METHODS TO ENRICH GENETICALLY ENGINEERED T CELLS

Information

  • Patent Application
  • 20220041999
  • Publication Number
    20220041999
  • Date Filed
    August 05, 2021
    4 years ago
  • Date Published
    February 10, 2022
    4 years ago
Abstract
Various embodiments are disclosed herein relate to methods for selection of a genetically engineered cell. Some embodiments relate to a cell that is produced with the methods disclosed herein.
Description
REFERENCE TO SEQUENCE LISTING

The present application is being filed along with a Sequence Listing in electronic format. The Sequence Listing is provided as a file entitled SEQUENCE_LISTING_NTBV024A.txt, created on Aug. 4, 2021, which is 70,429 bytes in size. The information in the electronic format of the Sequence Listing is incorporated herein by reference in its entirety.


BACKGROUND
Field of the Invention

The invention is in the cell therapy and/or gene therapy field. Some embodiments are also in the cell or gene engineering fields.


Description of the Related Art

Cell therapy is a therapy in which viable cells are injected, grafted or implanted into a patient in order to effectuate a medicinal effect, for example, by transplanting T-cells capable of fighting cancer cells via cell-mediated immunity in the course of immunotherapy, or grafting stem cells to regenerate diseased tissues.


SUMMARY

Some embodiments described herein relate to a method for selection of a genetically engineered cell. The method includes i) introducing into the cell at least one two-part nucleotide sequence that is operable for expression in a cell, wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate in a normal cell culture medium, and wherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding the essential protein for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed, wherein the second-part nucleotide sequence is encoding a protein of interest (e.g., a protein that is exogenous to the cell); and ii) culturing the cell in the normal cell culture medium for selection of the cell that expresses both the first-part and second-part nucleotide sequences.


Some embodiments described herein relate to a method for selection of a genetically engineered cell. The method includes i) introducing at least one two-part nucleotide sequence that is operable for expression in a cell, wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate under the selected culture conditions, and wherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a protein allowing for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed, wherein the second-part nucleotide sequence is encoding a protein that is exogenous to the cell; and ii) culturing the cell under in vitro propagation conditions that allow enrichment of the cell that expresses both the first-part and second-part nucleotide sequences.


Some embodiments described herein relate to a method for enrichment of a genetically engineered cell. The method includes: i) decreasing activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions; ii) introducing at least a two-part nucleotide sequence that is operable for expression in the cell and comprises a first-part nucleotide sequence encoding the first protein and a second-part nucleotide sequence encoding a second protein to be expressed, wherein the second-part protein is exogenous to the cell, and iii) culturing the cell under normal in vitro propagation conditions for enrichment of the cell that expresses both the first protein and second protein.


Some embodiments described herein relate to a cell that includes i) endogenous dihydrofolate reductase (DHFR) being suppressed to a level that the cell cannot survive and/or proliferate in a normal cell culture medium, and ii) at least a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding DHFR and a second-part nucleotide sequence encoding a neo-antigen T-cell receptor complex.


Some embodiments described herein relate to a method for enrichment of a genetically engineered cell. The method includes i) introducing at least a two-part nucleotide sequence that is operable for expression in the cell and comprises a first-part nucleotide sequence encoding the first protein providing the cell with resistance to selective pressure and a second-part nucleotide sequence encoding a second protein to be expressed, wherein the second-part protein is exogenous to the cell, and ii) culturing the cell in cell culture medium containing at least one supplement leading to enrichment of the cell that expresses both the first protein and the second protein.


Some embodiments described herein relate to a method for enrichment of a genetically engineered T cell. The method includes i) introducing a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor complex or Chimeric antigen receptor in the T cell by integration of the two-part nucleotide sequence downstream of the TRA or TRB promotor, and ii) culturing the cell in cell culture medium containing methotrexate leading to enrichment of the cell that expresses both the first protein and the second protein.


Some embodiments described herein relate to a method for enrichment of a T cell engineered to express an exogenous T cell receptor gene. The method includes i) knocking-out an endogenous TRBC gene from its locus using a first CRISPR/Cas9 RNP; ii) knocking-in, using a second CRISPR/Cas9 RNP, into the endogenous TRBC locus a first-part nucleotide sequence encoding a methotrexate-resistant DHFR gene and a second-part nucleotide sequence comprising a therapeutic TCR gene, wherein both nucleotide sequences are operably linked allowing for expression from the endogenous TRBC promotor; and iii) culturing the cells in cell culture medium containing methotrexate leading to enrichment of T cells that express both the therapeutic TCR and the methotrexate-resistant DHFR gene.


Some embodiments described herein relate to a T cell, which include i) an endogenous dihydrofolate reductase (DHFR) being suppressed by the presence of methotrexate to a level that the cell cannot survive and/or proliferate, and ii) at least a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor.


Some embodiments described herein relate to a T cell, or a method for enrichment of a T cell engineered to express an exogenous gene, which include i) an endogenous DHFR being suppressed by the presence of methotrexate to a level that the cell cannot survive and/or proliferate, and ii) at least two nucleotide sequences, including a first nucleotide comprising a nucleotide sequence encoding a non-functional portion of a methotrexate-resistant DHFR protein fused to a first binding domain and a second nucleotide comprising a nucleotide sequence encoding a non-functional portion of a methotrexate-resistant DHFR protein fused to a second binding domain such that when both nucleotides are expressed, a functional methotrexate-resistant DHFR is present and is capable of facilitating selection of cells containing both the first and second nucleotides. Any of the nucleotide sequences may contain two or more parts such that a first part comprises a nucleotide sequence encoding a non-functional portion of a methotrexate-resistant DHFR protein fused to a binding domain and a second part comprises a nucleotide sequence encoding an exogenous gene. For certain methods of selection according to these embodiments, the T cell is then cultured in a cell culture medium containing methotrexate leading to enrichment of the cell that comprises the at least two nucleotide sequences.


Some embodiments described herein relate binding domains for restoring function to a DHFR protein split into multiple non-functional portions. The binding domains, when fused to complementary non-functional portions of a DHFR protein, can restore DHFR protein function. Binding domains can be native binding domains, engineered binding domains that do not interact with native proteins, or inducible binding domains.


Also disclosed herein is a method for the selection of a genetically engineered cell. In some embodiments, the method comprises introducing at least two, two-part nucleotide sequences that are operable for expression in a cell. In some embodiments, the cell has an essential protein for survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate. In some embodiments, the first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a protein to be expressed. In some embodiments, the second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a protein to be expressed. In some embodiments, when both the first and second fusion proteins are expressed together in a cell, the function of the essential protein for the survival and/or proliferation is restored. In some embodiments, the method further comprises culturing the cell under conditions leading to the selection of the cell that expresses both the first and second two-part nucleotide sequences.


In some embodiments, the essential protein is a DHFR protein. In some embodiments, the second-part nucleotide sequence of either the first or second two-part nucleotide sequences is exogenous to the cell. In some embodiments, the second-part nucleotide sequence of either the first or second two-part nucleotide sequence is a TCR. In some embodiments, the first and second binding domains are derived from GCN4. In some embodiments, the first and second binding domains are derived from FKBP12. In some embodiments, the FKBP12 has an F36V mutation. In some embodiments, the first binding domain is derived from JUN and the second binding domains is derived from FOS. In some embodiments, the first binding domain and second binding domain have complementary mutations that preserve binding to each other. In some embodiments, neither the first binding domain nor the second binding domain bind to a native binding partner. In some embodiments, each of the first binding domain and second binding domain have between 3 and 7 complementary mutations. In some embodiments, the first binding domain and second binding domain each have 3 complementary mutations. In some embodiments, the first binding domain and second binding domain each have 4 complementary mutations. In some embodiments, the restoration of the function of the essential protein is induced, optionally by AP1903. In some embodiments, the culturing step is done in the presence of methotrexate.


Also disclosed herein is a method for enrichment of a genetically engineered cell. In some embodiments, the method comprises decreasing activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions. In some embodiments, the method further comprises introducing at least two two-part nucleotide sequences that are operable for expression in a cell. In some embodiments, the first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a protein to be expressed. In some embodiments, the second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a protein to be expressed. In some embodiments, when both the first and second fusion proteins are expressed together in a cell, the function of the essential protein for the survival and/or proliferation is restored. In some embodiments, the method further comprises culturing the cell under in vitro propagation conditions that lead to the enrichment of the cell that expresses both the first fusion protein and second fusion protein.


In some embodiments, the essential protein is a DHFR protein. In some embodiments, the second-part nucleotide sequence of either the first or second two-part nucleotide sequences is exogenous to the cell. In some embodiments, the second-part nucleotide sequence of either the first or second two-part nucleotide sequence is a TCR. In some embodiments, the first and second binding domains are derived from GCN4. In some embodiments, the first and second binding domains are derived from FKBP12. In some embodiments, the FKBP12 has an F36V mutation. In some embodiments, the first binding domain is derived from JUN and the second binding domains is derived from FOS. In some embodiments, the first binding domain and second binding domain have complementary mutations that preserve binding to each other. In some embodiments, neither the first binding domain nor the second binding domain bind to a native binding partner. In some embodiments, each of the first binding domain and second binding domain have between 3 and 7 complementary mutations. In some embodiments, the first binding domain and second binding domain each have 3 complementary mutations. In some embodiments, the first binding domain and second binding domain each have 4 complementary mutations. In some embodiments, the restoration of the function of the essential protein is induced, optionally by AP1903. In some embodiments, the culturing step is done in the presence of methotrexate.


Some embodiments provided herein involve a method for selection or enrichment of a genetically engineered cell. In some embodiments, the method comprises introducing into a cell at least one two-part nucleotide sequence capable of expressing both the first-part and second-part nucleotide sequences in the cell. The cell has an essential protein for the survival and/or proliferation that is reduced to a level that the cell cannot survive and/or proliferate in a normal cell culture medium. The at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, and the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding the essential protein for the survival and/or proliferation, or a variant thereof, and a second-part nucleotide sequence encoding a protein to be expressed. The second-part nucleotide sequence encodes a protein of interest. The method further comprises culturing the cell in the normal cell culture medium without a pharmacologic exogenous selection pressure for selection or enrichment of the cell that expresses both the first-part and second-part nucleotide sequences.


In some embodiments, the method comprises reducing the level of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions, introducing into the cell at least a two-part nucleotide sequence that is capable of expressing both the first-part and second-part nucleotide sequences in the cell and comprises a first-part nucleotide sequence encoding the first protein, or a variant thereof, and a second-part nucleotide sequence encoding a second protein to be expressed. The at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome. The second-part protein is a protein of interest. The method further comprises culturing the cell under normal in vitro propagation conditions without a pharmacologic exogenous selection pressure for enrichment of the cell that expresses both the first protein and second protein.


In some embodiments, the method comprises introducing into a cell at least one two-part nucleotide sequence capable of expressing both the first-part and second-part nucleotide sequences in the cell. The cell has the functional activity of an essential protein for the survival and/or proliferation that is reduced such that the cell cannot survive and/or proliferate in a normal cell culture medium. The at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome. The at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encodes a first protein that provides a substantially equivalent function to the essential protein for the survival and/or proliferation and a second-part nucleotide sequence encodes a second protein to be expressed. The second protein that is a protein of interest. The method further comprises culturing the cell in cell culture medium containing at least one supplement leading to enrichment or selection of the cell that expresses both the first protein and the second protein.


In some embodiments, the method comprises reducing the functional activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions; introducing into the cell at least a two-part nucleotide sequence that is capable of expressing both the first-part and second-part nucleotide sequences in the cell and comprises a first-part nucleotide sequence encodes a first protein that provides a substantially equivalent function to and a second-part nucleotide sequence encoding a second protein to be expressed. The at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, and the second protein is a protein of interest. The method further comprises culturing the cell in cell culture medium containing at least one supplement leading to selection or enrichment of the cell that expresses both the first protein and the second protein.


In some embodiments, the method comprises introducing into a cell at least two two-part nucleotide sequences capable of expressing both a first-part and a second-part nucleotide sequence in the cell. The cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate. The first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a first protein of interest. The second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a second protein of interest. When both the first and second fusion proteins are expressed together in a cell, the function of the essential protein for the survival and/or proliferation is restored. The method further comprises culturing the cell under conditions leading to the selection of the cell that expresses both the first and second two-part nucleotide sequences.


In some embodiments, the method comprises suppressing at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions, and introducing at least two two-part nucleotide sequences that are capable of being expressed in the cell. The first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a first protein of interest. The second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a second protein of interest. When both the first and second fusion proteins are expressed together in a cell, the function of the essential protein for the survival and/or proliferation is restored. The method further comprises culturing the cell under in vitro propagation conditions that lead to the enrichment of the cell that expresses both the first fusion protein and second fusion protein.


In some embodiments, the method comprises introducing at least one two-part nucleotide sequence that is operable for expression in a cell. The cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate, and the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding the essential protein for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed. The second-part nucleotide sequence is encoding a protein that is exogenous to the cell. The method further comprises culturing the cell under conditions leading to the selection of the cell that expresses both the first-part and second-part nucleotide sequences.


In some embodiments, the method comprises decreasing activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions, introducing at least a two-part nucleotide sequence that is operable for expression in the cell and comprises a first-part nucleotide sequence encoding the first protein and a second-part nucleotide sequence encoding a second protein to be expressed. The second-part protein is exogenous to the cell, and culturing the cell under in vitro propagation conditions that lead to the enrichment of the cell that expresses both the first protein and second protein.


Also disclosed herein is a cell that is made according to any of the methods of the present disclosure.


Also disclosed herein is a method for enrichment of a genetically engineered T cell. In some embodiments, the method comprises introducing a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor complex or Chimeric antigen receptor in the T cell by integration of the two-part nucleotide sequence downstream of the TRA or TRB promotor, and culturing the cell in cell culture medium containing methotrexate leading to enrichment of the cell that expresses both the first protein and the second protein.


Also disclosed herein is a method for enrichment of a T cell engineered to express an exogenous T cell receptor gene. In some embodiments, the method comprises knocking-out an endogenous TRBC gene from its locus using a first CRISPR/Cas9 RNP, knocking-in, using a second CRISPR/Cas9 RNP, into the endogenous TRBC locus a first-part nucleotide sequence encoding a methotrexate-resistant DHFR gene and a second-part nucleotide sequence comprising a therapeutic TCR gene, wherein both nucleotide sequences are operably linked allowing for expression from the endogenous TRBC promotor, and culturing the cells in cell culture medium containing methotrexate leading to enrichment of T cells that express both the therapeutic TCR and the methotrexate-resistant DHFR gene.


Also disclosed herein is a T cell. In some embodiments, the T cell comprises an endogenous dihydrofolate reductase (DHFR) being suppressed by the presence of methotrexate to a level that the cell cannot survive and/or proliferate, and at least a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor.


In some embodiments, the T cell comprises a knock-out of endogenous dihydrofolate reductase (DHFR), and at least one two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a DHFR protein, or variant thereof, and a second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor.


In some embodiments, the T cell comprises an endogenous dihydrofolate reductase (DHFR) being suppressed by the presence of methotrexate to a level that the cell cannot survive and/or proliferate, and at least two two-part nucleotide sequences. The first two-part nucleotide sequence comprises a first first-part nucleotide sequence encoding a non-functional or dysfunctional portion of a DHFR protein, or variant thereof, and a first second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor. The second two-part nucleotide sequence comprises a second first-part nucleotide sequence encoding a non-functional or dysfunctional portion of a DHFR protein, or variant thereof, and a second second-part nucleotide sequence encoding a protein of interest operably expressed from the endogenous B2M promotor, and the cell has DHFR activity.


