Patent Application
20140187608
The specification further incorporates by reference the Sequence Listing submitted herewith via EFS on Dec. 20, 2013. Pursuant to 37 C.F.R. 1.52(e)(5), the Sequence Listing text file, identified as 0700505112Seqlist.txt, is 19,313 bytes and was created on Dec. 19, 2013. The Sequence Listing, electronically filed herewith, does not extend beyond the scope of the specification and thus does not contain new matter.
Association between recurrent de novo 22q11.2 microdeletions and schizophrenia represented a shift in our understanding of the genetic architecture of schizophrenia (SCZ), highlighting the role that rare and highly penetrant mutations play in the disease risk (1,2). This view has been strengthened recently by the identification of a widespread role of chromosomal microdeletions and microduplications (copy-number variants or CNVs) in determining susceptibility to schizophrenia and other psychiatric disorders (3-5). Individuals with 22q11.2 microdeletions have specific behavioral impairments and exhibit a spectrum of deficits in cognitive abilities linked to activity in the hippocampus and prefrontal cortex, such as measures of attention, working memory and executive function. Up to one third of children with the microdeletion develop schizophrenia or schizoaffective disorder in adolescence or early adulthood accounting for 1-2% of sporadic schizophrenia cases (2). Understanding how the genes disrupted by this microdeletion contribute to the emergence of the psychiatric and cognitive phenotypes associated with this genomic imbalance would provide important clues for the pathogenesis of SCZ and can guide future analysis of other CNVs that cause psychiatric disorders (6,7).
The present invention relates to methods and compositions for enhancing neuronal connectivity. It is based, at least in part, on the discovery of a protein, termed “Mirta22,” that inhibits the formation of structures which create connections between neurons. It is further based, in part, on the discovery that inhibiting Mirta22 activity by short hairpin RNA was able to restore these structures. Mirta22 was discovered in experiments relating to 22q11 microdeletions, which have been linked to schizophrenia. Accordingly, the present invention provides for methods of treating schizophrenia comprising administering an agent that inhibits Mirta22 activity. It may also be used in the treatment of other disorders that would benefit from enhanced neural connectivity, including learning and memory disorders.
(B-C) qRT-PCR quantification of endogenous 2310044H10Rik (Mirta22) in DIV7 hippocampal neurons. Expression levels in anti-mir-185-treated and pre-mir-185-treated neurons were normalized to expression levels under respective controls. (B) Increased expression levels of Mirta22 in neurons transfected with anti-miR-185 at DIV5 (n=5, each treatment), (C) Reduced expression levels of Mirta22 in DIV9 hippocampal neurons transfected with pre-miR-185 mimic at DIV7 (n=3, each treatment). (D-E) qRT-PCR quantification of endogenous 2310044H10Rik (Mirta22) in N18 cells. Expression levels in pre-mir-185-treated and anti-mir-185-treated cells were normalized to expression levels under respective controls. (D) Reduced expression levels of Mirta22 in cells transfected with pre-mir-185 mimic (n=3, each treatment). (E) Up-regulation of Mirta22 in cells transfected with an anti-mir-185 LNA oligo (n=3, each treatment). (F-H) Repression effects of pre-mir-185, pre-mir-485 and pre-mir-491 on Mirta22 3′UTR were examined by a dual-luciferase reporter assay. psiCHECK2 plasmids containing a Renilla luciferase gene under the control of either Wt or one of the mutant 2310044H10Rik (Mirta22) 3′UTRs were co-transfected with pre-miRNA or pre-scramble mimic into the N18 neuroblastoma cell line (n=3 for each condition). Firefly luciferase expressed from the same plasmid was used as internal control. Values are Renilla luciferase levels relative to firefly luciferase levels and normalized to the relative expression levels under pre-scramble treatment (F, H) or to the relative expression levels from plasmid with no 3′UTR (G). Pre-mir-185 significantly decreases the 2310044H10Rik (Mirta22) 3′UTR reporter expression over a concentration range of 10 nM to 0.01 nM (F). pre-mir-185 mediated repression on 2310044H10Rik (Mirta22) 3′UTR reporter expression depends on conserved miRNA binding sites (G). 2310044H10Rik (Mirta22) 3′UTR luciferase reporters with mutations at Site 1 (Mut1) or Site 2 (Mut2) or both sites (Mut1& 2) were analyzed. Mutated 2310044H10Rik (Mirta22) 3′UTR reporters express significantly higher luciferase activities than Wt Mirta22 3′UTR reporters. Pre-mir-485 and pre-mir-491 significantly decreases the 2310044H10Rik (Mirta22) 3′UTR reporter expression (H). For all data, ***P<0.001, **P<0.01, *P<0.05 (Student's t-test); Error bars indicate s.e.m.
(G) qRT-PCR results showing that the endogenous Mirta22 mRNA was significantly reduced in DIV12 hippocampal cultured neurons transfected with Mirta22 shRNA. (H) Right: Representative western blot showing the reduction of the endogenous Mirta22 protein in DIV12 hippocampal neurons transfected with Mirta22 shRNA (lane 2) or scramble shRNA (lane 1). Alpha-tubulin is the loading control. Left: Quantification of western blots showing a 48% decrease (p<0.01; n=4 each condition) in Mirta22 levels in Mirta22 shRNA-transfected cells, compared to scramble shRNA-transfected cells. (I-J) Reduction in the number of primary dendrites (I), but not reduction in the number branch points (J), in Df(16)A+/− neurons at DIV9 relative to Wt neurons is reversed by the transfection of a construct that expresses 2310044H10Rik (Mirta22) shRNA+/− (n=24 for Wt+scr shRNA; n=21 for Df(16)A+/− scr shRNA; n=25 for Df(16)A+/−+Mirta22 shRNA). Scr shRNA: scramble shRNA. N.S.: not significant. In (J), values of Df(16)A+/− neurons were normalized to Wt+scr shRNA. (K) Reduction in the density of mushroom spines (estimated over 75 μm of dendritic length) in Df(16)A+/− neurons at DIV19 relative to Wt neurons is reversed by the introduction of Mirta22 shRNA, but not scramble shRNA+/− (n=22 for Wt+scr shRNA; n=24 for Df(16)A+/− scr shRNA; n=15 for Df(16)A+/−+Mirta22 shRNA). Values of Df(16)A+/− neurons were normalized to Wt+scr shRNA. (L) Transfection of Mirta22 shRNA does not affect the width of mushroom spines of Df(16)A+/− neurons at DIV19 (p 0.05, Kolmogorov-Smirnov test), n=342 for Wt+pre-scr; n=289 for Df(16)A+/−+pre-scr, n=177 for Df(16)A+/−+pre-miR-185. (A-E, G-K) Results are expressed as mean±SEM. *p<0.05, **p<0.01 (Student's t-test).
