, or X-linked retinoschisis.

128. The rAAV capsid, rAAV or pharmaceutical composition for use of claim 126 or 127, wherein the ocular condition is Stargardt disease.

129. A viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513.

130. The VP capsid polypeptide of claim 1, wherein the 581 to 589 region comprises a sequence of any one of SEQ ID NO: 2014-SEQ ID NO: 2513.

131. A viral protein (VP) capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 4514-SEQ ID NO: 5013.

132. The VP capsid polypeptide of claim 3, wherein the 581 to 589 region comprises a sequence of any one of SEQ ID NO: 4514-SEQ ID NO: 5013.

133. A recombinant viral adeno-associated virus (rAAV) capsid comprising the VP capsid polypeptide of any one of claims 129-132, wherein the rAAV capsid preferentially targets retinal pigment epithelium tissue.

134. A recombinant viral adeno-associated virus (rAAV) capsid comprising the VP capsid polypeptide of any one of claims 129-132, wherein the rAAV capsid preferentially targets choroid tissue.

135. A method of delivering a payload to a retinal pigment epithelium tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013.

136. A method of delivering a payload to a retinal pigment epithelium tissue of a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013.

137. A method of delivering a payload to a choroid tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013; and(ii) delivering the payload to the choroid tissue.

138. A method of delivering a payload to a retinal pigment epithelium tissue of a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates the payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013; and(ii) delivering the payload to the retinal pigment epithelium tissue.

139. A method of treating a condition in a subject, the method comprising administering a recombinant adeno-associated virus (rAAV) to the subject via intravitreal administration, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013.

140. A method of treating a condition in a subject, the method comprising: (i) administering a recombinant adeno-associated virus (rAAV) to the subject, wherein the rAAV encapsidates a payload, and wherein the rAAV comprises a VP capsid polypeptide comprising a 581 to 589 region corresponding to residues 581 to 589 of an AAV5 VP1 polypeptide, wherein the 581 to 589 region comprises a sequence having at least 85% sequence identity to any one of SEQ ID NO: 2014-SEQ ID NO: 2513 or SEQ ID NO: 4514-SEQ ID NO: 5013; and(ii) expressing the payload in a retinal pigment epithelium tissue of the subject, thereby treating the condition in the subject.