These and other features, aspects, and advantages of the present invention will become better understood with reference to the following description and appended claims.





BRIEF DESCRIPTION OF THE DRAWINGS


FIG. 1 shows some embodiments involving a DFHR involved pathway.



FIG. 2 shows the genetic construct of some embodiments.



FIG. 3 depicts the results of a TIDE (Tracking of Indels by Decomposition) analysis to determine the knockout efficiency of sgRNA sgDHFR-1 in human T cells from two donors (75% and 18% for BC23 and BC26, respectively).



FIG. 4 depicts the results of a TIDE analysis to determine the knockout efficiency of sgRNA sgDHFR-2 in human T cells from two donors (34% and 75% for BC23 and BC26, respectively).



FIG. 5 depicts the results of a FACS analysis to check NY-ESO-1 1G4 TCR knockin efficiency in T cells from two donors at day 6 post-electroporation.



FIG. 6 depicts the results of a FACS analysis to check NY-ESO-1 1G4 TCR knockin efficiency in T cells from two donors at day 10 post-electroporation.



FIG. 7 provides a left panel that shows that TCR expression levels are comparable between 1G4-TCR KI (knockin) T cells and 1G4-TCR-DHFR KI+DHFR KO T cells; right panel shows that the total number of TCR knockin cells are comparable between 1G4-TCR knockin and 1G4-TCR-DHFR KI+DHFR KO T cells in both donor T cells at day 12 post electroporation.



FIG. 8 depicts the results of a FACS analysis to check NY-ESO-1 1G4 TCR knockin efficiency in T cells from four donors (BC29, BC30, BC31, and BC32) at day 5 post electroporation.



FIG. 9 provides the quantification data of FIG. 8.



FIG. 10 provides a left panel showing that TCR expression levels are comparable between 1G4-TCR KI and 1G4-TCR-DHFR KI+DHFR KO cells; right panel shows that the total number of TCR knockin cells for the 1G4-TCR knockin condition is higher compared to either the 1G4-DHFR-KI T cells or 1G4-TCR-DHFR KI+DHFR KO T cells in four donor T cells.



FIG. 11 provides the results of using MTX-fluorescein labeling to determine DHFR expression.



FIG. 12 left panel shows the method described in FIG. 11 to screen for efficient guide RNAs which target DHFR; right panel, use of the method described in FIG. 11 to screen for efficient siRNAs which target DHFR.



FIG. 13A are FACS plots showing T cells with knockin of the control repair template 1G4 KI, FIG. 13B are FACS plots showing T cells with knockin of the repair template 1G4-DHFRm KI, and FIG. 13C are bar charts showing the quantification of FIG. 13A and FIG. 13B with three donors (BC37, BC38, and BC39) and two technical replicates.



FIG. 14 are bar plots showing the T cell expansion of the two knockin conditions described on FIG. 13.



FIG. 15 shows FACS analysis of the proportion of CD4+ cells in the two knockin conditions described on FIG. 13 by staining with an anti-CD4 antibody.



FIG. 16 shows FACS analysis of the phenotype of TCR knockin cells by staining with an anti-CD45RA and an anti-CD62L antibody.



FIG. 17 shows FACS analysis of the phenotype of TCR knockin cells by staining with an anti-CD27 and an anti-CD28 antibody.



FIG. 18 shows colony formation assay to determine the cytolytic capacity of T cells by co-culturing with tumor cells (donor BC37).



FIG. 19 shows tumor-T cell co-culture assay with T cells derived from two additional donors (BC38 and BC39).



FIG. 20 are bar plots showing the IFNγ production capacity of T cells when stimulated with tumor cells.



FIG. 21 are bar plots showing the IFNγ expression levels (determined by Mean Fluorescence Intensity, MFI) of T cells when stimulated with tumor cells.



FIG. 22 are bar plots showing the IL2 production capacity of T cells when stimulated with tumor cells. Left panel: the proportion of IL2-producing cells. Right panel: expression levels of IL2-producing cells.



FIG. 23 are histograms showing the T cell proliferation capacity when stimulated with tumor cells.



FIG. 24 is a diagram of in-frame exonic integration into a gene locus to enable expression from the endogenous promotor, the endogenous splice sites, and the endogenous termination signal.



FIG. 25 is a diagram of in-frame exonic integration into a gene locus to enable expression from the endogenous promotor, the endogenous splice sites, and an exogenous termination signal.



FIG. 26 is a diagram of intronic integration into a gene locus to enable expression from the endogenous promotor, an exogenous splice acceptor site, and an exogenous termination signal.



FIG. 27A shows a diagram of knocking out of an essential gene. FIG. 27B shows a diagram of knocking in a two-part nucleotide sequence that encodes an altered essential protein and a second protein.



FIG. 28 shows the FACS results of BC45 and BC46 double transduction.



FIG. 29 shows the results of MTX selection of BC 45 cells.



FIG. 30 shows the results of MTX selection of BC 46 cells.



FIG. 31 shows the results of selecting BC 45 cells in higher MTX concentration.



FIG. 32 shows the results of selecting BC 46 cells in higher MTX concentration.



FIG. 33 shows some embodiments of selection methods for genetically engineered cells.



FIG. 34 shows the sequence of SEQ ID NO: 1, which is a human DHFR wildtype protein sequence.



FIG. 35 shows the sequence of SEQ ID NO: 2, which is a human MTX-resistant DHFR mutant protein sequence.



FIG. 36 shows the sequence of SEQ ID NO: 3, which is a DNA sequence that encodes a wildtype human DHFR.



FIG. 37 shows the sequence of SEQ ID NO: 4, which is a codon-optimized and nuclease-resistant DNA sequence that encodes a wildtype human DHFR.



FIG. 38 shows the sequence of SEQ ID NO: 5, which is a codon-optimized DNA sequence that encodes a MTX-resistant human DHFR mutant.



FIG. 39 shows a schematic for site-specific integration of TCRs.



FIG. 40 shows sample data regarding the editing of T cells with a TCR in the absence of selection.



FIG. 41 shows a schematic of an embodiment of an mDHFR-MTX selection strategy.



FIG. 42 shows a summary comparison of TCR-edited T cells with and without use of an embodiment of an mDHFR-MTX selection strategy.



FIG. 43A-43B show the FACS results for JunMUT3AA-FosMUT3AA based split-DHFR selection after 2 days of methotrexate.



FIGS. 44A-44D show the FACS results for JunMUT3AA-FosMUT3AA and JunMUT4AA-FosMUT4AA based split-DHFR selection after 10 days of methotrexate.



FIGS. 45A-45B show the FACS results for FKBP12F36V based split-DHFR selection after 8 days of methotrexate.



FIGS. 46A-46B show the FACS results comparing FKBP12F36V based split-DHFR selection and JunMUT4AA-FosMUT4AA based split-DHFR selection after 6 days of methotrexate.



FIG. 47A shows the FACS results comparing JunMUT3AA-FosMUT3AA and Jun-Fos based CD90.2 and Ly-6G selection after no treatment or 100 nM methotrexate treatment for four days.



FIG. 47B shows the FACS results comparing Jun-FosMUT3AA and JunMUT3AA-Fos based CD90.2 and Ly-6G selection after no treatment or 100 nM methotrexate treatment for four days.



FIG. 48 is a bar chart showing fold-enrichment of engineered T cells in Donor A and Donor B following infection with vector pair JUNWT-mDHFR_A+FOSWT-mDHFR_B, JUNMUT3AA-mDHFR_A+FOSMUT3AA-mDHFR_B, JUNWT-mDHFR_A+FOSMUT3AA-mDHFR_B, or JUNMUT3AA-mDHFR_A+FOSWT-mDHFR_B.



FIG. 49 is a bar chart showing fold-enrichment of engineered T cells in Donor A and Donor B following 100 nM methotrexate treatment for six days, four days after infection with vector pair JUNWT-mDHFR_A+FOSWT-mDHFR_B, JUNMUT3AA-mDHFR_A+FOSMUT3AA-mDHFR_B, JUNWT-mDHFR_A+FOSMUT3AA-mDHFR_B, or JUNMUT3AA-mDHFR_A+FOSWT-mDHFR_B.



FIG. 50 is a bar chart showing fold-enrichment of engineered T cells in Donor A and Donor B following 100 nM methotrexate treatment for six days, four days after infection with vector pair JUNWT-mDHFR_A+FOSWT-mDHFR_B, JUNMUT4AA-mDHFR_A+FosMUT4AA-mDHFR_B, JUNWT-mDHFR_A+FOSMUT4AA-mDHFR_B, or JUNMUT4AA-mDHFR_A+FOSWT-mDHFR_B.



FIGS. 51A and 51B show shows the FACS results of double engineered T cells from donor A and B, using CD90.2 and Ly-6G selection after no treatment or 100 nM methotrexate treatment for six days, four days after infection with either sJUN-mDHFR_A+sFOS-mDHFR_B or pair sJUNMUT8AA-mDHFR_A+sFOSMUT8AA-mDHFR_B, sJUN-mDHFR_A+sFOSMUT8AA-mDHFR_B, or sJUNMUT8AA-mDHFR_A+sFOS-mDHFR_B.



FIG. 52 is a bar chart showing the quantification of fold enrichment of engineered T cells, as generated by the FACS plot from FIGS. 51A-51B.



FIG. 53 is a bar chart showing fold-enrichment of engineered T cells in Donor A and Donor B following infection with vector pair FKBP12F36V-mDHFR_A+FKBP12F36V-mDHFR_B, four hours of either no treatment or 10 nM AP1903, and six days of treatment with 100 nM methotrexate.



FIG. 54 is a bar chart showing the percentage of knock-out cells in human primary T cells treated with one of five Cas9 RNPs targeting the B2M locus.





DETAILED DESCRIPTION

In the Summary Section above and the Detailed Description Section, and the claims below, reference is made to particular features of the invention. It is to be understood that the disclosure of the invention in this specification includes all possible combinations of such particular features. For example, where a particular feature is disclosed in the context of a particular aspect or embodiment of the invention, or a particular claim, that feature can also be used, to the extent possible, in combination with and/or in the context of other particular aspects and embodiments of the invention, and in the invention generally.


The precise introduction of exogenous DNA sequences at a specific genomic site, also known as gene knock-in, generally requires two steps: (1) the introduction of a DNA double-strand break at the genomic site by a nuclease, and (2) the repair of that DNA break using a homologous repair template by the homology-directed repair (HDR) pathway. This process is generally inefficient because the enzymes that are required for HDR are only active during the S and G2 phases of the cell cycle. That is, gene knock-in is largely restricted to dividing cells. Given the overall low efficiency of the gene knock-in process, an approach that can select and enrich those cells that have successfully undergone the gene-editing procedure can be useful.


To allow for the enrichment of cells with successful knock-in of a therapeutic gene construct, a selective pressure is useful to ensure that primarily cells with the knock-in event can survive, while those without the knock-in event die.


Various embodiments described herein relate to methods for selection of a genetically engineered cell. In those methods, a genetically engineered cell is selected by the introduction of at least one two-part nucleotide sequence that encodes at least one protein that is exogenous to the cell (and for example is introduced for therapeutic purposes) and another protein that restores the function of an essential protein that is needed for the cell to survive and/or proliferate and has been suppressed.


The function of an essential protein that is needed for the cell to survive and/or proliferate may be suppressed by nucleases or protein inhibitors; the suppression can be permanent or transient, and the suppression can be at the nucleotide level or protein level.


The function of an essential protein that is needed for the cell to survive and/or proliferate may be suppressed by an exogenous selective pressure, for example induced by small molecule mediated inhibition.


The essential protein can be restored by encoding the essential protein in the two-part nucleotide sequence. The encoded essential protein may be genetically engineered so that its nucleotide sequence is nuclease resistant or the protein is protein inhibitor resistant. As such, cells with successful re-introduction of the essential protein will gain a strong survival advantage over the wild type cells and become enriched in time.


The essential protein may be introduced as one continuous sequence or split in distinct domains to allow genetic engineering of the cell with multiple exogenous proteins.


In addition, various embodiments described herein relate to a cell that is generated in the process using the methods described herein for selection of a genetically engineered cell.


Some embodiments described herein relate to a method for selection of a genetically engineered cell. The method includes i) introducing at least one two-part nucleotide sequence that is operable for expression in a cell, wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate under the selected culture conditions, and wherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a protein allowing for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed, wherein the second-part nucleotide sequence is encoding a protein that is exogenous to the cell; and ii) culturing the cell under in vitro propagation conditions that allow enrichment of the cell that expresses both the first-part and second-part nucleotide sequences.


Some embodiments described herein relate to a method for selection of a genetically engineered cell. The method includes i) suppressing an essential protein in a cell to a level that said cell cannot survive and/or proliferate in normal culture medium; ii) introducing at least one two-part nucleotide sequence that is operable for expression in a cell, wherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a protein allowing for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed; iii) culturing the cell in normal culture medium allow enrichment of the cell that expresses both the first-part and second-part nucleotide sequences.


Some embodiments described herein relate to a method for selection of a genetically engineered cell. The method includes i) suppressing an essential protein in a cell to a level that said cell cannot survive and/or proliferate by supplementation of the cell culture medium with at least one compound; ii) introducing at least one two-part nucleotide sequence into the cell by targeted integration into a genomic locus to achieve operable expression in the cell from a cell-endogenous promotor, wherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a protein allowing for the survival and/or proliferation of the cell in the supplemented medium and a second-part nucleotide sequence encoding a protein to be expressed; iii) culturing the cell in culture medium with at least one compound to allow enrichment of the cell that expresses both the first-part and second-part nucleotide sequences.


Some embodiments described herein relate to a method for selection of a genetically engineered cell. The method includes

    • i) introducing at least two two-part nucleotide sequences that are operable for expression in a cell,
    • wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate under the selected culture conditions,
    • wherein the first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first portion of a protein allowing for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed,
    • wherein the second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second portion of a protein allowing for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed,
    • wherein the portions of the protein can form a functional protein when co-expressed in the cell;
    • ii) culturing the cell under in vitro propagation conditions that allow enrichment of the cell that expresses both the first-part and second-part nucleotide sequences of the at least two two-part nucleotide sequences.


Some embodiments are shown in FIG. 33. The novel aspect of these embodiments include:

    • Application for TCRs and CARs
    • Use in T cells
    • Use with site-specific integration into the TCR gene loci
    • Use for cancer treatment


Some embodiments described herein relate to a T cell which include i) an endogenous DHFR being suppressed by the presence of methotrexate to a level that the cell cannot survive and/or proliferate, and ii) at least two nucleotide sequences, including a first nucleotide comprising a nucleotide sequence encoding a non-functional portion of a methotrexate-resistant DHFR protein fused to a first binding domain and a second nucleotide comprising a nucleotide sequence encoding a non-functional portion of a methotrexate-resistant DHFR protein fused to a second binding domain such that when both nucleotides are expressed, a functional methotrexate-resistant DHFR is present and is capable of facilitating selection of cells containing both the first and second nucleotides.