Results are expressed as mean±SEM. *p<0.05, **p<0.01, ***p<0.001 (Student's t-test).
Expression heatmap plot of all potential miR-185 targets that have Golgi apparatus related function (GO term) in E17 (left panel), P6 (middle panel) and adult (right panel) HPC of Df(16)A+/− mice and Wt littermates.
As discussed in the working example below, it was discovered that a consequence of 22q11.2 hemizygous microdeletion is heterozygosity for expression of the microRNA, mir-185. It was further discovered that decreased levels of mir-185 consequent to heterozygosity lead to overexpression of Mirta22, and that overexpression of Mirta22 is associated with changes in neuronal morphology, including decreased numbers of primary dendrites, decreased spine density, and a small but significant reduction in mushroom spine width, all of which are, in turn, associated with decreased neuronal connectivity. According to the invention, neuronal connectivity may be increased by decreasing the activity of Mirta22 and/or increasing the activity of mir-185. Further, as both mir-485 and mir-491 also have binding sites in proximity to Mirta22, the present invention also provides for increasing neuronal connectivity by increasing the activity of mir-485 and/or mir-491.
For clarity of description, and not by way of limitation, the detailed description of the invention is divided into the following subsections:
(i) mir-185, mir-485 and mir-491;
(ii) Mirta22; and
(iii) methods of treatment.
The present invention provides for mir-185, mir-485 and mir-491 nucleic acid molecules. These nucleic acid molecules may be comprised of deoxyribonucleotides and/or ribonucleotides and may optionally comprise non-naturally occurring nucleotides, for example phosphorothioate residues, to promote stability. In non-limiting embodiments the mir-185, mir-485 or mir-491 nucleic acid molecules are between about 15 and 100, or between about 15 and 80, or between about 15 and 70, or between about 15 and 60, or between about 15 and 50, or between about 15 and 40, or between about 15 and 30, nucleotides in length or between about 22 and 100, or between about 22 and 80, or between about 22 and 70, or between about 22 and 60, or between about 22 and 50, or between about 22 and 40, or between about 22 and 30, nucleotides in length.
In certain non-limiting embodiments, the present invention provides for murine mir-185 nucleic acid molecules, including, as non-limiting examples, the mir-185 RNA molecule as well as precursors thereof. In certain non-limiting embodiments, the present invention provides for murine mir-185 nucleic acid molecules. Such molecules may comprise the sequence, GenBank Acc. No. NR—029571: agggattggagagaaaggcagttcctgatggtcccctcccagg ggctggctttcctctggtcctt (SEQ ID NO:6), or a sequence at least 95 percent homologous thereto or at least 99 percent homologous thereto (homology, as that term is used herein, may be measured using standard software such as BLAST or FASTA). In related non-limiting embodiments, some or all of the thymidines in SEQ ID NO:6 may be substituted with uridine. For example, a murine mir-185 nucleic acid may comprise the sequence agggauuggagagaaaggcaguuccugaugguccccucccaggggcuggcuuuccucugguccuu (SEQ ID NO:7). or may comprise the subsequence (miRBase Acc. No. MIMAT0000214) uggagagaaaggcaguuccuga (SEQ ID NO: 8). In further embodiments, a murine mir-185 nucleic acid may comprise a 15-21 nucleotide fragment of SEQ ID NO:6 or SEQ ID NO:7 or SEQ ID NO:8.
In certain non-limiting embodiments, the present invention provides for human mir-185 nucleic acid molecules, including, as non-limiting examples, the mir-185 RNA molecule as well as precursors thereof. In certain non-limiting embodiments, the present invention provides for human mir-185 nucleic acid molecules. Such molecules may comprise the sequence, GenBank Acc No. NR—029706: agggggcgagggattggagagaaaggcagttcctgatggtcccctcccca ggggctggctttcctctggt ccttccctccca (SEQ ID NO:9), or a sequence at least 95 percent homologous thereto or at least 99 percent homologous thereto. In related non-limiting embodiments, some or all of the thymidines in SEQ ID NO:9 may be substituted with uridine. For example, a human mir-185 nucleic acid may comprise the sequence: agggggcgagggauuggagagaaaggcaguuccugaugguccccuccccaggggcuggcuuuccucuggu ccuucccuccca (SEQ ID NO: 10) or the sequence uggagagaaaggcaguuccuga (SEQ ID NO:8). In further embodiments, a human mir-185 nucleic acid may comprise a 15-21 nucleotide fragment of SEQ ID NO:8 or SEQ ID NO:9 or SEQ ID NO: 10.
In certain non-limiting embodiments, the present invention provides for murine mir-485 nucleic acid molecules, including, as non-limiting examples, the mir-485 RNA molecule as well as precursors thereof. In certain non-limiting embodiments, the present invention provides for murine mir-485 nucleic acid molecules. Such molecules may comprise the sequence, MiRBase Acc. No. MI0003492: ACUUGGAGAGAGGCUGGCCGUGAUGAAU UCGAUUCAUCUAAACGAGUCAUACACGGCUCUCCUCUCUUCUAGU (SEQ ID NO:11) or MiRBase Acc. No. MIMAT0003128: AGAGGCUGGCCGUGAUGAAUUC (SEQ ID NO: 12), or a sequence at least 95 percent homologous thereto or at least 99 percent homologous thereto (homology, as that term is used herein, may be measured using standard software such as BLAST or FASTA). In further embodiments, a murine mir-485 nucleic acid may comprise a 15-21 nucleotide fragment of SEQ ID NO:11 or SEQ ID NO: 12.
In certain non-limiting embodiments, the present invention provides for human mir-485 nucleic acid molecules, including, as non-limiting examples, the mir-485 RNA molecule as well as precursors thereof. In certain non-limiting embodiments, the present invention provides for human mir-485 nucleic acid molecules. Such molecules may comprise the sequence, MiRBase Acc. No. MI0002469: ACUUGGAGAGAGGCUGGCCGUGAUGAAU UCGAUUCAUCAAAGCGAGUCAUACACGGCUCUCCUCUCUUUUAGU (SEQ ID NO: 13) or MiRBase Acc. No. MIMAT0002175: AGAGGCUGGCCGUGAUGAAUUC (SEQ ID NO: 14), or a sequence at least 95 percent homologous thereto or at least 99 percent homologous thereto. In further embodiments, a human mir-485 nucleic acid may comprise a 15-21 nucleotide fragment of SEQ ID NO: 13 or SEQ ID NO: 14.