Some embodiments described herein relate to a method for selection of a genetically engineered cell. The method includes

    • i) introducing at least two two-part nucleotide sequences that are operable for expression in a cell,
    • wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate under the selected culture conditions,
    • wherein the first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a fusion protein comprising a first binding domain fused to a first non-functional portion of a protein allowing for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed,
    • wherein the second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a fusion protein comprising a second binding domain fused to a second non-functional portion of a protein allowing for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed,
    • wherein the first and second binding domains are capable of binding to each other in the cell,
    • wherein the first and second non-functional portions of the protein can form a functional protein when co-expressed in the cell;
    • ii) culturing the cell under in vitro propagation conditions that allow enrichment of the cell that expresses both the first-part and second-part nucleotide sequences of the at least two two-part nucleotide sequences.


Some embodiments described herein relate to binding domains for restoring function to a DHFR protein split into multiple non-functional portions. The binding domains, when fused to complementary non-functional portions of a DHFR protein, can restore DHFR protein function. Binding domains can be native binding domains, engineered binding domains that do not interact with native proteins, or inducible binding domains.


Some embodiments described herein relate to a method for selection or enrichment of a genetically engineered cell. It will be understood that the terms “selection” and “enrichment” refer to the overall increased ratio of a desirable genetically engineered cell in a population of cells. This therefore can include, for example, increasing the overall number of genetically engineered cells, decreasing the number of any other cells present in the population, purifying the genetically engineered cells, any combination thereof, and other similar approaches.


In some embodiments, the method comprises introducing into a cell at least one two-part nucleotide sequence capable of expressing both the first-part and second-part nucleotide sequences in the cell. In some embodiments, the cell has an essential protein for the survival and/or proliferation that is reduced to a level that the cell cannot survive and/or proliferate in a normal cell culture medium. The at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, and the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding the essential protein for the survival and/or proliferation, or a variant thereof, and a second-part nucleotide sequence encoding a protein to be expressed. The second-part nucleotide sequence encodes a protein of interest. The method further comprises culturing the cell in the normal cell culture medium without a pharmacologic exogenous selection pressure for selection or enrichment of the cell that expresses both the first-part and second-part nucleotide sequences.


In some embodiments, the method comprises reducing the level of at least a first protein that functions and/or is essential the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions, introducing into the cell at least a two-part nucleotide sequence that is capable of expressing both the first-part and second-part nucleotide sequences in the cell and comprises a first-part nucleotide sequence encoding the first protein, or a variant thereof, and a second-part nucleotide sequence encoding a second protein to be expressed.


It will be understood by those skilled in the art that an “essential” protein may be any protein that influences growth, replication, cell cycle, gene regulation (including DNA repair, transcription, translation, and replication), stress response, metabolism, apoptosis, nutrient acquisition, protein turnover, cell surface integrity, essential enzyme activity, survival, or any combination thereof in a given cell.


In some embodiments, the reduction in level of the essential protein is permanent. In some embodiments, the reduction in level of the essential protein is transient, or non-permanent. In some embodiments, the reduction in level of the essential protein is inducible. In some embodiments, the reduction in level of the essential protein influences the survival and/or proliferation of a cell through a single cell cycle time period. In some embodiments, the reduction in level of the essential protein influences the survival and/or proliferation of a cell for a period of at least about 1 minute, at least about 10 minutes, at least about 30 minutes, at least about 60 minutes, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 20 hours, at least about 1 day, at least about 2 days, at least about 4 days, at least about 1 week, at least about 2 weeks, at least about 1 month, or at least about 2 months. In some embodiments, the reduction in level of the essential protein results in a complete halt of proliferation. the reduction in level of the essential protein results in a partial halt of proliferation. In some embodiments, proliferation is halted by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100%. In some embodiments, the reduction in level of the essential protein results in complete cell death. In some embodiments, the reduction in level of the essential protein initiates cell death in all cells in a population. the reduction in level of the essential protein initiates cell death in some cells within a population. In some embodiments, cell death (or the reduced rate of survival) is increased by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% in a population of cells. In some embodiments, the reduction in level of the essential protein comprises a knock-out of the gene encoding the essential protein. In some embodiments, the reduction in level of the essential protein comprises a knock-down of the gene encoding the essential protein. In some embodiments, the reduction in level of the essential protein comprises a knock-in of a gene capable of inhibiting the essential protein. In some embodiments, the knock-out and/or knock-down is mediated by CRISPR Ribonucleoprotein (RNP), TALEN, MegaTAL, or any other nucleases. In some embodiments, the transient suppression is through siRNA, miRNA, or CRISPR interference (CRISPRi). It will be understood to those skilled in the art that knock-outs, knock-downs, and other methods of protein level reduction may be performed using any conventional method, including restriction enzymes and selection cassettes, selective transcription inhibition, selective translation inhibition, and driving protein targeting for degradation. In some embodiments, the reduction in level of the essential protein comprises transient reduction in the level of the essential protein at the RNA level. In some embodiments, the RNA of the essential protein is reduced by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100%. In some embodiments, the cell is a T cell, NK cell, NKT cell, iNKT cell, hematopoietic stem cell, mesenchymal stem cell, iPSC, neural precursor cell, a cell type in retinal gene therapy, or any other cell.


In some embodiments, the at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, and the second-part protein is a protein of interest. In some embodiments, the first-part nucleotide sequence is altered in nucleotide sequence to achieve nuclease, siRNA, miRNA, or CRISPRi resistance. In some embodiments, the first-part nucleotide sequence is altered in nucleotide sequence to achieve at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% nuclease, siRNA, miRNA, or CRISPRi resistance. In some embodiments, the first part nucleotide sequence encodes a protein having an identical amino acid sequence to the essential first protein. In some embodiments, the first part nucleotide sequence encodes a protein having an amino acid sequence that is at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to the essential first protein. In some embodiments, the first-part nucleotide sequence is altered to encode an altered protein that does not have an identical amino acid sequence to the first protein. In some embodiments, the altered protein has specific features that the first protein does not have. In some embodiments, specific features include, but are not limited to, one or more of the following: reduced activity, increased activity, and altered half-life. In some embodiments, activity of the altered protein is altered by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% compared to the first protein. In some embodiments, the half-life of the altered protein is reduced compared to the first protein. In some embodiments, the half-life of the altered protein is extended compared to the first protein. In some embodiments, the half-life of the altered protein is extended or reduced at least about 1.5-fold, at least about 2-fold, at least about 5-fold, at least about 10-fold, at least about 20-fold, at least about 50-fold, or at least about 100-fold compared to the first protein. In some embodiments, both the first-part and the second-part nucleotide sequences are driven by a same promoter. In some embodiments, the first-part and the second-part nucleotide sequences are driven by different promoters. the second-part nucleotide sequence comprises at least a therapeutic gene.


It will be understood to those skilled in the art that a “therapeutic” gene or protein can be any gene or protein that is useful in the treatment, prevention, prophylaxis, palliation, amelioration, or cure of any disease or disorder.


In some embodiments, the second-part nucleotide sequence encodes a neo-antigen T-cell receptor complex (TCR) containing a TCR alpha chain and a TCR beta chain. In some embodiments, the essential or first protein is dihydrofolate reductase (DHFR), Inosine Monophosphate Dehydrogenase 2 (IMPDH2), O-6-Methylguanine-DNA Methyltransferase (MGMT), Deoxycytidine kinase (DCK), Hypoxanthine Phosphoribosyltransferase 1 (HPRT1), Interleukin 2 Receptor Subunit Gamma (IL2RG), Actin Beta (ACTB), Eukaryotic Translation Elongation Factor 1 Alpha 1 (EEF1A1), Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH), Phosphoglycerate Kinase 1 (PGK1), or Transferrin Receptor (TFRC). In some embodiments, the first-part nucleotide sequence comprises a nuclease-resistant or siRNA-resistant DHFR gene, and the second-part nucleotide sequence comprises a TRA gene and a TRB gene. In some embodiments, the first-part nucleotide sequence comprises a nuclease-resistant or siRNA-resistant DHFR gene, and the second-part nucleotide sequence comprises a TRA gene and a TRB gene. In some embodiments, the TRA, TRB, and DHFR genes are separated by an at least one linker. In some embodiments, the at least one linker is an at least one self-cleaving 2A peptide and/or an at least one IRES element. In some embodiments, the DHFR, TRA, and TRB genes are driven by an endogenous TCR promoter or any other suitable promoters including, but not limited to the following promoters: TRAC, TRBC1/2, DHFR, EEF1A1, ACTB, B2M, CD52, CD2, CD3G, CD3D, CD3E, LCK, LAT, PTPRC, IL2RG, ITGB2, TGFBR2, PDCD1, CTLA4, FAS, TNFRSF1A (TNFR1), TNFRSF10B (TRAILR2), ADORA2A, BTLA, CD200R1, LAG3, TIGIT, HAVCR2 (TIM3), VSIR (VISTA), IL10RA, IL4RA, EIF4A1, FTH1, FTL, HSPA5, and PGK1. In some embodiments, the two-part nucleotide sequence is integrated into the genome of the cell. In some embodiments, the at least one two part nucleotide sequence becomes operable for expression when inserted into the pre-determined site in the target genome and both the first-part and second-part nucleotide sequences are driven by a promoter in the target genome. In some embodiments, the integration is through nuclease-mediated site-specific integration, transposon-mediated gene delivery, or virus-mediate gene delivery. In some embodiments, the nuclease-mediated site-specific integration is through CRISPR RNP, optionally a CRISPR/Cas9 RNP. In some embodiments, the method further comprises culturing the cell under normal in vitro propagation conditions without a pharmacologic exogenous selection pressure for enrichment of the cell that expresses both the first protein and second protein.


It will be understood to those skilled in the art that “normal in vitro propagation conditions” encompass typical conditions in which a cell, cell line, or tissue sample can be maintained, but which do not include a variable (e.g., process or ingredient) that has intentionally been left out or added to drive the methods as provided herein.


In some embodiments, the method further comprises using the Split intein system. In some embodiments, the introduced two-part nucleotide sequence is not integrated into the genome of the cell. In some embodiments, a CRISPR RNP that targets an endogenous TCR Constant locus, the first-part nucleotide sequence encoding a nuclease-resistant DHFR gene, and the second-part nucleotide sequence encoding a neo-antigen TCR are delivered to the cell. In some embodiments, the endogenous TCR constant locus can be a TCR alpha Constant (TRAC) locus or a TCR beta Constant (TRBC) locus. In some embodiments, the endogenous TCR constant locus can be a TCR alpha Constant (TRAC) locus or a TCR beta Constant (TRBC) locus. In some embodiments, the endogenous TCR constant locus can be a TCR alpha Constant (TRAC) locus or a TCR beta Constant (TRBC) locus. In some embodiments, the second CRISPR RNP is a TRAC RNP that cuts the TRAC locus for knock-in. In some embodiments, the CRISPR RNP is a CRISPR/Cas9 RNP. In some embodiments, the normal cell culture medium is one that is suitable for non-modified cell's growth and/or proliferation. In some embodiments, the normal cell culture medium is without any exogenous selection pressure. In some embodiments, a CRISPR RNP is used to knock-in into a pre-determined site in the target genome a second two-part nucleotide, optionally wherein the pre-determined site in the target genome is the B2M gene.


In some embodiments, the method comprises introducing into a cell at least one two-part nucleotide sequence capable of expressing both the first-part and second-part nucleotide sequences in the cell. The cell has the functional activity of an essential protein for the survival and/or proliferation that is reduced such that the cell cannot survive and/or proliferate in a normal cell culture medium. The at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, and the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encodes a first protein that provides a substantially equivalent function to the essential protein for the survival and/or proliferation and a second-part nucleotide sequence encodes a second protein to be expressed. The second protein is a protein of interest. The method further comprises culturing the cell in cell culture medium containing at least one supplement leading to enrichment or selection of the cell that expresses both the first protein and the second protein.


In some embodiments, the method comprises reducing the functional activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions and introducing into the cell at least a two-part nucleotide sequence that is capable of expressing both the first-part and second-part nucleotide sequences in the cell and comprises a first-part nucleotide sequence encodes a first protein that provides a substantially equivalent function to and a second-part nucleotide sequence encoding a second protein to be expressed. The at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, and the second protein is a protein of interest. The method further comprises culturing the cell in cell culture medium containing at least one supplement leading to selection or enrichment of the cell that expresses both the first protein and the second protein.


In some embodiments, the cell is a T cell, NK cell, NKT cell, iNKT cell, hematopoietic stem cell, mesenchymal stem cell, iPSC, neural precursor cell, a cell type in retinal gene therapy, or any other cell. In some embodiments, the cell is mammalian. In some embodiments, the cell is rat or mouse. In some embodiments, the cell is human. In some embodiments, the cell is from an established or standard cell line. In some embodiments, the cell is from primary tissue or primary cells. In some embodiments, the first-part nucleotide sequence is altered in nucleotide sequence to achieve nuclease, siRNA, miRNA, or CRISPRi resistance, and either a) encodes a protein having an identical amino acid sequence to the first protein or b) encodes a protein having an adjusted functionality to the first protein. In some embodiments, the first-part nucleotide sequence is altered to encode an altered protein that does not have an identical amino acid sequence to the first protein. In some embodiments, the first part nucleotide sequence encodes a protein having an amino acid sequence that is at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to the first protein. In some embodiments, the altered protein has specific features that the first protein does not have. the specific features include, but are not limited to, one or more of the following: reduced activity, increased activity, altered half-life resistance to small molecule inhibition, and increased activity after small molecule binding. In some embodiments, activity of the altered protein is altered by at least about 5%, at least about 10%, at least about 20%, at least about 30%, at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% compared to the first protein. In some embodiments, the half-life of the altered protein is reduced compared to the first protein. In some embodiments, the half-life of the altered protein is extended compared to the first protein. In some embodiments, the half-life of the altered protein is extended or reduced at least about 1.5-fold, at least about 2-fold, at least about 5-fold, at least about 10-fold, at least about 20-fold, at least about 50-fold, or at least about 100-fold compared to the first protein. In some embodiments, both the first-part and the second-part nucleotide sequences are driven by a same promoter. In some embodiments, the first-part and the second-part nucleotide sequences are driven by different promoters. In some embodiments, the second-part nucleotide sequence comprises at least a therapeutic gene. In some embodiments, the second-part nucleotide sequence encodes a neo-antigen T-cell receptor complex (TCR) containing a TCR alpha chain and a TCR beta chain. In some embodiments, the essential or first protein is dihydrofolate reductase (DHFR), Inosine Monophosphate Dehydrogenase 2 (IMPDH2), O-6-Methylguanine-DNA Methyltransferase (MGMT), Deoxycytidine kinase (DCK), Hypoxanthine Phosphoribosyltransferase 1 (HPRT1), Interleukin 2 Receptor Subunit Gamma (IL2RG), Actin Beta (ACTB), Eukaryotic Translation Elongation Factor 1 Alpha 1 (EEF1A1), Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH), Phosphoglycerate Kinase 1 (PGK1), or Transferrin Receptor (TFRC). In some embodiments, the first-part nucleotide sequence comprises a protein inhibitor-resistant DHFR gene, and the second-part nucleotide sequence comprises a TRA gene and a TRB gene. In some embodiments, the TRA, TRB, and DHFR genes are operably configured to be expressed from a single open reading frame. the TRA, TRB, and DHFR genes are expressed two or three open reading frames. In some embodiments, the TRA, TRB, and DHFR genes are separated by an at least one linker. In some embodiments, the TRA, TRB, and DHFR genes are separated by two linkers. In some embodiments, the order of the at least one linker, TRA, TRB, and DHFR genes is the following: TRA-linker-TRB-linker-DHFR, TRA-linker-DHFR-linker-TRB, TRB-linker-TRA-linker-DHFR, TRB-linker-DHFR-linker-TRA, DHFR-linker-TRA-linker-TRB, or DHFR-linker-TRB-linker-TRA. In some embodiments, the at least one linker is an at least one self-cleaving 2A peptide and/or an at least one IRES element. In some embodiments, the DHFR, TRA, and TRB genes are driven by an endogenous TCR promoter or any other suitable promoters including, but not limited to the following promoters: TRAC, TRBC1/2, DHFR, EEF1A1, ACTB, B2M, CD52, CD2, CD3G, CD3D, CD3E, LCK, LAT, PTPRC, IL2RG, ITGB2, TGFBR2, PDCD1, CTLA4, FAS, TNFRSF1A (TNFR1), TNFRSF10B (TRAILR2), ADORA2A, BTLA, CD200R1, LAG3, TIGIT, HAVCR2 (TIM3), VSIR (VISTA), IL10RA, IL4RA, EIF4A1, FTH1, FTL, HSPA5, and PGK1. In some embodiments, the two-part nucleotide sequence is integrated into the genome of the cell. In some embodiments, the two-part nucleotide sequence is not integrated into the genome of the cell. In some embodiments, the two-part nucleotide sequence is not integrated into the genome of the cell, but is expressed by the cell through an at least one plasmid. In some embodiments, the two-part nucleotide sequence is integrated into the nuclear genome of the cell. the two-part nucleotide sequence is integrated into the mitochondrial genome of the cell. In some embodiments, the at least one two part nucleotide sequence becomes operable for expression when inserted into the pre-determined site in the target genome and both the first-part and second-part nucleotide sequences are driven by a promoter in the target genome. In some embodiments, the integration is through nuclease-mediated site-specific integration, transposon-mediated gene delivery, or virus-mediate gene delivery. In some embodiments, the nuclease-mediated site-specific integration is through CRISPR RNP, optionally a CRISPR/Cas9 RNP. In some embodiments, the method further comprises using the Split intein system. In some embodiments, a CRISPR RNP that targets an endogenous TCR Constant locus, the first-part nucleotide sequence encoding a protein inhibitor-resistant DHFR gene, and the second-part nucleotide sequence encoding a neo-antigen TCR are delivered to the cell. In some embodiments, the endogenous TCR constant locus can be a TCR alpha Constant (TRAC) locus or a TCR beta Constant (TRBC) locus. In some embodiments, the delivery is by electroporation, or methods based on mechanical or chemical membrane permeabilization. In some embodiments, the CRISPR RNP is a TRAC RNP that cuts the TRAC locus for knock-in. In some embodiments, the CRISPR RNP is a CRISPR/Cas9 RNP. In some embodiments, wherein the supplement leading to enrichment or selection of the cell is an antibody that allows enrichment of the cells by flow cytometry or magnetic bead enrichment. In some embodiments, the supplement leading to enrichment or selection of the cell is an antibody that allows enrichment of the cells by flow cytometry or magnetic bead enrichment. In some embodiments, the first protein mediates resistance of the cell to the supplement mediated impairment of survival and/or proliferation of cells. In some embodiments, the supplement is methotrexate. In some embodiments, the first protein is a methotrexate-resistant DHFR mutant protein.