In certain non-limiting embodiments, the present invention provides for murine mir-491 nucleic acid molecules, including, as non-limiting examples, the mir-491 RNA molecule as well as precursors thereof. In certain non-limiting embodiments, the present invention provides for murine mir-491 nucleic acid molecules. Such molecules may comprise the sequence, MiRBase Acc. No. MI0004680: AAUUGACUUAGCUGGGAAGUGGGGAACCCU UCCAUGAGGAGUAGAACACUCCUUAUGCAAGAUUCCCUUCUACCUGACUGAGUUG A (SEQ ID NO: 15) or MiRBase Acc. No. MIMAT0003486: AGUGGGGAACCCUUCCAUGAGG (SEQ ID NO: 16), or a sequence at least 95 percent homologous thereto or at least 99 percent homologous thereto (homology, as that term is used herein, may be measured using standard software such as BLAST or FASTA). In further embodiments, a murine mir-491 nucleic acid may comprise a 15-21 nucleotide fragment of SEQ ID NO:15 or SEQ ID NO: 16.
In certain non-limiting embodiments, the present invention provides for human mir-491 nucleic acid molecules, including, as non-limiting examples, the mir-491 RNA molecule as well as precursors thereof. In certain non-limiting embodiments, the present invention provides for human mir-491 nucleic acid molecules. Such molecules may comprise the sequence, MiRBase Acc. No. MI0003126: UUGACUUAGCUGGGUAGUGGGGAACCCU UCCAUGAGGAGUAGAACACUCCUUAUGCAAGAUUCCCUUCUACCUGGCUGGGUUG G (SEQ ID NO: 17), or MiRBase Acc. No. MIMAT0002807: AGUGGGGAACCCUUCCAUGAGG (SEQ ID NO: 18), or a sequence at least 95 percent homologous thereto or at least 99 percent homologous thereto. In further embodiments, a human mir-491 nucleic acid may comprise a 15-21 nucleotide fragment of SEQ ID NO:17 or SEQ ID NO:18.
The present invention further provides for nucleic acid molecules comprising nucleotide sequences that are the complements of any of the above-described nucleotide sequences (SEQ ID NO:6-18).
The present invention provides for Mirta22, also known in the literature as 2310044H10Rik (murine) and C19orf63 (human).
In certain non-limiting embodiments, the present invention provides for a murine Mirta22 protein comprising an amino acid sequence as depicted in
In certain non-limiting embodiments, the present invention provides for a nucleic acid encoding a murine Mirta22 protein, as described above. For example, said nucleic acid may comprise the sequence set forth in GenBank Accession No. NM—197991.2 and as depicted in
In certain non-limiting embodiments, the present invention provides for an antibody or fragment (e.g., Fab or F(ab′)2 thereof, or single chain antibody, or diabody, that specifically binds to murine Mirta22 protein, for example a protein having SEQ ID NO: 1. Antibody or the source of antibody fragment may be polyclonal or monoclonal antibody. In a specific, non-limiting embodiment of the invention, the antibody may be directed to the subfragment of murine Mirta22, EQAQKAKNPQEQKSFFAKY (SEQ ID NO:20).
In certain non-limiting embodiments, the present invention provides for a human Mirta22 protein (isotype 1) comprising an amino acid sequence as depicted in
In certain non-limiting embodiments, the present invention provides for a nucleic acid encoding a human Mirta22 protein (isotype 1), as described above. For example, said nucleic acid may comprise the sequence as set forth in GenBank Accession No. NM—206538.2 and as depicted in
In certain non-limiting embodiments, the present invention provides for an antibody or fragment (e.g., Fab or F(ab′)2 thereof, or single chain antibody, or diabody, that specifically binds to human Mirta22 protein, for example a protein having SEQ ID NO:2, Antibody or the source of antibody fragment may be polyclonal or monoclonal antibody. In a specific, non-limiting embodiment of the invention, the antibody may be directed to the sub fragment of human Mirta22 sharing the sequence with the murine protein, EQAQKAKNPQEQKSFFAKY (SEQ ID NO: 20).
In certain non-limiting embodiments, the present invention provides for a human Mirta22 protein (isotype 2) comprising an amino acid sequence as depicted in GenBank Accession No. NM—175063.4, MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGR EGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAA LNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNWGVSV VTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQE QKSFFAKYWHIILGGAVLLTALRPAAPGPAPPPQEA (SEQ ID NO:4), or a subsequence thereof comprising amino acids 28-263, or a variant of the complete protein or subsequence that is at least about 95 percent or at least about 99 percent homologous thereto.
In certain non-limiting embodiments, the present invention provides for a nucleic acid encoding a human Mirta22 protein (isotype 2), as described above. For example, said nucleic acid may comprise the sequence as set forth in GenBank Accession No. NM—175063.4 and as depicted in
In certain non-limiting embodiments, the present invention provides for an antibody or fragment (e.g., Fab or F(ab′)2 thereof, or single chain antibody, or diabody, that specifically binds to human Mirta22 protein, for example a protein having SEQ ID NO:4. Antibody or the source of antibody fragment may be polyclonal or monoclonal antibody. In a specific, non-limiting embodiment of the invention, the antibody may be directed to the subfragment of human Mirta22 sharing the sequence with the murine protein, EQAQKAKNPQEQKSFFAKY (SEQ ID NO:20).
In certain non-limiting embodiments, the present invention provides for a method for increasing connectivity between neurons comprising administering to said neurons an effective amount of an agent that inhibits Mirta22 activity.
“Increasing connectivity between neurons” includes increasing the number of primary dendrites and/or increasing the spine density and/or increasing the width of mushroom spines on neurons and/or increasing the number of synapses.
The method for increasing connectivity between neurons may be practiced in vitro or in vivo.
The neurons in said methods may be human or non-human neurons.
“Inhibits Mirta22 activity” includes reducing and/or antagonizing Mirta22 activity. Agents that inhibit Mirta22 activity may act, for example, by reducing transcription or translation or processing of Mirta22 or by antagonizing the function of Mirta22, for example by binding to it such as to reduce or prevent it from performing its natural function.