In some embodiments, the method comprises introducing into a cell at least two, two-part nucleotide sequences capable of expressing both a first-part and a second-part nucleotide sequence in the cell. The cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate, and the first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a first protein of interest. The second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a second protein of interest. When both the first and second fusion proteins are expressed together in a cell, the function of the essential protein for the survival and/or proliferation is restored. The method further comprises culturing the cell under conditions leading to the selection of the cell that expresses both the first and second two-part nucleotide sequences.


In some embodiments, the method comprises suppressing at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions and introducing at least two two-part nucleotide sequences that are capable of being expressed in the cell. The first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a first protein of interest. The second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a second protein of interest, and when both the first and second fusion proteins are expressed together in a cell, the function of the essential protein for the survival and/or proliferation is restored. The method further comprises culturing the cell under in vitro propagation conditions that lead to the enrichment of the cell that expresses both the first fusion protein and second fusion protein.


In some embodiments, the method comprises introducing at least one two-part nucleotide sequence that is operable for expression in a cell. The cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate, and the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding the essential protein for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed. The second-part nucleotide sequence is encoding a protein that is exogenous to the cell; and culturing the cell under conditions leading to the selection of the cell that expresses both the first-part and second-part nucleotide sequences.


In some embodiments, the method comprises decreasing activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions, introducing at least a two-part nucleotide sequence that is operable for expression in the cell and comprises a first-part nucleotide sequence encoding the first protein and a second-part nucleotide sequence encoding a second protein to be expressed. The second-part protein is exogenous to the cell, and culturing the cell under in vitro propagation conditions that lead to the enrichment of the cell that expresses both the first protein and second protein.


In some embodiments, cell survival and/or proliferation are measured after at least about 1 minute, at least about 10 minutes, at least about 30 minutes, at least about 60 minutes, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 20 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 4 days, at least about 5 days, at least about 6 days, at least about 1 week, at least about 2 weeks, at least about 1 month, or at least about 2 months. In some embodiments, decreasing activity of at least a first protein that is essential for the survival and/or proliferation lasts for at least about 1 minute, at least about 10 minutes, at least about 30 minutes, at least about 60 minutes, at least about 2 hours, at least about 5 hours, at least about 10 hours, at least about 20 hours, at least about 1 day, at least about 2 days, at least about 3 days, at least about 4 days, at least about 5 days, at least about 6 days, at least about 1 week, at least about 2 weeks, at least about 1 month, or at least about 2 months. In some embodiments, decreasing activity of at least a first protein that is essential for the survival and/or proliferation is permanent.


Some embodiments described herein relate to a cell that is made according to any of the methods of the present disclosure.


Some embodiments described herein relate to a method for enrichment of a genetically engineered T cell. In some embodiments, the method comprises introducing a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor complex or Chimeric antigen receptor in the T cell by integration of the two-part nucleotide sequence downstream of the TRA or TRB promotor, and culturing the cell in cell culture medium containing methotrexate leading to enrichment of the cell that expresses both the first protein and the second protein.


Some embodiments described herein relate to a method for enrichment of a T cell engineered to express an exogenous T cell receptor gene. In some embodiments, the method comprises knocking-out an endogenous TRBC gene from its locus using a first CRISPR/Cas9 RNP, knocking-in, using a second CRISPR/Cas9 RNP, into the endogenous TRBC locus a first-part nucleotide sequence encoding a methotrexate-resistant DHFR gene and a second-part nucleotide sequence comprising a therapeutic TCR gene. Both nucleotide sequences are operably linked allowing for expression from the endogenous TRBC promotor, and culturing the cells in cell culture medium containing methotrexate leading to enrichment of T cells that express both the therapeutic TCR and the methotrexate-resistant DHFR gene.


In some embodiments, the essential protein is a DHFR protein. In some embodiments, the essential protein is a DHFR mimic or analog. In some embodiments, the essential protein is at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to a DHFR protein or portion thereof. In some embodiments, the second-part nucleotide sequence of either the first or second two-part nucleotide sequences is exogenous to the cell. In some embodiments, the second-part nucleotide sequence of either the first or second two-part nucleotide sequence is a TCR. In some embodiments, the first and/or second binding domains are derived from GCN4. In some embodiments, the first and/or second binding domains are derived from a GCN4 mimic or analog. In some embodiments, the first and/or second binding domains are derived from a sequence that is at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to GCN4. In some embodiments, the first and/or second binding domains comprise SEQ ID NO: 24. In some embodiments, the first and/or second binding domains comprise a sequence that at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to SEQ ID NO: 24. In some embodiments, the first fusion protein and/or second fusion protein comprise SEQ ID NO: 39 and/or SEQ ID NO: 40. In some embodiments, the first fusion protein and/or second fusion protein comprise a sequence that is at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to SEQ ID NO: 39 and/or SEQ ID NO: 40. In some embodiments, the first fusion protein and/or second fusion protein comprise SEQ ID NO: 35 and/or SEQ ID NO: 36. In some embodiments, the first fusion protein and/or second fusion protein comprise a sequence that is at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to SEQ ID NO: 35 and/or SEQ ID NO: 36. In some embodiments, the first fusion protein and/or second fusion protein comprise SEQ ID NO: 37 and/or SEQ ID NO: 38. In some embodiments, the first fusion protein and/or second fusion protein comprise a sequence that is at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to SEQ ID NO: 37 and/or SEQ ID NO: 38. In some embodiments, the first fusion protein and/or second fusion protein comprise SEQ ID NO:62 and/or SEQ ID NO: 63. In some embodiments, the first fusion protein and/or second fusion protein comprise a sequence that is at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to SEQ ID NO: 62 and/or SEQ ID NO: 63. In some embodiments, the first and second binding domains are derived from FKBP12. In some embodiments, the first and second binding domains are derived from a FKBP12 analog or mimic. In some embodiments, the FKBP12 has an F36V mutation. In some embodiments, the first and second binding domains are derived from a sequence that is at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to FKBP12. In some embodiments, the first and/or second binding domains comprise SEQ ID NO: 31. In some embodiments, the first and/or second binding domains comprise a sequence that is at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to SEQ ID NO: 31. In some embodiments, the first and/or second binding domains are derived from JUN and/or FOS. In some embodiments, the first and/or second binding domains are derived from a JUN and/or FOS analog or mimic. In some embodiments, the first and/or second binding domains are derived from a sequence that is at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to JUN and/or FOS. In some embodiments, the first and/or second binding domains are derived from SEQ ID NO: 26 and/or SEQ ID NO: 29. In some embodiments, the first and/or second binding domains are derived from a sequence that is at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to SEQ ID NO: 26 and/or SEQ ID NO: 29. In some embodiments, the first and/or second binding domains are derived from SEQ ID NO: 27 and/or SEQ ID NO: 30. In some embodiments, the first and/or second binding domains are derived from a sequence that is at least about 50%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or at least about 100% identical to SEQ ID NO: 27 and/or SEQ ID NO: 30. In some embodiments, the first binding domain and second binding domain have complementary mutations that preserve binding to each other. In some embodiments, neither the first binding domain nor the second binding domain bind to a native binding partner. In some embodiments, wherein each of the first binding domain and second binding domain have between 3 and 7 complementary mutations. In some embodiments, the first binding domain and second binding domain each have 3 complementary mutations. In some embodiments, the first binding domain and second binding domain each have 4 complementary mutations. In some embodiments, the at least two two-part nucleotide sequences are integrated into the genome of the cell. In some embodiments, the at least two two-part nucleotide sequences are not integrated into the genome of the cell. In some embodiments, the at least two two-part nucleotide sequences are integrated into the nuclear genome of the cell. In some embodiments, the at least two two-part nucleotide sequences are integrated into the mitochondrial genome of the cell. In some embodiments, the at least two two-part nucleotide sequences are not integrated into the genome of the cell but are expressed by the cell through an at least one plasmid. In some embodiments, the at least two two-part nucleotide sequences become operable for expression when inserted into pre-determined sites in the target genome and both the first-part and second-part nucleotide sequences are driven by a promoters in the target genome. In some embodiments, the integration is through nuclease-mediated site-specific integration, transposon-mediated gene delivery, or virus-mediate gene delivery. In some embodiments, the nuclease-mediated site-specific integration is through CRISPR RNP. In some embodiments, the first two-part nucleotide sequence is delivered to the cell by a CRISPR RNP that targets an endogenous TCR Constant locus, the first first-part nucleotide sequence encodes a non-functional portion of a DHFR protein, and the first second-part nucleotide sequence encodes a neo-antigen TCR. In some embodiments, the first two-part nucleotide sequence is delivered to the cell by a CRISPR RNP that targets an endogenous TCR Constant locus, the first first-part nucleotide sequence encodes a non-functional portion of a DHFR protein, and the first second-part nucleotide sequence encodes a neo-antigen TCR. In some embodiments, the first first-part nucleotide sequence and the second first-part nucleotide sequences encode fusion proteins comprising non-functional portions of a DHFR protein that have DHFR activity when the fusion proteins are co-expressed. In some embodiments, the endogenous TCR Constant locus can be a TCR alpha Constant (TRAC) locus or a TCR beta Constant (TRBC) locus. In some embodiments, the endogenous locus other than a TCR Constant locus is a B2M locus. In some embodiments, the delivery is by electroporation, or methods based on mechanical or chemical membrane permeabilization. In some embodiments, the CRISPR RNP is a CRISPR/Cas9 RNP.


In some embodiments, the nuclease allows for in-frame exonic integration into a gene locus to enable expression from the endogenous promotor, the endogenous splice sites, and the endogenous termination signal. In some embodiments, the nuclease allows for in-frame exonic integration into a gene locus to allow for expression from the endogenous promotor, the endogenous splice sites, and an exogenous termination signal. In some embodiments, these embodiments can be part of any of the embodiments provided herein.


In some embodiments, the nuclease allows for intronic integration into a gene locus to allow for expression from the endogenous promotor, an exogenous splice acceptor site, and an exogenous termination signal. In some embodiments, the essential or first protein is split into at least two individually dysfunctional protein portions, wherein each of the at least two portions is fused to multimerization domain and wherein each of the at least two portions is integrated into distinct two-part nucleotide sequences to allow for selection of cells in which all distinct two-part nucleotide sequences are expressed, optionally wherein the function of the essential or first protein is restored. In some embodiments, the essential or first protein is split into at least two individually dysfunctional protein portions, wherein each of the at least two portions is fused to multimerization domain and wherein each of the at least two portions is integrated into distinct two-part nucleotide sequences to allow for selection of cells in which all distinct two-part nucleotide sequences are expressed, optionally wherein the function of the essential or first protein is partially restored. the essential or first protein is split into at least two individually dysfunctional protein portions, wherein each of the at least two portions is fused to multimerization domain and wherein each of the at least two portions is integrated into distinct two-part nucleotide sequences to allow for selection of cells in which all distinct two-part nucleotide sequences are expressed, optionally wherein the function of the essential or first protein is restored at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 80%, at least about 95%, at least about 99%, or at least about 100% to its normal level. In some embodiments, the essential or first protein is split into a dysfunctional N-terminal and C-terminal protein half, each half fused to a homo- or heterodimerizing protein partner or to a split intein. In some embodiments, the essential or first protein is a DHFR protein. In some embodiments, the essential or first protein is a DHFR protein analog or mimic. In some embodiments, the essential or first protein is at least about 50%, at least about 75%, at least about 80%, at least about 95%, at least about 99%, or at least about 100% identical to a DHFR protein. In some embodiments, the homodimerizing protein is GCN4, FKBP12, or a variant thereof. In some embodiments, the heterodimerizing proteins are Jun/Fos, or variants thereof. In some embodiments, restoration of the function of the essential protein is induced. In some embodiments, restoration of the function of the essential protein is induced by AP1903. In some embodiments, restoration of the function of the essential protein is induced by at least about 5%, at least about 10%, at least about 20%, at least about 50%, at least about 75%, at least about 80%, at least about 95%, at least about 99%, or at least about 100%. In some embodiments, the culturing step is done in the presence of methotrexate. In some embodiments, the protein of interest is a T cell receptor. In some embodiments, the T cell receptor is specific for a viral or a tumor antigen. In some embodiments, the tumor antigen is a tumor neo-antigen. In some embodiments, the genetically engineered cell is a primary human T cell.