Agents that inhibit Mirta22 activity include, but are not limited to, mir-185, mir-485, mir-491, antisense RNA comprising a sequence complementary to the Mirta22 mRNA; RNAi comprising a sequence complementary to the Mirta22 mRNA, shRNA comprising a sequence complementary to the Mirta22 mRNA, an anti-Mirta22 antibody or fragment thereof, a single chain antibody that specifically binds to Mirta22, or a diabody that specifically binds to Mirta22.
In certain non-limiting embodiments, the present invention provides for a method for increasing connectivity between neurons comprising administering to said neurons an effective amount of an agent that increases mir-185 activity.
“Increasing mir-185 activity” includes increasing the amount or functionality of mir-185. For example, but not by way of limitation, agents that increase mir-185 activity include a mir-185 nucleic acid, as well as agents that promote mir-185 functionality, for example agents that increase the activity of Dgcr8 including Dgcr8 protein or a nucleic acid encoding Dgcr8 protein. Agents that directly increase mir-185 activity include mir-185 nucleic acid. Agents that indirectly increase mir-185 include agents that increase the activity of Dgcr8.
In certain non-limiting embodiments, the present invention provides for a method for increasing connectivity between neurons comprising administering to said neurons an effective amount of an agent that increases mir-485 activity.
“Increasing mir-485 activity” includes increasing the amount or functionality of mir-485. For example, but not by way of limitation, agents that increase mir-485 activity include a mir-485 nucleic acid, as well as agents that promote mir-485 functionality, for example agents that increase the activity of Dgcr8 including Dgcr8 protein or a nucleic acid encoding Dgcr8 protein. Agents that directly increase mir-485 activity include mir-485 nucleic acid. Agents that indirectly increase mir-485 include agents that increase the activity of Dgcr8.
In certain non-limiting embodiments, the present invention provides for a method for increasing connectivity between neurons comprising administering to said neurons an effective amount of an agent that increases mir-491 activity.
“Increasing mir-491 activity” includes increasing the amount or functionality of mir-491. For example, but not by way of limitation, agents that increase mir-491 activity include a mir-491 nucleic acid, as well as agents that promote mir-491 functionality, for example agents that increase the activity of Dgcr8 including Dgcr8 protein or a nucleic acid encoding Dgcr8 protein. Agents that directly increase mir-491 activity include mir-491 nucleic acid. Agents that indirectly increase mir-491 include agents that increase the activity of Dgcr8.
In related non-limiting embodiments, the present invention provides for a method for increasing connectivity between neurons in a subject in need of such treatment comprising administering to said subject an effective amount of an agent that inhibits Mirta22 activity.
A subject in need of such treatment is a subject who suffers from schizophrenia or a related disorder or a subject who has a disorder of memory or learning or a subject who would benefit from enhancement of neural connectivity or memory or learning capabilities. A subject may be a human or non-human subject.
Schizophrenia-related disorders include but are not limited to brief psychotic disorder, schizophreniform disorder, schizoaffective disorder, and delusional disorder.
Disorders of memory include, but are not limited to, Alzheimer's disease, Lewy body dementia, vascular dementia, corticobasal degeneration, Creuzfeld-Jacob disease, frontotemporal dementia, Huntington's disease, mild cognitive impairment, progressive supranuclear palsy, and Picks disease.
Disorders of learning include, but are not limited to, attention deficit hyperactivity disorder, dyslexia, dyscalcula, nonverbal learning disorder and mental retardation.
Additional subjects that may benefit from treatment according to the invention include, but are not limited to, subjects suffering from autism, Asperger's syndrome, depression, bipolar disorder, obsessive compulsive disorder, and subjects suffering from memory or learning deficits secondary to cerebral infarction, surgical, radiologic, or chemotherapeutic treatment of the brain, or trauma. The present invention provides for a method for increasing connectivity between neurons in such subjects comprising administering to said subject an effective amount of an agent that inhibits increases mir-185, mir-485 and/or mir-491 activity and/or inhibits Mirta22 activity.
In certain non-limiting embodiments, the present invention provides for a method of treating schizophrenia or a related disorder in a subject, comprising administering to said subject an effective amount of an agent that inhibits Mirta22 activity.
In certain non-limiting embodiments, the present invention provides for a method of treating schizophrenia or a related disorder in a subject, comprising administering to said subject an effective amount of an agent that increases mir-185, mir-485 and/or mir-491 activity.
In certain non-limiting embodiments, the present invention provides for a method of enhancing memory in a subject, comprising administering to said subject an effective amount of an agent that inhibits Mirta22 activity.
In certain non-limiting embodiments, the present invention provides for a method of enhancing memory in a subject, comprising administering to said subject an effective amount of an agent that increases mir-185, mir-485 and/or mir-491 activity.
Enhancement of memory may be determined using standard tests. In non-human animals, for example, memory may be tested using performance in a passing through a maze. In humans, memory may be tested, for example but not by way of limitation, using the Mini-Mental State Exam or the Wechsler Memory Scale.
In any of the foregoing, the species of origin of nucleic acids or antibodies or related molecules being utilized is preferably the same as or closely related to the species of the neurons or subject being treated.
According to the invention, the agent may be administered by any route, including but not limited to intrathecal, intravenous, nasal, intraarterial, oral, intramuscular, subcutaneous, pulmonary, intraperitoneal, etc.
The present invention provides for pharmaceutical compositions comprising an agent for use according to the invention in a suitable carrier, such as, but not limited to, normal saline or sterile water.
The present invention is exemplified but not limited by the following working example, which sets for additional specific non-limiting embodiments of the present invention. The contents of the working example are hereby incorporated by reference into the detailed description of the invention.
Mice, qRT-PCR and Expression Profiling.
Generation of Df(16)A+/− and Dgcr8+/− mice is described in (8). Total RNA was isolated by miRNeasy mini kit. qRT-PCR was performed as described in (8). For expression profiling, cDNA was generated and exposed to the Affymetrix Mouse genome 430 2.0 array, which includes 45,000 probe sets from 34,000 well characterized mouse genes. Data were obtained using GeneChip Analysis Software Microarray Suite version 5 and analyzed with limma package in the bioconductor project (www.bioconductor.org)_.
Analysis of Dendritic Complexity and Spine Morphology.
Dissected E17 hippocampal neurons were plated at 2×105 cells/ml in 6-well plates and cultured for 9-19 days, depending on the experiments. Images of basal dendrites and dendritic spines were acquired as described previously (9). An experimenter blind to the genotype performed imaging and analysis. Semi-automatic tracing and quantification was performed using ImageJ and NeuroStudio (30,31). The number of primary dendrites and total branch points for each treatment condition were calculated by L-measure [version 4.0](32). Statistics were conducted using Student's t-test (number of primary dendrites and branch points, as well as spine density) and Kolmogorov-Smirnov test (width of mushroom spines).
Luciferase Assay.
Mirta22 3′UTR was cloned into psiCHECK2. Binding site mutant clones were generated by PCR-based mutagenesis. N18 neuroblastoma cells were transfected with various psiCHECK2 reporter constructs together with pre-mir-185 mimic or pre-scramble control unless mentioned otherwise and luciferase assays were performed using the Promega Dual-Luciferase Reporter Assay System. All experiments were performed at least 2 times and all data presented is the average of 3 technical repeats.
Antibodies.
A 20 amino acid peptide ([H]-CEQAQKAKNPQEQKSFFAKY-[NH2]) (SEQ ID NO:21) was used to generate a rabbit polyclonal antibody. The specificity of the antibody was determined as described in
In Situ Hybridization.
Digoxigenin tail labeled anti-mir-185 locked nucleic acid (LNA) and scramble LNA oligonucleotides were obtained from Exiqon. In situ hybridization was conducted as described previously (33).
qRT-PCR and Primers.
Total RNA was isolated from brain or culture cells using the miRNeasy mini kit (QIAGEN) according to manufacturer's instructions. qRT-PCR was performed as described in detail previously (8). The sequences of primers used are as follows:
Neuronal Culture and Transfection.
Dissociated neurons were isolated from E17 mouse embryos and plated at 2×105 cells/ml in 6-well plates containing glass coverslips coated with poly-D-lysine. Neurons were cultured for 9-19 days, depending on the experiments. A pRFP-C-2310044H10Rik shRNA and pRFP-C-scramble shRNA control (Origene), a Mirta22 (2310044H10Rik) cDNA clone (Origene), as well as pre-mir-185 mimic and a pre-scramble control (Ambion) were used for high efficiency calcium-phosphate mediated transfections as described previously (34). For all experiments, 5 μg of total plasmids and/or 100 pmol of pre-miRNA mimics were used per well.
Analysis of Dendritic Complexity.
Images of basal dendrites were acquired as described previously (9). An experimenter blind to the genotype performed all imaging and analysis. The basal dendrite branches were semi-automatically traced from the somata of neurons using NeuronStudio (31). The .swc files were imported into L-measure (32). The number of primary dendrites and total branch points for each treatment condition were calculated by L-measure (version 4.0). Statistical analysis was conducted using the Student's t-test as implemented in L-measure. Sholl analysis was conducted in ImageJ (http://rsbweb.nih.gov/ij/) using the “Sholl analysis” plugin (http://biology.ucsd.edu/labs/ghosh/software/ShollAnalysis.pdf). The results were combined in the MS-Excel and a student t-test was conducted to determine the intersection number and significance at each step size between the experimental group and the controls.
Analysis of Spine Morphology.
Images of dendritic spines were acquired as described previously (9). For each experiment, images across all genotypes were acquired with similar optimal settings for laser power, detector gain, and amplifier offset. An experimenter blind to the genotype performed all imaging and analysis. Quantification of spine density, length, and width was performed using ImageJ (http://rsbweb.nih.gov/ij/) and NeuroStudio30. One basal dendrite, each at least 75 μm in length from the first branch point, was analyzed per neuron. We analyzed at least 4 neurons from each animal. Spine width was measured as the distance of a straight line drawn across the widest part of the spine head. Changes in spine density between groups were assessed by Student's t-test. The distribution of width of mushroom spines was compared using the Kolmogorov-Smirnov test.
Expression Profiling.
A total of 48 PFC and 48 HPC from 12 Df(16)A+/− mutants and 12 WT littermate control mice at E17 and P6 were dissected and processed using standard protocols recommended by Affymetrix. RNA quality was assessed with Bioanalyzer (Agilent Technologies) and all RNAs had a RIN>7.0. For hybridization, cRNA was exposed to the Affymetrix Mouse genome 430 2.0 array, which includes 45,000 probe sets from 34,000 well characterized mouse genes, and then scanned (Agilent). Sequence clusters were created and refined from the UniGene and the Whitehead Institute Center for Genome Research databases.
Microarray Data Analysis.
Initial intensity files (CEL files) were obtained from microarray images using GeneChip (Affymetrix) Analysis Software Microarray Suite version 5 (Affymetrix) and analyzed with limma package in the bioconductor project (www.bioconductor.org). Data analysis of Df(16)A+/− and Wt littermate expression profiling at E17 and P6 was performed as previously described (8). Briefly, the raw intensity data were first normalized by the Robust Multichip Average (RMA) method, linear models were applied and differential expression was determined by limma package. The gene list was ranked according to their nominal P values and the significance level was estimated by adjusting P values using Benjamini and Hochberg FDR35 to control false positive rate due to multiple testing.
Functional and Geneset Enrichment Analysis of Predicted miR-185 Targets.
miR-185 target predictions were obtained using TargetScan Mouse v5.2. The gene list was imported into DAVID gene functional annotation database. 92% (2708 out of 2932) predicted targets genes were mapped into the DAVID database. Functional annotation was conducted using the program's functional annotation clustering analysis with default settings. The gene list from the top cluster (“Golgi apparatus”) was converted into Affymetrix IDs using the DAVID ID conversion tool and further mapped to the corresponding IDs of the Affymetrix mouse 430 2.0 chip. This final probeset list was used as a user-defined geneset for downstream analysis. Geneset enrichment analysis was conducted using the ErmineJ software (38). Analysis was conducted using the receiver operator characteristic (ROC) analysis based on p value rankings.
Luciferase Assays.