Some embodiments described herein relate to a T cell. In some embodiments, the T cell comprises an endogenous dihydrofolate reductase (DHFR) being suppressed by the presence of methotrexate to a level that the cell cannot survive and/or proliferate, and at least a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor.


In some embodiments, the T cell comprises a knock-out of endogenous dihydrofolate reductase (DHFR), and at least one two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a DHFR protein, or variant thereof, and a second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor.


In some embodiments, the T cell comprises an endogenous dihydrofolate reductase (DHFR) being suppressed by the presence of methotrexate to a level that the cell cannot survive and/or proliferate, and at least two two-part nucleotide sequences. The first two-part nucleotide sequence comprises a first first-part nucleotide sequence encoding a non-functional or dysfunctional portion of a DHFR protein, or variant thereof, and a first second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor. The second two-part nucleotide sequence comprises a second first-part nucleotide sequence encoding a non-functional or dysfunctional portion of a DHFR protein, or variant thereof, and a second second-part nucleotide sequence encoding a protein of interest operably expressed from the endogenous B2M promotor, and wherein the cell has DHFR activity.


Definitions

Throughout this specification the word “comprise,” or variations such as “comprises” or “comprising,” will be understood to imply the inclusion of a stated element, integer or step, or group of elements, integers or steps, but not the exclusion of any other element, integer or step, or group of elements, integers or steps.


The following explanations of terms and methods are provided to better describe the present disclosure and to guide those of ordinary skill in the art in the practice of the present disclosure. The singular forms “a,” “an,” and “the” refer to one or more than one, unless the context clearly dictates otherwise. For example, the term “comprising a nucleic acid molecule” includes single or plural nucleic acid molecules and is considered equivalent to the phrase “comprising at least one nucleic acid molecule.” The term “or” refers to a single element of stated alternative elements or a combination of two or more elements, unless the context clearly indicates otherwise. As used herein, “comprises” means “includes.” Thus, “comprising A or B,” means “including A, B, or A and B,” without excluding additional elements. Unless otherwise specified, the definitions provided herein control when the present definitions may be different from other possible definitions.


Unless explained otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this disclosure belongs. All HUGO Gene Nomenclature Committee (HGNC) identifiers (IDs) mentioned herein are incorporated by reference in their entirety. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, suitable methods and materials are described below. The materials, methods, and examples are illustrative only and not intended to be limiting.


“T cell receptor” or “TCR” denotes a molecule found on the surface of T cells or T lymphocytes that recognizes antigen bound as peptides to major histocompatibility complex (MHC) molecules. The TCR is composed of two different protein chains (that is, it is a hetero dimer). In humans, in 95% of T cells the TCR consists of an alpha (α) chain and a beta (β) chain (encoded by TRA and TRB, respectively), whereas in 5% of T cells the TCR consists of gamma and delta (γ/δ) chains (encoded by TRG and TRD, respectively). This ratio changes during ontogeny and in diseased states (such as leukemia). It also differs between species. Each TCR chain is composed of two extracellular domains: Variable (V) region and a Constant (C) region. The Constant region is proximal to the cell membrane, followed by a transmembrane region and a short cytoplasmic tail, while the Variable region binds to the peptide/MHC complex. The variable domain of both the TCRα and TCRβ chains has three hypervariable complementarity determining regions (CDRs), denoted CDR1, CDR2, and CDR3. In some embodiments, CDR3 is the main antigen-recognizing region. In some embodiments, TCRα chain genes comprise V and J, and TCRβ chain genes comprise V, D and J gene segments that contribute to TCR diversity. The constant domain of the TCR consists of short connecting sequences in which a cysteine residue forms disulfide bonds, which form a link between the two chains.


In addition to other features, T Cells can be characterized by the expression of markers that indicate functionality or activation state, including but not limited to CD4, CD8, CD25, and CD69. In some embodiments, the cells are a specific subset of T cells, such as CD4+ or CD8+ T cells. In some embodiments, the methods are used on a specific subset of T cells, such as CD4+ or CD8+ T cells. In some embodiments, the methods are used in the process of generating a specific subset of T cells, such as CD4+ or CD8+ T cells. In some embodiments, the cells are activated, for example, expressing CD25 or CD69. In some embodiments, the methods are used on cells that are activated, for example, expressing CD25 or CD69. In some embodiments, the methods are used in the process of generating cells that are activated, for example, expressing CD25 or CD69.


The term “therapeutic TCRs” or “therapeutic TCR genes” can refer to specific combinations of TCRα and TCRβ chains that mediate a desired functionality, for example, being able to facilitate a host's immune system to fight against a disease. Therapeutic TCR genes can be selected from in vitro mutated TCR chains expressed as recombinant TCR libraries by phage-, yeast- or T cell-display systems. Therapeutic TCR genes can be autologous or allogeneic.


The term “protein of interest” can refer to any protein that is to be expressed in addition to the protein that is essential for the survival and/or proliferation of a cell according to some embodiments described herein. A protein of interest may be exogenous to the cell. A protein of interest may be a protein that is natively expressed by the cell but that is to be overexpressed. Proteins may be of interest for therapeutic, diagnostic, research, or any other purpose. Examples of proteins of interest include TCRs, chimeric-antigen receptors, switch receptors, cytokines, enzymes, growth factors, antibodies, and modified versions thereof.


“Genetically engineered cells” are cells that have changes in their genetic makeup using biotechnology. Such changes include transfer of genes within and across species boundaries, the introduction of new natural or synthetic genes, or the removal of native genes, to produce improved or novel organisms or improved or novel functionality within an organism. New DNA is obtained by either isolating and copying the genetic material of interest using recombinant DNA methods or by artificially synthesizing the DNA. Isolated or synthesized DNA may be modified prior to introduction into the genetically engineered cell.


“Genetically engineered T cells” are T cells that have changes in their genetic makeup using biotechnology.


A “linker,” when used in the context of a protein or polypeptide, refers to an amino acid sequence that connects two proteins, polypeptides, peptides, domains, regions, or motifs and may provide a spacer function compatible with interaction of the two sub-binding domains so that the resulting polypeptide retains a specific function or activity. In certain embodiments, a linker is comprised of about two to about 35 amino acids or 2-35 amino acids, for instance, about four to about 20 amino acids or 4-20 amino acids, about eight to about 15 amino acids or 8-15 amino acids, about 15 to about 25 amino acids or 15-25 amino acids. In some embodiments, linkers can be rich in glycines and/or serine amino acids.


An “intein,” also known as a “protein intron,” is a protein segment or segments capable of joining adjacent residues. In some embodiments, the intein is able to excise itself and/or join the remaining portions of a precursor polypeptide during protein splicing. In some embodiments, an intein joins together with other residues through a peptide bond. A “Split intein” refers to a case in which the intein of the precursor protein comes from at least two genes.


The term “nonfunctional” refers to a molecule, amino acid, amino acids, nucleotide, nucleotides, domain, protein segment, protein, RNA, RNA segment, DNA, or DNA segment that has no or severely reduced activity.


The term “dysfunctional” refers to a molecule, amino acid, amino acids, nucleotide, nucleotides, domain, protein segment, protein, RNA, RNA segment, DNA, or DNA segment that cannot function in the expected or complete manner and may or may not have aberrant activity.


As used herein, the term “neo-antigen” refers to an antigen derived from a tumor-specific genomic mutation. For example, a neo-antigen can result from the expression of a mutated protein in a tumor sample due to a non-synonymous single nucleotide mutation or from the expression of alternative open reading frames due to mutation induced frame-shifts. Thus, a neo-antigen may be associated with a pathological condition. In some embodiments, “mutated protein” refers to a protein comprising at least one amino acid that is different from the amino acid in the same position of the canonical amino acid sequence. In some embodiments, a mutated protein comprises insertions, deletions, substitutions, inclusion of amino acids resulting from reading frame shifts, or any combination thereof, relative to the canonical amino acid sequence. “PTM neo-antigens” refers to antigens that are tumor specific but are not based on genomic mutations. Examples of PTM neo-antigens include phospho-neo-antigens and glycan-neo-antigens.


“CRISPR/Cas9” is a technology that enables geneticists and medical researchers to edit parts of the genome by removing, adding or altering sections of the DNA sequence. The CRISPR/Cas9 system consists of two key molecules that introduce a change into the DNA: an enzyme called Cas9, which acts as a pair of “molecular scissors” that can cut the two strands of DNA at a specific location in the genome so that bits of DNA can then be added or removed; a piece of RNA called guide RNA (gRNA), which consists of a small piece of pre-designed RNA sequence (about 20 bases long) located within a longer RNA scaffold. The scaffold part binds to DNA and the pre-designed sequence “guides” Cas9 to the right part of the genome. This makes sure that the Cas9 enzyme cuts at the right point in the genome. A ribonucleoprotein (RNP) is a complex of ribonucleic acid and RNA-binding protein. Persons having skill in the art will recognize that CRISPR systems other than Cas9 may equivalently be used in various embodiments described herein and the term “CRISPR” refers to the genus of such systems when the term is used to refer to a technology, system, or method.


CRISPR interference (CRISPRi) is a genetic perturbation technique that allows for sequence-specific repression of gene expression in prokaryotic and eukaryotic cells.


“TALEN,” or Transcription activator-like effector nucleases, are restriction enzymes that can be engineered to cut specific sequences of DNA. They are made by fusing a TAL effector DNA-binding domain to a DNA cleavage domain (a nuclease which cuts DNA strands). Transcription activator-like effectors (TALEs) can be engineered to bind to practically any desired DNA sequence, so when combined with a nuclease, DNA can be cut at specific locations.


“MegaTAL” is a single-chain rare-cleaving nuclease system, in which the DNA binding region of a transcription activator-like (TAL) effector is used to address a site-specific meganuclease adjacent to a single desired genomic target site. This system allows the generation of extremely active and hyper-specific compact nucleases.


“siRNA,” Small interfering RNA, sometimes known as short interfering RNA or silencing RNA, is a class of double-stranded RNA non-coding RNA molecules, typically 20-27 base pairs in length, similar to miRNA, and operating within the RNA interference (RNAi) pathway. It interferes with the expression of specific genes with complementary nucleotide sequences by degrading mRNA after transcription, preventing translation.


“miRNA” (microRNA) is a small non-coding RNA molecule (containing about 22 nucleotides) found in plants, animals and some viruses, that functions in RNA silencing and post-transcriptional regulation of gene expression. miRNAs function via base-pairing with complementary sequences within mRNA molecules. As a result, these mRNA molecules are silenced.


Various Embodiments

In some embodiments, a method provided herein is a selection method for the enrichment of a genetically engineered cell. The method can comprise: introducing a genomic knock-out at, at least, one genomic locus encoding a protein essential for the survival and/or proliferation of a cell. See FIG. 27A “knockout essential gene.” The method may also include introducing at least one nucleotide sequence that is operable for expression in the cell and encodes, at least, the protein essential for the survival and/or proliferation of the cell.


In some embodiments, the selection is achieved without an exogenous selection pressure. An “exogenous selection pressure” is a supplement added to a normal culture media that allows for selection of the cell. Exogenous selection pressures can be molecules that inhibit or activate a protein or cellular process (e.g., a drug molecule such as methotrexate), molecules that bind to a component of the cell to allow for physical, optical, or magnetic sorting of cells having the component from cells that do not have the component (e.g., an antibody that allows enrichment by flow cytometry or magnetic bead enrichment), or molecules that can be added to a cell culture media to differentially promote the proliferation of a cell having a modification from one that does not have a modification. In some preferred embodiments, the exogenous selection pressure is a pharmacological exogenous selection pressure (e.g., methotrexate). In some embodiments, the re-introduced gene is identical in amino acid sequence to the endogenous gene that is genetically knocked-out but altered in nucleotide sequence to achieve nuclease resistance, thereby allowing to avoid the use of a mutant protein, such as a DHFR protein. In some embodiments, the introduced nucleotide sequence needs to be integrated into the genome of the cell (i.e. requirement for stable expression of the transgene). The gene encoding the essential protein can be integrated into a gene locus of interest. See FIG. 27B “Knockin altered essential gene into locus of interest.”


In some embodiments, the method is for the enrichment of a genetically engineered T cell. The method comprises introducing a nuclease-mediated knock-out of the endogenous DHFR gene of the T cell, and introducing into the T cell genome a nucleotide sequence encoding a T cell receptor alpha chain, a T cell receptor beta chain and DHFR, in which the T cell receptor alpha chain, a T cell receptor beta chain and DHFR are all operably linked to be expressed simultaneously. See FIG. 2.


In some embodiments, any of the selection methods provided herein can be employed for the enrichment of genetically engineered T cells of which the antigen specificity has been redirected for cell therapy. In some embodiments, this can be used for fully personalized engineered TCR therapy for the treatment of solid cancer. To allow for this, this method can be included in larger methods that allow for the identification of neo-antigen specific TCR genes from tumor biopsies on an individual patient basis. Following their identification, such neo-antigen TCR genes can then be introduced into patient T cells via any technique, including, but not limited to, CRISPR nuclease-mediated gene knock-in, thereby redirecting the antigen specificity of the T cells towards tumor neo-antigens. Finally, the genetically engineered T cells can be administered back to the patient via intravenous infusion.


To allow for maximal therapeutic efficacy, it is useful that a large fraction of the genetically engineered T cells that are administered back to the patient express the neo-antigen specific TCR genes of interest. Since the efficiency of TCR gene knock-in generally ranges between 10-30%, a selection method is useful that can enrich successfully engineered cells prior to cell infusion. In some embodiments, such a selection method can make use of the same molecular components that are needed for the TCR knock-in, meaning that no additional experimental procedures are required for the T cell manufacturing process. This can be achieved by some of the various embodiments provided herein.


In some embodiments, the strategy is also applicable to enrich cells with a genetic knockout for a particular gene, provided the endogenous gene used as the selection marker (e.g. DHFR) is introduced as a knock-in. In some embodiments, CRISPR/Cas9 Ribonucleoprotein (RNP) (or any other nuclease, including other CRISPR systems) can be used to knock-out the essential endogenous dihydrofolate reductase (DHFR) gene. See FIG. 2 upper panel. A second CRISPR/Cas9 RNP can be used to knock-in a construct containing a therapeutic TCR gene and a CRISPR/Cas9 nuclease-resistant DHFR gene into the endogenous TCR locus. See FIG. 2 lower panel. As such, cells with successful knock-in of the TCR gene construct will gain a strong survival advantage over the other DHFR knock-out cells and become enriched in time. Some embodiments provided herein can be used to enrich genetically modified cells independent of (1) the gene delivery method, (2) the nature of the transgene and (3) the target cell type. The DFHR involved pathway is shown in FIG. 1. DHFR/methotrexate (MTX) selection is used for multiple amplification to isolate high recombinant protein producing clones. DHFR is a reductase that coverts folate to tetrahydrofolate, an essential precursor in the de novo nucleotide synthesis pathway for cell proliferation. When DHFR is suppressed, the cells cannot proliferate without extra supplements (hypoxanthine and thymidine (HT)). Thus, a DHFR selection system provides a point at which one can select knockin cells. An embodiment of a genetic construct is shown in FIG. 2. In some embodiments, for this enrichment strategy, one can knockout endogenous DHFR and reintroduce it together with the therapeutic transgenes (TCRβ and TCRα). The cells with DHFR knockout will stop proliferating and/or die and only the cells that have re-introduced DHFR (together with transgenes TCRβ and TCRα) can continue to proliferate and/or survive and therefore will be enriched; the reintroduced DHFR is nuclease-resistant but has the same amino acid sequence as wild-type DHFR. For the embodiments in FIG. 2, it allows one to co-deliver 3 components during electroporation:

    • 1. TRAC RNP to cut TRAC locus for knockin
    • 2. DHFR RNP to knockout endogenous DHFR
    • 3. Linear dsDNA template including 1G4-TCR and sgRNA-resistant DHFR. For the DHFR knockout cells, only cells with concomitant sgRNA-resistant DHFR knockin can proliferate in normal medium.