Mirta22 3′UTR was cloned into XhoI and NotI sites of psiCHECK2 (Promega). Binding site mutant clones were generated by PCR-based mutagenesis. Site Mut1 sequence (starting from position 289 in 3′UTR): GGAgtTTGCCAAGCTCggTaaA (SEQ ID NO:25; lower case letters denote altered nucleotide). Site Mut2 sequence (starting from position 350): AtTGTCACgCTaaA (SEQ ID NO:26). Mutations are predicted by RNAhybrid36 to disrupt the binding of mir-185 at the seeds and secondary binding sites. N18 neuroblastoma cells were transfected with various psiCHECK2 reporter constructs (100 ng per well of a 24-well plate) together with pre-mir-185 mimic or pre-scramble control (1 nM=0.5 pmol), unless mentioned otherwise, and luciferase assays were performed 24 hrs post-transfection using the Dual-Luciferase Reporter Assay System (Promega) under the manufacturer's instructions. Ail experiments were performed at least 2 times and all data presented is the average of 3 technical repeats.
Antibody Production.
A 20 amino acid peptide ([H]-CEQAQKAKNPQEQKSFFAKY-[NH2]) (SEQ ID NO:21) was designed, synthesized and conjugated to KLH (Keyhole Limpet Hemocyanin) and then injected into rabbits using Covance custom antibody production service (Covance). Antibody serum was then purified using Melon Gel IgG purification Kit (Thermo Scientific) and the purified antibody was used for western blot (1:50), immunohistochemistry and immunocytochemistry assays (1:25).
In western blot assays of 293T cell lysates, the purified antibody specifically recognized overexpressed full length Mirta22 tagged with C-terminal FLAG (28 kD), which was independently verified using both polyclonal and monoclonal anti-FLAG antibodies (
Western Blot Assays.
The western blot procedure has been described previously (8). Briefly, equal amounts of protein were separated and then transferred onto an ECF plus membrane. The membrane was probed with 1:50 purified Mirta22 antibody and then with 1:5000 horseradish peroxidase conjugated secondary antibody. The washed membrane was incubated with HRP substrate and chemiluminence images were obtained using Alpha imaging system.
Immunohistochemistry Assays.
Immunohistochemistry assays were conducted according to (37). Briefly, fresh brains were dissected and immediately frozen in OCT. Brains were then sliced at a thickness of 15-20 μm and brain sections were dried at room temperature and then fixed. Sections were incubated overnight with one or two primary antibodies and subsequently incubated for 1 hr with secondary antibody coupled to the Alexa Fluor fluorochromes (1:1,000, Invitrogen). Images were examined under a fluorescence microscope (Nikon).
Immunocytochemistry Assays.
Cells were cultured on coverslips, fixed, permeabilized, and then exposed to primary antibodies and secondary antibodies as described previously (9). Images were examined under a fluorescence microscope (Nikon). For quantification of Mirta22 signals, images were acquired as described previously (9). The raw LSM images were projected and exported using ImageJ. Mirta22 immunocytochemical signal from cell body of each individual neuron was calculated as total integrated density minus background of the cell body area.
Using chromosomal engineering, we generated a mouse model carrying a hemizygous 1.3-Mb chromosomal deficiency on mouse chromosome 16 [Df(16)A], which is syntenic to the 22q11.2 1.5-Mb microdeletion (FIG. 1A-D)(8). Analysis of Df(16)A+/− mice provided evidence for abnormalities in dendritic morphogenesis and formation of dendritic spines of hippocampal pyramidal neurons both in culture and in vivo (8,9). Such changes may account, at least in part, for the regional decreases in grey matter volumes observed in some 22q11.2 deletion carriers (10). Even modest alterations in dendritic and spine formation may result in a suboptimal number of synaptic connections, formation of inappropriate connections or changes in the integration of synaptic inputs, and may ultimately lead to considerable changes in information processing (11,12).
The Df(16)A+/− strain also provided compelling evidence that the 22q11.2 deletion results in abnormal processing of brain microRNAs (miRNAs), a class of small, noncoding RNAs that regulate the stability and translation of mRNAs (13-16). One gene disrupted by the 22q11.2 microdeletion is Dgcr8, a component of the ‘microprocessor’ complex that is essential for miRNA production (17). Dgcr8+/− mice were generated (
A Drastic Reduction of miR-185 Levels in Df(16)A+/− Mice.
Studies in the Df(16)A+/− mouse strain have shown that the 22q11.2 microdeletion results in abnormal processing of a specific subset of brain miRNAs due to the removal of one copy of the Dgcr8 gene and decrease in its expression in the adult brain (8) as well as earlier in the development (
Altered miR-185 Levels Contribute to Structural Alterations of Df(16)A+/− Neurons.
miRNAs have been shown to affect structural indices of neuronal connectivity, such as dendritic tree and dendritic spine development (19-21). 22q11.2 microdeletion results in impaired dendritic tree and dendritic spine development in the brain and these deficits are recapitulated in primary neuronal cultures. Impaired dendritic tree and dendritic spine development could be partially accounted for by the 50% decrease in the levels of Dgcr8 but it remained unknown whether reduction in the levels of mir-185 also contributes (8,9,18). Localization of Mirta22 within the Golgi apparatus and dendritic shafts suggests that diminishment of the repressive influence of miR-185 on Mirta22 levels may also contribute to these deficits.
To investigate this, we first asked whether reduction of miR-185 levels results in deficits in dendritic and spine development similar to those observed in Df(16)A+/− neurons (9). We introduced an anti-miR-185 and a scramble control LNA oligonucleotide into Wt primary hippocampal neurons and measured dendritic and spine morphology two days post-transfection at DIV9 and DIV19, respectively. As mentioned above, we confirmed that introduction anti-miR-185 LNA oligo resulted in a significant increase of Mirta22 mRNA levels when compared to anti-miR control transfected primary neurons (
We also examined whether elevation of miR-185 levels could, at least partially, reverse cytoarchitectural alterations observed in Df(16)A+/− neurons (9). We transfected primary hippocampal neurons from Df(16)A+/− mice and their Wt littermates with a miRNA precursor mimic (“pre-miR-185,” Ambion), which is processed into mature miRNA or a scramble precursor oligonucleotide (“pre-scramble”) with no homology to the mouse genome, which serves as a control for nonspecific effects of small RNA expression. A co-transfected GFP reporter plasmid allowed us to analyze the dendritic architecture (
A Primary Transcriptional Consequence of 22q11.2 Genomic Losses.
Impaired production of miRNAs may have considerable impact on target transcript stability. Previous microarray analysis of adult Df(l 6)A+/− mice revealed that reduction in dosage of genes in the 22q11.2 region results in genome-wide alterations of transcriptional programs in the HPC and PFC (8). We extended analysis of these two brain regions to two earlier developmental stages, embryonic day 17 (E17) and postnatal day 6 (P6), when mir-185 and possibly other miRNAs are already decreased in Df(16)A+/− mice. Only one gene, 2310044H10Rik, was consistently found to be significantly upregulated in at least two of the three developmental stages examined and in at least one of the two brain areas tested. Indeed, 2310044H10Rik was among the top upregulated genes in both postnatal stages examined (adult and P6) and the top upregulated transcript in the frontal cortex of P6 mutant mice (
In independent experiments, we attempted to distinguish primary versus secondary gene targets of the 22q11.2 microdeletion by looking for genes whose expression changes in opposite direction as a result of genomic losses or gains in this locus. Such genes are likely to represent primary targets and direct transcriptional readouts of the underlying copy number imbalances. By contrast, expression changes specific to genomic losses or in the same direction independently of genomic dosage are more likely to be secondary reflections of affected physiological process or malfunctioning brain regions (39). We compared the PFC and HPC gene expression profiles in mice carrying a deletion or duplication at the syntenic mouse locus using as reference compound heterozygous mice balanced for copy number (
The pattern of upregulation in both PFC and HPC was confirmed by TaqMan qRT-PCR (PFC: E17, 20% P=0.24; P6, 59%, P<0.01; Adult, 76%, P<10−6; HPC: E17, 20%, P=0.16; P6, 50%, P<0.05; Adult, 38%, P<0.05;
2310044H10Rik is major downstream effector of miRNA dysregulation. The gene expression profiling described above highlighted the impaired developmental regulation of 2310044H10Rik levels as a major consequence of the 22q11.2 deletion at the transcriptomic level. Notably, 2310044H10Rik mRNA levels were also elevated in Dgcr8+/− mice (HPC: 30%, P<0.05; PFC: 24%, P<0.05;
Because increased brain expression of 2310044H10Rik is recapitulated in primary neurons from Df(16)A+/− mice (
To further characterize the nature of the inhibition of mir-185 on 2310044H10Rik expression and test if it is 2310044H10Rik 3′UTR-dependent as predicted by TargetScan and mirDB (see above), 2310044H10Rik 3′UTR fused luciferase reporter genes (see Methods and Figure legend for details) were cotransfected with either “pre-mir-185” mimic or a scramble precursor (“pre-scramble”), into N18 cells, a mouse neuroblastoma cell line. Pre-scramble did not affect the reporter activity. Introduction of pre-mir-185 mimic led to a dramatic decrease of luciferase activity as compared to the pre-scramble control (P<0.001 for all pre-mir-185 concentrations used, compared to pre-scramble control;
To investigate if mir-185-mediated repression is specific and operates directly via the two binding sites predicted by TargetScan (
We further addressed the dependence of 2310044H10Rik 3′UTR reporter repression on the levels of mir-485 or mir-491, which are also predicted to target binding sites in the 3′UTR of 2310044H10Rik gene. None of these miRNAs is located within the 22q11.2 microdeletion, but both are modestly down-regulated in HPC of Df(16)A+/− mice due to the Dgcr8 hemizygosity (
Interestingly, a comparison between the 3′UTR of human and mouse Mirta22 orthologues as implemented by the “30-way multiz alignment and conservation analysis” in the USCS browser (
Mirta22 Encodes a Novel Neuronal Protein Residing in the Golgi Apparatus.
Mirta22 encodes a 28 kD protein without any known sequence homology or functional domain (http://www.uniprot.org/uniprot/Q3TAS6). The murine orthologue is located on mouse chromosome 7 and contains seven coding exons. The human orthologue (C19orf63) is located on chromosome 19q13.33 and encodes a protein with 92.3% identity to the murine Mirta22 protein (
To investigate the distribution in the brain, as well as the subcellular localization of Mirta22, we raised a polyclonal antibody against a protein segment spanning both isoforms (amino acids 207-226,
miR-185 Reduction Results in Coordinated Mild Dysregulation of Golgi-Related Genes.
Accumulating evidence suggests that miRNAs may target functionally connected genes, often in a developmental stage-specific manner (41, 42). Consistent with this notion, functional annotation clustering analysis of 2708 predicted miR-185 targets (TargetScan Mouse v5.2) included in the DAVID Mus musculus gene functional annotation database (http://david.abcc.ncifcrf.gov) identified as the top enriched gene cluster (gene count=159, Enrichment Score=8.56, FDR-corrected P=2×10−9) the Gene Ontology (cellular component) term “Golgi apparatus” (
Elevation of Mirta22 Levels Inhibits Dendritic and Spine Development in Df(16)A+/− Neurons.
The observation that reduction of Mirta22 levels partially reverses the deficits in neuronal connectivity observed in Df(16)A+/− mice strongly suggests that Mirta22 may be an inhibitor of dendritic and spine development. To test this possibility and determine whether elevation of Mirta22 levels phenocopies aspects of the Df(16)A, we introduced a Mirta22 cDNA into WT primary hippocampal neurons and measured dendritic and spine morphology two days post-transfection at DIV9 and DIV19, respectively. Control experiments using qRT-PCR and western blot confirmed that the Mirta22-encoding plasmid drives increased expression of Mirta22 at both mRNA and protein levels (
We showed that the elevation of mir-185 levels in primary hippocampal neurons from Df(16)A+/− mice reverses some key structural connectivity deficits that emerge as a result of the microdeletion. We also showed that Mirta22 is a major target of mir-185. Therefore, we considered the possibility that elevation of Mirta22 levels may contribute to at least some of the effects of the mir-185 deficiency on the neuronal morphology in Df(16)A+/− mice. To test this hypothesis, we asked first whether reduction of Mirta22 levels could partially reverse the neuronal abnormalities observed in Df(16)A+/− mice (9). We transfected primary hippocampal neurons isolated from Df(16)A+/− embryos and their WT littermates with constructs that coexpress turbo RFP (tRFP) and either a shRNA engineered to knock down expression of endogenous mouse Mirta22 or a scramble control shRNA (scr shRNA). We confirmed that the Mirta22 shRNAs can effectively knockdown the expression of Mirta22 at both mRNA and protein levels (
Elucidation of the biological processes affected by pathogenic CNVs may offer novel insights into the pathogenesis of psychiatric disorders as well as disorders of cognitive development (2). However, the transcriptional networks and signaling cascades that mediate the effects of CNVs on neuronal structure and function remain to a large extent uncharacterized. This study was designed to identify such downstream targets and processes disrupted by a bona fide pathogenic mutation that predisposes to schizophrenia and cognitive dysfunction. By applying an array of morphological, molecular and cellular assays to a mouse model of this mutation we provide a number of novel mechanistic insights.