As noted above, DHFR is an essential enzyme that converts dihydrofolate to tetrahydrofolate during the synthesis of purine nucleotides (see, e.g., FIG. 1). As such, knock-out of DHFR inhibits DNA synthesis and repair, and preferentially impairs growth of highly proliferative cells such as T cells. Based on this, the present gene-editing enrichment strategy has been provided in which, for example, cells can be electroporated with a CRISPR/Cas9 RNP complex (or, in the alternative, any other relevant system) that knocks out/suppresses the endogenous DHFR gene. Simultaneously, the cells are electroporated with an RNP complex that targets the endogenous TCRalpha Constant (TRAC) gene together with a DNA repair template that encodes a neo-antigen TCR and a nuclease-resistant DHFR gene, which contains silent mutations to which the RNP complex cannot bind. To ensure that the nuclease-resistant DHFR gene is always co-expressed with the introduced TCR, the DNA repair template can be designed in the following order: TCRbeta-2A-nuclease-resistant DHFR-2A-TCRalpha, as such that three proteins can be expressed from a single open reading frame using self-cleaving 2A peptides.


In some embodiments, at 10 days post electroporation of the TRAC RNP and the DNA repair template, 20%±10% of T cells can display successful knock-in of the introduced TCR gene. Notably, this can increase, for example, to 73%±12% of T cells when the DHFR RNP are electroporated simultaneously. This shows that functional DHFR is useful for T cell survival and that knock-in of a nuclease-resistant DHFR gene can be used to enrich the frequency of T cells with successful TCR knock-in by, for example, ˜5 fold during a culture period of 10 days.


As shown in the examples herein, the DHFR selection strategy can efficiently enrich knockin cells. However, knocking out DHFR with sgRNA can permanently alter the endogenous DHFR locus. Furthermore, it can introduce unspecific off-target editing. In some embodiments, sgRNA can be replaced with siRNA to transiently suppress endogenous DHFR expression, or with methotrexate, a clinically approved DHFR inhibitor during T cell expansion.


Several selection systems based on current technologies can be used for the enrichment of gene-modified cells. Most systems rely on the selection of modified cells based on antibody binding to the introduced transgene or an introduced marker (e.g. truncated mutants of surface molecules such as EGFR and LNGFR). Such systems are fundamentally different from the presented options because they require dedicated process steps, reagents and/or equipment to enrich for genetically modified cells.


Compared to the selection systems based on current technologies for genetically modified cells, some of the present embodiments offer significant advantages, including, one or more of the following:

    • 1. No required introduction of an exogenous genetic sequence to allow for selection: unlike alternative systems based on surface marker (e.g., truncated EGFR), drug resistance (e.g., methotrexate) or antibiotic resistance (e.g., puromycin or blasticidin) mediated selection, no exogenous gene sequence is introduced into the cell other than the transgene. In some embodiments, selection is solely based on genetic knockout of an essential endogenous gene that is re-introduced with unaltered amino acid sequence in conjunction with a transgene.
    • 2. No requirement for physical selection of genetically engineered cells: unlike other methods in the art, the invention does not require antibody-mediated enrichment (e.g. by flow cytometry sorting or magnetic bead enrichment). Selection is achieved by loss of expression or suppression of function of an essential gene in cells that do not express the transgene cassette while function in genetically engineered cells is restored by the transgene cassette.
    • 3. No requirement for mutants of the cell endogenous protein: previously described selection systems based on DHFR are based on the generation and introduction of a methotrexate-resistant DHFR mutant. The modified amino acid sequence of the DHFR mutant is potentially immunogenic and may facilitate cell rejection after adoptive transfer. Furthermore, in the context of T cells, genetically engineered T cells will become resistant to methotrexate. This is undesirable because methotrexate is commonly used to treat autoimmune disease. The lack of a requirement for a mutant protein version greatly facilitates the use of the system with other essential genes than DHFR. In principle, the relevant various embodiments provided here can be applied to any gene that is essential for the survival of the gene-modified cell.
    • 4. Reduced risk for transgene loss: due to the selective pressure to maintain transgene expression for cell survival because expression of the transgene is required to achieve expression of an essential protein or of a resistance protein, it is conceivable that loss of transgene expression, e.g. through promotor silencing, is likely reduced.
    • 5. Compatible with complex genetic payloads: the disclosed invention enables the enrichment of cells expressing three exogenously introduced proteins (TCRalpha, TCRbeta and DHFR) from a single genetic locus. Notably, it is understood that the expression of even more proteins could be co-enriched by using additional 2A peptide sequences or IRES elements. Furthermore, the invention allows to select for genetically engineered cells modified with co-occurring genetic engineering events, e.g. expression of two two-part nucleotide sequences (each of which may encode for multiple exogenously introduced proteins.)


As noted herein, some embodiments may have fewer than all five of these described advantages (e.g., one, two, three, or four of these advantages). For example, (1) in an embodiment where the endogenous DHFR is knocked out, the knock-in DHFR may be a wild-type DHFR (2) in an embodiment where the endogenous DHFR is suppressed by methotrexate, a methotrextate-resistant DHFR or split-DHFR may be used while maintaining selection pressure with the exogenously expressed elements from the same locus. Each of these embodiments and collections of advantages are consistent with and reflected in various embodiments of the present disclosure. It will be appreciated by those of skill in the art that the present disclosure provides multiple and varied inventions and not all of the elements of one invention are required for the other inventions. Thus, not all (or necessarily any) of the inventions disclosed herein will necessarily have one or more of the above embodiments. One of skill in the art will be able to determine which inventions will have the above advantages given the present disclosure, and their knowledge, and/or the specific elements provided for the invention itself.


In some embodiments, knock-down of endogenous DHFR using siRNA, shRNA, miRNA, or CRISPR interference (CRISPRi) technology in combination with expressing a TCR gene construct containing an siRNA, shRNA, miRNA, or CRISPRi-resistant DHFR gene variant may be used instead of permanent genetic knock-out of the endogenous genomic loci.


In some embodiments, inhibition of endogenous DHFR using Methotrexate (MTX) in combination with expressing of transgene cassette containing an MTX-resistant DHFR gene and that is integrated in-frame into an exon of a gene locus to enable expression from the endogenous promotor, the endogenous splice sites, and the endogenous termination signal can be employed.


In some embodiments, inhibition of endogenous DHFR using Methotrexate (MTX) in combination with expressing a TCR gene construct containing an MTX-resistant DHFR gene variant can be employed.


In some embodiments, the selection principle is applicable to other genes than DHFR, provided that the gene is essential for the survival and/or proliferation of the cell.


In some embodiments, endogenous DHFR is knocked out or knocked down by a nuclease; the selection principle is applicable to any other therapeutic gene as provided that the therapeutic gene is coupled to re-introducing a nuclease-resistant DHFR variant.


In some embodiments, the selection principle is applicable in other cell types as well, e.g. hematopoietic stem cells, mesenchymal stem cells, iPSCs, neural precursor cells, fibroblasts, B cells, NK cells, monocytes, macrophages, dendritic cells, and cell types in retinal gene therapy etc.


In some embodiments, the transgene can be delivered in other ways than nuclease-mediated site-specific integration by HDR, namely transposon-mediated gene delivery, microinjection, liposome/nanoparticle-mediate gene transfer, virus-mediated gene delivery, electroporation, or methods based on mechanical or chemical membrane permeabilization.


In some embodiments, the protein restoring a suppressed function or providing resistance for a selective pressure may be i) split into two or more portions which can be operably combined within the cell and ii) each portion linked to a transgene cassette in order to allow selection for cells that have successfully been engineered simultaneously with all transgene cassettes. In some embodiments, the protein restoring a suppressed function may be fused to dimerization domains. In some embodiments, the dimerization domains may be derived from GCN4, Fos, Jun, or FKBP12 proteins. In some embodiments, dimerization may be achieved using leucine-zipper motifs. In some embodiments, dimerization may be achieved by using Split intein proteins. In some embodiments, the dimerization domain can be modified (e.g., have alterations to the amino acid sequences) that reduce or prevent dimerization with an endogenous protein, that promote dimerization and/or binding with an exogenous protein. In some embodiments, the dimerization domain can be modified (e.g., have alterations to the amino acid sequences) to add, remove, and/or modify a feature of the dimerization domain (e.g., inducibile dimerization).


In some embodiments, different designs of the transgene cassette can be employed, for example, six different orientations:

    • Exogenous Protein 1-2A-Exogenous protein 2-2A-Selection advantage protein
    • Exogenous Protein 1-2A-Selection advantage protein-2A-Exogenous protein 2
    • Exogenous protein 2-2A-Exogenous Protein 1-2A-Selection advantage protein
    • Exogenous protein 2-2A-Selection advantage protein-2A-Exogenous Protein 1
    • Selection advantage protein-2A-Exogenous Protein 1-2A-Exogenous protein 2
    • Selection advantage protein-2A-Exogenous protein 2-2A-Exogenous Protein 1
    • (Based on any 2A element)


In some embodiments, different designs of the transgene cassette can be employed, for example 6 different orientations of TCRa, TCRb and DHFR:

    • TCRa-2A-TCRb-2A-DHFR
    • TCRa-2A-DHFR-2A-TCRb
    • TCRb-2A-TCRa-2A-DHFR
    • TCRb-2A-DHFR-2A-TCRa
    • DHFR-2A-TCRa-2A-TCRb
    • DHFR-2A-TCRb-2A-TCRa
    • (Based on any 2A element)


In some embodiments, the two-part nucleotide sequence is integrated in-frame into an exon of a gene locus to enable expression from the endogenous promotor, the endogenous splice sites, and the endogenous termination signal.


In some embodiments, the two-part nucleotide sequence is integrated together with its own exogenous promotor that enables expression of the first protein, the second protein or both.


In some embodiments, the TCRa- and TCRb-chains will be driven by endogenous TCR promoter while a DHFR protein will be driven from an exogenously induced promotor and the transgene cassette has one of the following designs:

    • TCRa-2A-TCRb-pA-promoter-DHFR-pA
    • TCRb-2A-TCRa-pA-promoter-DHFR-pA
    • TCRa-2A-TCRb-pA-promoter-DHFR-2A (use endogenous TRAC pA)
    • TCRb-2A-TCRa-pA-promoter-DHFR-2A (use endogenous TRAC pA)


Elements of the at least two-part nucleotide sequences can be expressed from the same or different promoters. In some embodiments, the elements are expressed from the same promoter and are linked by either genetic linkers (such that each element is separately expressed as a protein) or by protein linkers (such that the linked elements are expressed as a single protein, which may or may not be cleaved after translation). An example of a genetic linker is an IRES element. Examples of protein linkers include 2A or gly-ser linkers. Proteins can also be expressed as a fusion protein without any linker between elements.


In some embodiments, any of the methods provided herein can include the use for the enrichment of genetically modified T cells. In those T cells, an essential protein is suppressed so that the cells cannot survive or proliferate unless a genetically engineered nucleotide encoding the same essential protein or a variant thereof is re-introduced into those cells. The T cells with successful re-introduction of the essential protein will gain a strong survival advantage over the other knock-out cells and become enriched in time. This includes (1) the introduction of any transgene, including T cell receptors and Chimeric Antigen Receptors as well as exogenous genes to modify the phenotype and/or function of the T cell (e.g. dominant negative TGFbeta receptors, switch receptors, etc.) and/or (2) the use of any T cell subset (naïve T cells, memory T cells, tumor-infiltrating lymphocytes (TIL), etc.).


In some embodiments, the method is generically applicable to deliver a wide range of transgenes into different cell types. It is applicable to enrich a wide range of genetic-modifications (gene knockout, knock-in, etc.) provided the endogenous gene used as a selection marker is re-introduced into the cells.


In some embodiments, the methods provided herein provide one or more of the following:

    • a solution for the enrichment of CRISPR nuclease gene-edited T cells expressing therapeutic TCR or CAR genes,
    • a solution for the enrichment of genetically engineered T cells,
    • a method that allows selection without use of an antibody,
    • a method that allows to deliver complex and multiple transgenes.


In some embodiments, any of the methods provided herein can be applied for the enrichment of genetically engineered cells in all therapeutic areas besides oncology, such as Barth syndrome, β-Thalas semia, Cystic fibrosis, Duchenne muscular dystrophy, hemophilia, Sickle cell disease, autoimmunity and infectious disease.


In some embodiments, the present method does not require one to use a vector to express nuclease and sgRNAs. In some embodiments, a ribonucleoprotein complex (nuclease protein+guide RNA) instead of a DNA vector can be used.


In some embodiments, this approach may only lead to a temporary expression of nuclease and sgRNAs. This can allow for one to avoid permanent integration in the genome, which allows one to avoid 1) random integration, which can lead to gene disruption and 2) continuous expression of nuclease, which can be immunogenic or toxic to the cells.


In some embodiments, the two-part nucleotide sequence is expressed in the cell by genomic integration mediated by plasmid-, transposon- or virus-mediated random genomic integration. In some embodiments, the two-part nucleotide sequence is expressed by targeted site-specific integration into the genome of the cell. In some embodiments, targeted site-specific integration is achieved by homology-directed repair of DNA breaks. This can be desirable as the plasmid or virus can randomly integrate into the genome of the target cell. In some embodiments, the two-part nucleotide sequence is linear double-stranded DNA, single-stranded DNA, nano-plasmid, adeno-associated virus (AAV) or any other viral, circular, linear template suitable for Homology-directed repair. Linear double-stranded DNA may be either open-ended or closed-ended.


In some embodiments, the methods do not use a separate promoter to drive transgene and cargo expression as the present repair template will be integrated into the specific site of the genome and therefore, an endogenous promoter will drive their expressions.


In some embodiments, the present methods do not necessarily require a nuclease or a base editor. Instead, a siRNA, shRNA, miRNA, or CRISPRi will work.


In some embodiments, the present methods use a two-vector system which avoids permanent integration of the nuclease. This can be useful as continuous expression of the nuclease may be toxic.


In some embodiments, two promotors need not be used, and one can couple expression of transgene and rescue gene. In some embodiments, this can be beneficial because it makes transgene loss less likely.


In some embodiments, the various embodiments herein can overcome one or more of the following: addressing T cell donors where gene knockin efficiency is low (e.g., less than 20%), allows for selecting knockin cells. An approach more amenable to cGMP-manufacturing requirements. Avoiding adding antibiotic selection markers to the cells or exposing the cells to additional antibody selection methods.


Some embodiments described herein relate to a method for enrichment of a genetically engineered cell. The method can include: i) decreasing activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions. The method can further include ii) introducing at least a two-part nucleotide sequence that is operable for expression in the cell and comprises a first-part nucleotide sequence encoding the first protein and a second-part nucleotide sequence encoding a second protein to be expressed, wherein the second-part protein is exogenous to the cell, and iii) culturing the cell under normal in vitro propagation conditions for enrichment of the cell that expresses both the first protein and second protein. In some embodiments, step iii) can be culturing the cell in vitro propagation conditions leading to enrichment of the cell that expresses both the first protein and second protein.


In these embodiments, the first protein is essential for the survival and/or proliferation of a cell. The essential or first protein can be dihydrofolate reductase (DHFR), Inosine Monophosphate Dehydrogenase 2 (IMPDH2), O-6-Methylguanine-DNA Methyltransferase (MGMT), Deoxycytidine kinase (DCK), Hypoxanthine Phosphoribosyltransferase 1 (HPRT1), Interleukin 2 Receptor Subunit Gamma (IL2RG), Actin Beta (ACTB), Eukaryotic Translation Elongation Factor 1 Alpha 1 (EEF1A1), Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH), Phosphoglycerate Kinase 1 (PGK1), or Transferrin Receptor (TFRC). The activity of the essential protein can be suppressed at nucleotide or protein levels. If the activity of the essential protein is suppressed, the cell can no longer survive or proliferate under normal in vitro propagation conditions unless a substance is added to the culture medium or a genetically engineered nucleotide encoding the same essential protein is re-introduced into those cells. For example, when DHFR is suppressed, the cells cannot proliferate without extra supplements (hypoxanthine and thymidine (HT)) or re-introduced into those cells a functional DHFR.


The first part of the two-part nucleotide sequence encodes an essential protein, which not only has an altered nucleotide or protein sequence so that it can be resistant to the matter that was used to suppress the activity of the endogenous essential protein, but also has the ability to restore the cells' ability to survive or proliferate under the selected in vitro propagation conditions. The second part of the two-part nucleotide sequence encodes a second protein, which is exogenous to the cell and can have therapeutic functions. For example, the second protein can be a TCR complex containing a TCR alpha chain and a TCR beta chain. FIG. 27B shows an example of the two-part nucleotide sequence.


The cells with successful re-introduction of the two-part nucleotide sequence will express the essential protein and restore the cells' ability to survive or proliferate under the selected in vitro propagation conditions, thus gain a strong survival advantage over the other cells and become enriched in time. In some embodiments, the first part and the second part of the nucleotides are configured to be expressed from a single open reading frame so that they are co-expressed in the cells. Therefore, the enriched cells can be used for downstream applications, such as T cell therapy.


Some embodiments described herein relate to a method for selection of a genetically engineered cell when the cell has an essential protein for the survival and/or proliferation that is being suppressed. The method can include i) introducing at least one two-part nucleotide sequence that is operable for expression in a cell, wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate under selected culture conditions, and wherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding the essential protein for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed, and the second-part nucleotide sequence is encoding a protein that is exogenous to the cell; The method can further include ii) culturing the cell under cell culture conditions leading to the selection of the cell that expresses both the first-part and second-part nucleotide sequences.


In these embodiments, the cells with successful re-introduction of the two-part nucleotide sequence will gain a strong survival advantage over the other cells and become enriched in time. In some embodiments, the selection of engineered cells is possible in normal cell culture medium. In some embodiments, the normal cell culture medium is one that is suitable for non-modified cell's growth and/or proliferation. For example, a normal culture medium for T cells is RPMI 1640 from Thermo Fisher Scientific.


In some embodiments, the normal cell culture medium is without an exogenous selection pressure, such as a drug molecule, an antibody, or any specific supplements that allows enrichment of the cells by flow cytometry or magnetic bead enrichment. In some embodiments, the selection of engineered cells is possible based on addition of components to the cell culture medium that lead to an exogenous selective pressure. In some embodiments, the exogenous selective pressure leads to suppression of a protein essential for the survival and/or proliferation of a cell. In some embodiments, the exogenous selective pressure is based on addition of methotrexate to the cell culture medium.


In some embodiments, the decreasing activity can be permanently or transiently. In some embodiments, the decreasing activity or suppression is accomplished by a permanent or transient reduction in the amount or level of the essential protein in the cell. In some embodiments, the level of protein remains the same, but the functionality of the protein is decreased or suppressed. In some embodiments, the decreasing activity or suppression is accomplished by a permanent or transient reduction in the functional activity of the cell with or without reducing the level of the protein in the cell. In some embodiments, the decreasing activity or suppression is accomplished by a permanent or transient reduction in the functional activity of the cell without separately altering the level of the protein in the cell. In permanent embodiments, the gene encoding the essential protein can be knocked out, which permanently removes the essential gene from the cell's genome. In some embodiments, the knock-out is mediated by CRISPR/Cas9 Ribonucleoprotein (RNP), TALEN, MegaTAL, or any other nucleases.


In transient embodiments, the activity of the essential protein can be suppressed transiently. In some embodiments, the transient suppression is through siRNA, miRNA, or CRISPR interference (CRISPRi), where the activity of the essential protein is suppressed at RNA level. In some embodiments, the transient suppression is through a protein inhibitor, which suppress the activity of the essential protein at protein level. The activity of the essential protein will restore once the siRNA, miRNA, CRISPR interference (CRISPRi), or protein inhibitor are removed from the cell growth/culture environment.


In some embodiments, the essential protein is DHFR and the transient suppression is by methotrexate. Methotrexate is a protein inhibitor that competitively inhibits DHFR, an enzyme that participates in the synthesis of tetrahydrofolate, which is thought to be required in the synthesis of DNA, RNA, thymidylates, and proteins. Thus, cells with DHFR suppressed will not be able to survive or proliferate.


In some embodiments, the cell is a T cell, NK cell, NKT cell, iNKT cell, hematopoietic stem cell, mesenchymal stem cell, iPSC, neural precursor cell, a cell type in retinal gene therapy, or any other cell.


In some embodiments, the first-part nucleotide sequence is altered in nucleotide sequence to achieve nuclease, siRNA, miRNA, or CRISPRi resistance, but encodes a protein having an identical amino acid sequence to the first protein. For example, SEQ ID NO: 1 (FIG. 34) is a first-part nucleotide sequence that has altered nucleotide sequence than endogenous DHFR gene. SEQ ID NO: 1 is created by point mutating certain nucleotides in the endogenous DHFR gene. The altered nucleotide sequence renders SEQ ID NO: 1 nuclease resistant. However, the DHFR protein encoded by SEQ ID NO: 1 has an identical amino acid sequence to the endogenous DHFR protein, thus has an identical function.


In some embodiments, the first-part nucleotide sequence is altered in nucleotide sequence to encode an altered protein that does not have an identical amino acid sequence to the first protein. The altered protein can have an adjusted functionality to the first protein. In some embodiments, the altered protein has specific features that the first protein does not have. In some embodiments, the specific features include, but are not limited to, one or more of the following: reduced activity, increased activity, altered half-life, resistance to small molecule inhibition, and increased activity after small molecule binding. For example, SEQ ID NO: 2 (FIG. 35) is created by point mutating certain nucleotides in the endogenous DHFR gene and SEQ ID NO: 2 encodes an altered DHFR protein with an amino acid sequence different than that of the endogenous DHFR. The altered DHFR protein has similar activity to the endogenous DHFR but is resistant to MTX, a protein inhibitor.


In some embodiments, the at least one nucleotide sequence is operable for expressing both the first-part and second-part nucleotide sequences. A nucleotide sequence is operable for expression when it has all the elements for gene transcription. The elements include, but are not limited to, a promoter, an enhancer, a TATA box, and a poly(A) termination signal. In some embodiments, one or more of these is optional. In some embodiments, both the first-part and second-part nucleotide sequences can be driven by a same promoter or different promoters.


In some embodiments, the two part nucleotide sequence is capable of expressing both the first-part and second-part nucleotide sequences in the cell. A nucleotide sequence is capable of expression if (i) it is operable for expression in a cell or (ii) will become operable for expression in the cell when inserted at a pre-determined site in the target genome because it will have or be operably linked with all the elements for gene transcription. The elements include, but are not limited to, a promoter, an enhancer, a TATA box, and a poly(A) termination signal. Not all elements may be necessary in all circumstances for expression. In some embodiments, both the first-part and second-part nucleotide sequences can be driven by a same promoter and/or upstream sequences (e.g., an enhancer) or different promoters and/or upstream sequences (e.g., an enhancer).


In some embodiments, the second-part nucleotide sequence comprises at least a therapeutic gene. A therapeutic gene is a gene that is used as a drug to treat a disease. For example, genes encoding T cell receptors that target specific cancer antigens can be used as a therapeutic gene. In some embodiments, the second-part nucleotide sequence encodes a neo-antigen T-cell receptor complex (TCR) containing a TCR alpha chain and a TCR beta chain.


In some embodiments, the first-part nucleotide sequence comprises a nuclease-resistant, siRNA-resistant, or protein inhibitor-resistant DHFR gene, and the second-part nucleotide sequence comprises a TRA gene and a TRB gene. For example, SEQ ID NO: 3 (FIG. 36) is a DNA sequence that encodes a wildtype human DHFR; SEQ ID NO: 4 (FIG. 37) is a codon-optimized and nuclease-resistant DNA sequence that encodes a wildtype human DHFR; SEQ ID NO: 5 (FIG. 38) is a codon-optimized DNA sequence that encodes a MTX-resistant human DHFR mutant. In some embodiments, the protein inhibitor-resistant DHFR gene is a methotrexate-resistant DHFR gene.


In some embodiments, the TRA, TRB, and DHFR genes are operably configured to be expressed from a single open reading frame. One advantage of this arrangement is that if the cells express DHFR and survive in the normal cell culture medium, the cells also express TRA and TRB genes and can be used for downstream applications, such as TCR therapy.


In some embodiments, the TRA, TRB, and DHFR genes are separated by linkers. These linkers allow multiple genes under a single open reading frame to be expressed. In some embodiments, the order of the linkers, TRA, TRB, and DHFR genes is in the following order:

    • TRA-linker-TRB-linker-DHFR,
    • TRA-linker-DHFR-linker-TRB,
    • TRB-linker-TRA-linker-DHFR,
    • TRB-linker-DHFR-linker-TRA,
    • DHFR-linker-TRA-linker-TRB, or
    • DHFR-linker-TRB-linker-TRA.


In some embodiments, the linkers are self-cleaving 2A peptides or IRES elements. Both self-cleaving 2A peptides and IRES elements allow multiple genes under a single open reading frame to be expressed.


In some embodiments, the DHFR, TRA, and TRB genes are driven by an endogenous TCR promoter or any other suitable promoters including, but not limited to the following promoters: TRAC, TRBC1/2, DHFR, EEF1A1, ACTB, B2M, CD52, CD2, CD3G, CD3D, CD3E, LCK, LAT, PTPRC, IL2RG, ITGB2, TGFBR2, PDCD1, CTLA4, FAS, TNFRSF1A (TNFR1), TNFRSF10B (TRAILR2), ADORA2A, BTLA, CD200R1, LAG3, TIGIT, HAVCR2 (TIM3), VSIR (VISTA), IL10RA, IL4RA, EIF4A1, FTH1, FTL, HSPA5, and PGK1.


In some embodiments, the two-part nucleotide sequence is integrated into the genome of the cell. In some embodiments, the integration is through nuclease-mediated site-specific integration, transposon-mediated gene delivery, or virus-mediate gene delivery. In some embodiments, the nuclease-mediated site-specific integration is through CRISPR/Cas9 RNP. Some embodiments further include using the split intein system, where the essential protein or first protein can be split into a dysfunctional N-terminal and C-terminal protein half, each fused to a homo- or heterodimerizing protein partner or to a split intein. Functional reconstitution of the essential protein or the first protein is then only possible when both protein halves are co-expressed in the same cell. In some embodiments, the essential or first protein is a DHFR protein. (Pelletier J N, Campbell-Valois F X, Michnick S W. Oligomerization domain-directed reassembly of active dihydrofolate reductase from rationally designed fragments. Proc. Natl. Acad. Sci. USA. 1998 Oct. 13; 95(21):12141-6; and Remy I, Michnick S W. Clonal selection and in vivo quantitation of protein interactions with protein-fragment complementation assays. Proc. Natl. Acad. Sci. USA. 1999 May 11; 96(10):5394-9, both of which are hereby expressly incorporated by reference in their entireties for any purpose.)


In some embodiments, the introduced two-part nucleotide sequence is not integrated into the genome of the cell.


In some embodiments, a CRISPR/Cas9 RNP that targets the endogenous TCR Constant locus, the first-part nucleotide sequence encoding a nuclease-resistant DHFR gene, and the second-part nucleotide sequence encoding a neo-antigen TCR are delivered to the cell. In some embodiments, the endogenous TCR constant locus can be a TCR alpha Constant (TRAC) locus or a TCR beta Constant (TRBC) locus. In some embodiments, the delivery is by electroporation, or methods based on mechanical or chemical membrane permeabilization.


In some embodiments, a first CRISPR/Cas9 RNP is used to knock-out endogenous dihydrofolate reductase (DHFR) gene, and a second CRISPR/Cas9 RNP is used to knock-in into an endogenous TCR constant locus the first-part nucleotide sequence comprising the CRISPR/Cas9 nuclease-resistant DHFR gene and the second-part nucleotide sequence encoding a therapeutic TCR gene. In these embodiments, the endogenous dihydrofolate reductase (DHFR) is no longer being expressed, the introduced nuclease-resistant DHFR gene has alteration in the nucleotide sequence but not in the corresponding protein sequence. In some embodiments, the second CRISPR/Cas9 RNP is a TRAC RNP that cuts the TRAC locus for knock-in.


In some embodiments, methotrexate is used to inhibit the first protein, and a CRISPR/Cas9 RNP is used to knock-in into an endogenous TCR constant locus the first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and the second-part nucleotide sequence comprising a therapeutic TCR gene. In these embodiments, the endogenous first protein is still being expressed, but its activity has been inhibited by methotrexate; and the introduced nucleotide sequence encodes a DHFR protein that is methotrexate-resistant.


Some embodiments described herein relate to a cell that is made according to any of the methods disclosed herein.


In some embodiments, a cell includes i) endogenous dihydrofolate reductase (DHFR) being suppressed to a level that the cell cannot survive and/or proliferate in a normal cell culture medium, and ii) at least a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding DHFR and a second-part nucleotide sequence encoding a neo-antigen T-cell receptor complex.


Some embodiments described herein relate to a method for enrichment of a genetically engineered cell. The method can include i) introducing at least a two-part nucleotide sequence that is operable for expression in the cell and comprises a first-part nucleotide sequence encoding the first protein and a second-part nucleotide sequence encoding a second protein to be expressed, wherein the second-part protein is exogenous to the cell, and ii) culturing the cell in cell culture medium containing at least one supplement leading to enrichment of the cell that expresses both the first protein and the second protein.


In some embodiments, the genetically engineered cell is a primary human T cell. In some embodiments, the supplement impairs survival and/or proliferation of cells without expressing both the first protein and the second protein. In some embodiments, at least one protein mediates resistance of the cell to the supplement mediated impairment of survival and/or proliferation of cells. In some embodiments, the supplement is methotrexate. In some embodiments, the first protein is a methotrexate-resistant DHFR mutant protein.


In some embodiments, the second protein is a T cell receptor. In some embodiments, the T cell receptor is specific for a viral or a tumor antigen. In some embodiments, the first-part nucleotide sequence is altered in nucleotide sequence to achieve nuclease, siRNA, miRNA, or CRISPRi resistance.