First, taken together with previous results on the effects of Dgcr8 hemizygosity (18, 8) we provide a comprehensive view of the pattern of miRNA dysregulation emerging due to 22q11.2 deletions, which is shaped by the combined (synergistic and additive) effect of miR-185 and Dgcr8 hemizygosity (see graphic summary). In this context, our results shows how a genuine gene X gene interaction within a pathogenic CNV can result in a considerably greater reduction of the expression of a resident gene than expected by the 50% decrease in gene dosage indicating that mechanisms other than simple haploinsufficiency could represent an important and previously unappreciated component of CNV pathogenicity. Along these lines, our results also raise the more general and intriguing possibility that 22q11.2 microdeletions, by partially disabling the miRNA machinery, create a sensitized genetic background, which promotes the effects of deleterious mutations that affect the expression or activity of a subset of miRNAs (43, 44).
Second, by comparing gene expression profiles over three developmental stages and variable levels of genomic dosage at the 22q11.2 locus we identified elevated levels of a previously uncharacterized gene, Mirta22 as the most robust change in gene expression resulting from the 22q11.2 microdeletion, as well as the major downstream transcriptional effects of the 22q11.2-associated miRNA dysregulation.
Third, using physiologically relevant cellular models we provide unequivocal evidence that Mirta22 as well as its primary miRNA regulator (miR-185) mediate, at least in part, the effects of the 22q11.2 microdeletions on dendrite and spine formation. Although results from acute manipulations of gene expression via transient transfections of primary neurons cannot be over-interpreted quantitatively, the observed convergence and remarkable consistency of data from a multitude of experimental manipulations and approaches convincingly identified Mirta22 as a miRNA-regulated inhibitory factor of neuronal maturation that does not belong to any previously described class of developmental modulators.
Localization of Mirta22 in the Golgi apparatus and in vesicle and tubular-like extensions in dendrites is consistent with a role in membrane and protein trafficking and secretion, which is necessary for establishment and maintenance of neuronal connections (28). Mirta22 is likely to act in concert with other genes within the 22q11.2 deletion (2), including the Zdhhc8 palmitoyl-transferase, which is also located in the Golgi apparatus and has been shown to modulate dendritic and spine development (9). A potential interaction between miRNA dysregulation and altered neuronal palmitoylation is supported by previous findings (45, 21) and contributions from more than one gene to the morphological phenotypes described in this study are consistent with an oligogenic basis for the psychiatric and cognitive symptoms associated with 22q11.2 microdeletions (2). Moreover, although Mirta22 represents a major downstream effector of miR-185 dysregulation, our finding of a coordinated miR-185 targeting of Golgi apparatus-related genes suggests that Mirta22 upregulation may act, in an age and brain region specific manner, in concert with other modestly altered miR-185 targets to interfere with the Golgi-related processes required for neuronal maturation. Thus, our findings highlight a link between the Gogli apparatus and neuronal phenotypes associated with 22q11.2 micodeletions.
The reduction in the levels of Mirta22 soon after birth during periods of active neuronal maturation and synaptogenesis suggests that repression of this gene may play an important role in promoting neural circuit formation, especially in the postnatal brain, after embryonically generated neurons have migrated to their final destinations. Consistent with the notion that miRNAs function predominantly as fine-tuning regulators of the expression levels of their targets (26, 27), miR-185 and to a lesser extent other miRNAs affected by the 22q11.2 deletion appear to restrict and optimize Mirta22 expression, presumably to avoid excessive inhibition during this critical stage of synapse formation. Accordingly, sustained derepression of the gene due to genomic loss at the 22q11.2 locus may have an impact on the formation of neural circuits in early development, as well on their maintenance during adulthood. Such structural changes may result in local and long-distance disruptions of neuronal communication that may contribute to the cognitive dysfunction, psychiatric phenotypes or both (18, 46). In agreement with this prediction expression of the human orthologue of Mirta22 (C19orf63) declines in infant brains (40) and displays a spatio-temporal pattern that significantly overlaps with the one of Neuroligin-3, consistent with participation in processes related to synapse and circuit formation and maturation (47). Moreover, it has been shown that during the transition between human fetal and early postnatal development a large number of the genes reverse their direction of expression from an increase in utero to a decrease in the months after birth and that ˜40% of them are predicted miRNA targets (40). In that respect, Mirta22 is one of the first examples of a disease-related gene representative of this prominent type of transcriptional trajectory indicative of a miRNA-imposed inhibitory control over postnatal brain development.
Accumulating evidence suggests that miRNAs play an important role in the pathogenesis and pathophysiology of psychiatric disorders and cognitive dysfunction (29,14). Our work represents one of the first examples where a major downstream target of a disease-related miRNA dysregulation has been unequivocally identified and its function has been characterized. It will be of interest to determine whether elevation in Mirta22 levels affect additional aspects of neuronal structure and function. Future studies, entailing normalization of Mirta22 levels in mice compound heterozygous for Df(16)A and Mirta22 loss of function alleles should also establish which of the various behavioral (8), cognitive (48, 8) and circuit alterations (18, 46) observed in Df(16)A+/− mice can be attributed to the inhibitory influence of Mirta22 upregulation. In addition, since inhibition of Mirta22 function is predicted to promote formation of neuronal connections in the 22q11.2 deletion carriers, drugs that target this molecule may be used to ameliorate associated cognitive and psychiatric phenotypes.
Various references are cited herein, the contents of which are hereby incorporated by reference in their entireties.
This application is a continuation of International Application No. PCT/US2012/045093 filed Jun. 29, 2012, which claims priority to U.S. Provisional Application Ser. No. 61/502,661, filed Jun. 29, 2011, priority to both of which is claimed, and the contents of each of which is incorporated by reference in its entirety herein. The present invention relates to methods and compositions for enhancing neuronal connectivity.
This invention was made with government support under Grant Nos. MH067068 and MH077235 awarded by the National Institute of Mental Health. The government has certain rights in the invention.
| Number | Date | Country | |
|---|---|---|---|
| 61502661 | Jun 2011 | US |
| Number | Date | Country | |
|---|---|---|---|
| Parent | PCT/US2012/045093 | Jun 2012 | US |
| Child | 14136345 | US |