In some embodiments, expression of the at least a two-part nucleotide sequence is achieved by site-specific integration into an endogenous gene locus of the cell. In some embodiments, site-specific integration into an endogenous gene locus of the cell is achieved by using CRISPR/Cas9, TALEN, MegaTAL or any other nuclease that allows for traceless integration into a gene locus to enable expression from the endogenous promotor of the gene locus.


In some embodiments, the nuclease allows for in-frame exonic integration of the two-part nucleotide sequence into a gene locus to enable expression from the endogenous promotor, the endogenous splice sites, and the endogenous transcription termination signal. In this configuration, the elements controlling the expression of the two-part nucleotide sequence are all endogenous elements. Exonic integration refers to the situation where the two-part nucleotide sequence is integrated into an exon of the gene locus. The diagram of some of these embodiments can be found in FIG. 24.


In some embodiments, the nuclease allows for in-frame exonic integration of the two-part nucleotide sequence into a gene locus to enable expression from the endogenous promotor, the endogenous splice sites, and an exogenous transcription termination signal. In this configuration, the elements controlling the expression of the two-part nucleotide sequence are a mixture of endogenous and exogenous elements. The diagram of some of these embodiments can be found in FIG. 25.


In some embodiments, the nuclease allows for intronic integration of the two-part nucleotide sequence into a gene locus to enable expression from the endogenous promotor, an exogenous splice acceptor site, and an exogenous transcription termination signal. In this configuration, the elements controlling the expression of the two-part nucleotide sequence are a mixture of endogenous and exogenous elements. Intronic integration refers to the situation where the two-part nucleotide sequence is integrated into an intron of the gene locus. The diagram of these embodiments can be found in FIG. 26.


In some embodiments, a CRISPR/Cas9 RNP is used to knock-in into an endogenous TCR constant locus the first-part nucleotide sequence encoding a methotrexate-resistant DHFR mutant protein and the second-part nucleotide sequence comprising a therapeutic TCR gene.


Some embodiments further include a second CRISPR/Cas9 RNP that is used to knock-out the endogenous TRAC or TRBC gene.


Some embodiments described herein relate to a method for enrichment of a genetically engineered T cell. The method includes i) introducing a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor complex or Chimeric antigen receptor in the T cell by integration of the two-part nucleotide sequence downstream of the TRA or TRB promotor, and ii) culturing the cell in cell culture medium containing methotrexate (25 nM to 100 nM) leading to enrichment of the cell that expresses both the first protein and the second protein.


Some embodiments described herein relate to a method for enrichment of a T cell engineered to express an exogenous T cell receptor gene. The method includes i) knocking-out an endogenous TRBC gene from its locus using a first CRISPR/Cas9 RNP; ii) knocking-in, using a second CRISPR/Cas9 RNP, into the endogenous TRAC locus a first-part nucleotide sequence encoding a methotrexate-resistant DHFR gene and the second-part nucleotide sequence comprising a therapeutic TCR gene, wherein both nucleotide sequences are operably linked allowing for expression from the endogenous TRAC promotor; and iii) culturing the cells in cell culture medium containing methotrexate leading to enrichment of T cells that express both the therapeutic TCR and the methotrexate-resistant DHFR gene.


Some embodiments described herein relate to a T cell, which include i) an endogenous dihydrofolate reductase (DHFR) being suppressed by the presence of methotrexate to a level that the cell cannot survive and/or proliferate, and ii) at least a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor.


In some embodiments, a method for selection of a genetically engineered cell comprises i) introducing at least two two-part nucleotide sequences that are operable for expression in a cell. The cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate. The first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a protein to be expressed. The second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a protein to be expressed. Both the first and second fusion proteins can be expressed together in a cell, and the function of the essential protein for the survival and/or proliferation is restored by that co-expression. The method further comprises ii) culturing the cell under conditions leading to the selection of the cell that expresses both the first and second two-part nucleotide sequences. In some embodiments, one or more of the above processes can be repeated and/or omitted and/or modified with any of the other embodiments provided herein.


In some embodiments, a method for enrichment of a genetically engineered cell comprises: i) decreasing activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions; and ii) introducing at least two two-part nucleotide sequences that are operable for expression in a cell. The first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a protein to be expressed. The second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a protein to be expressed. Both the first and second fusion proteins can be expressed together in a cell, and the function of the essential protein for the survival and/or proliferation is restored by that co-expression. The method can further comprise iii) culturing the cell under in vitro propagation conditions that lead to the enrichment of the cell that expresses both the first fusion protein and second fusion protein. In some embodiments, one or more of the above processes can be repeated and/or omitted and/or modified with any of the other embodiments provided herein.


Some embodiments described herein relate to a method for the selection of a genetically engineered cell. The term “cell” as used herein can refer to any single cell, multiple cells, or cell line from any organism. In some embodiments, the cell is eukaryotic. In some embodiments, the cell is mammalian. In some embodiments, the cell is a primary cell or from a primary tissue. In some embodiments, the cell is derived from an established cell line. In some embodiments, the cell is mouse, rat, non-human primate, or human. It will be understood that the cell may be from any cell, tissue, organ, or organ system type. Non-limiting examples of a cell include a T cell, CD4+ T cell, CD8+ T cell, CAR T Cell, B cell, immune cell, nerve cell, muscle cell, epithelial cell, connective tissue cell, stem cell, bone cell, blood cell, endothelial cell, fat cell, sex cell, kidney cell, lung cell, brain cell, heart cell, root hair cell, pancreatic cell, and cancer cell.


In some embodiments, the method comprises introducing at least one nucleotide sequence that is operable for expression in a cell. In some embodiments, the method comprises introducing at least two, at least three, at least four, at least five, at least ten sequences, or at least twenty nucleotide sequences.


In some embodiments, the at least one nucleotide sequence comprises a single part. In some embodiments, the at least one nucleotide sequence comprises at least two parts. In some embodiments, the nucleotide sequences comprises at least three parts. In some embodiments, the nucleotide sequences comprises at least four parts. In some embodiments, the nucleotide sequences comprises at least five parts. In some embodiments, the nucleotide sequences comprises ten parts. In some embodiments, the nucleotide sequences comprises twenty parts.


In some embodiments, an at least one protein and/or cellular process essential for survival and/or proliferation of the cell is otherwise suppressed in the cell to a level that the cell cannot survive and/or proliferate independently. It will be understood by those skilled in the art that an “essential” protein or cellular system may be any protein or cellular system that influences growth, replication, cell cycle, gene regulation (including DNA repair, transcription, translation, and replication), stress response, metabolism, apoptosis, nutrient acquisition, protein turnover, cell surface integrity, essential enzyme activity, survival, or any combination thereof in a given cell. It will also be understood that the term “suppression” may apply to any phenotype from a significant increase in one or more occurrence of cell death, metabolic arrest, cell cycle arrest, stress induction, protein turnover arrest, DNA stress, and/or growth arrest compared to a control, to complete cell death, metabolic arrest, cell cycle arrest, stress induction, protein turnover arrest, DNA stress, and/or growth arrest compared to a control. In some embodiments, suppression can be partial or complete (e.g., a protein may be reduced in level or have its functional activity reduced by at least about some detectable amount, including, but not limited to 50%, 75%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%). In some embodiments, suppression is accomplished by reducing the level or amount of a protein in the cell (e.g., knock-out, gene silencing, siRNA, CRISPRi, miRNA, shRNA). In some embodiments, suppression is accomplished by reducing the functional activity of a protein (e.g., small molecule inhibitors of protein function, antibodies that block binding, mutations that reduce the function of a protein) with or without altering the level of protein in the cell.


In some embodiments, the nucleotide sequence comprises an at least one sequence encoding a fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a binding domain. In some embodiments, the first part of a nucleotide sequence comprises an at least one sequence encoding a fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a binding domain. In some embodiments, the second-part of the nucleotide sequence comprises an at least one sequence encoding an at least one protein to be expressed.


In some embodiments, the nucleotide sequence comprises an at least one sequence encoding a second fusion protein comprising a second non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second nucleotide sequence encoding the at least one protein to be expressed. In some embodiments, the second part of the nucleotide sequence comprises an at least one sequence encoding a second fusion protein comprising a second non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second nucleotide sequence encoding the at least one protein to be expressed. In some embodiments, the fusion proteins, when expressed together in a cell, result in the successful expression of an at least one essential protein. This returns the functionality of the essential protein to the cell, allowing the cell to survive. While many of the examples disclosed herein relate to two fusion proteins combining, it will be understood to those skilled in the art that the same method disclosed herein can be used under a multitude of various fusion proteins that can successfully combine into an at least one essential protein.


As disclosed herein, in some embodiments, when the first and second fusion proteins are expressed together in a cell, the function of the at least one essential protein for the survival and/or proliferation is restored. In some embodiments, when the first and second fusion proteins are expressed together in a cell, the function of the at least one essential cellular process for the survival and/or proliferation is restored. In some embodiments, the at least one essential protein or cellular process is the same essential protein or cellular process as the suppressed protein or cellular process. In some embodiments, the at least one essential protein comprises similar activity as the suppressed protein. In some embodiments, the at least one essential protein functions in the at least one suppressed cellular pathway or process. In some embodiments, the at least one essential protein functions in at least two essential cellular pathways or processes. In some embodiments, the expression of the at least one essential protein alleviates, activates, restores, or diminishes the suppression phenotype of the suppressed protein and/or cellular process. In some embodiments, the survival and/or proliferation of the cell is increased upon expression of the at least one essential protein. In some embodiments, the survival and/or proliferation of the cell is fully restored upon expression of the at least one essential protein.


In some embodiments, the method further comprises culturing the cell under conditions leading to the selection of the cell. In some embodiments, the selection comprises the expression of the at least one essential protein encoded on the nucleotide sequence. In some embodiments, the selection comprises the expression of both the first and second two-part nucleotide sequences encoded on the nucleotide sequence.


In some embodiments, the essential protein is a DHFR protein. In some embodiments, the essential protein is a protein that has at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or about 100% identity to DHFR. In some embodiments, the protein is mammalian DHFR. In some embodiments, the protein is human DHFR. In some embodiments, the protein is a DHFR analog.


In some embodiments, the nucleotide sequence is exogenous to the cell. In some embodiments, the nucleotide sequence of either the first and/or second two-part nucleotide sequences is exogenous to the cell. In some embodiments, the first-part nucleotide sequence of either the first and/or second two-part nucleotide sequences is exogenous to the cell. In some embodiments, the second-part nucleotide sequence of either the first or second two-part nucleotide sequences is exogenous to the cell. In some embodiments, the nucleotide sequence of the first and/or second two-part nucleotide sequence is a TCR. In some embodiments, the first-part nucleotide sequence of the first and/or second two-part nucleotide sequence is a TCR. In some embodiments, the second-part nucleotide sequence of the first and/or second two-part nucleotide sequence is a TCR.


In some embodiments, at least one of the first and/or second binding domains is derived from GCN4. In some embodiments, the binding domain is derived from a protein that has at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or about 100% identity to GCN4. In some embodiments, the binding domain is derived from a protein that is mammalian GCN4. In some embodiments, the binding domain is derived from a protein that is human GCN4. In some embodiments, the binding domain is derived from a protein that is a GCN4 analog.


In some embodiments, at least one of the first and/or second binding domains is derived from FKBP12. In some embodiments, the binding domain is derived from a protein that has at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or about 100% identity to FKBP12. In some embodiments, the binding domain is derived from a protein that is mammalian FKBP12. In some embodiments, the binding domain is derived from a protein that is human FKBP12. In some embodiments, the binding domain is derived from a protein that is a FKBP12 analog. In some embodiments, the FKBP12 has an F36V mutation. In some embodiments, FKBP12 binding is induced. (Straathof K C, Pulé M A, Yotnda P, Dotti G, Vanin E F, Brenner M K, Heslop H E, Spencer D M, Rooney C M. An inducible caspase 9 safety switch for T-cell therapy. Blood. 2005 Jun. 1: 105(11):4247-54, hereby expressly incorporated by reference in its entirety for any purpose.)


In some embodiments, at least one of the first and/or second binding domains is derived from JUN. In some embodiments, the binding domain is derived from a protein that has at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or about 100% identity to JUN. In some embodiments, the binding domain is derived from a protein that is mammalian JUN. In some embodiments, the binding domain is derived from a protein that is human JUN. In some embodiments, the binding domain is derived from a protein that is a JUN analog.


In some embodiments, at least one of the first and/or second binding domains is derived from FOS. In some embodiments, the binding domain is derived from a protein that has at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or about 100% identity to FOS. In some embodiments, the binding domain is derived from a protein that is mammalian FOS. In some embodiments, the binding domain is derived from a protein that is human FOS. In some embodiments, the binding domain is derived from a protein that is a FOS analog. In some embodiments, the first binding domain is derived from JUN and the second binding domains is derived from FOS. In some embodiments, JUN and FOS have complementary changes that promote binding to each other relative to wild-type JUN and FOS. (Glover J N, Harrison S C. Crystal structure of the heterodimeric bZIP transcription factor c-Fos-c-Jun bound to DNA. Nature. 1995 Jan. 19; 373(6511):257-61, and Glover and Harrison, Nature 1995. Jerome and Muller, Gene Ther 2001, and Jérôme V, Muller R. A synthetic leucine zipper-based dimerization system for combining multiple promoter specificities. Gene Ther. 2001 May; 8(9):725-9 both of which are hereby expressly incorporated by reference in their entireties for any purpose)


In some embodiments, the first binding domain and second binding domain have complementary mutations that preserve binding to each other. In some embodiments, the first binding domain does not bind to a native binding partner. In some embodiments, the second binding domain does not bind to a native binding partner. In some embodiments, neither the first binding domain nor the second binding domain bind to a native binding partner. In some embodiments, at least one of the first binding domain and/or second binding domain have between 3 and 7 complementary mutations. In some embodiments, at least one of the first binding domain and/or second binding domain have 3 or more complementary mutations. In some embodiments, at least one of the first binding domain and/or second binding domain have 4 or more complementary mutations. In some embodiments, at least one of the first binding domain and/or second binding domain have 5 or more complementary mutations. In some embodiments, at least one of the first binding domain and/or second binding domain have 6 complementary mutations. In some embodiments, at least one of the first binding domain and/or second binding domain have 7 complementary mutations. In some embodiments, the first binding domain has a different number of complementary mutations than the second binding domain. In some embodiments, the complementary mutations are one or more charge pair (or charge switch) mutations, such that paired charges are maintained in the structure, but the positions charges are reversed between the pairs of residues. For example, in a situation where there are a first residue associated with a second residue via a charge interaction, and where the first residue is a positively charged residue and the second residue is a negatively charged residue, the charge can be switched such that the first residue is a negatively charged residue and the second residue is a positively charged residue. In some embodiments, the first residue and second residue may reside on the same protein. In some embodiments, the first residue and second residue reside on different proteins.


In some embodiments, the restoration of the function of the essential protein is induced. In some embodiments, the restoration of the function of the essential protein is induced by a dimerizer agent. The term “dimerizer agent” as used herein has its ordinary meaning as commonly understood to one of ordinary skill in the art, and includes any small molecule or protein that cross-links two or more domains. A non-limiting example of a dimerizer agent is AP1903. As understood to one of skill in the art given the present disclosure, when restoration of the function of the essential protein is induced by a dimerizer agent, the dimerizer agent or inducer is not considered an exogenous selection pressure.


In some embodiments, the culturing step is done in the presence of at least one of a cell cycle inhibitor, growth inhibitor, DNA replication inhibitor, metabolic inhibitor, gene expression inhibitor, or stress inhibitor. In some embodiments, the culturing step is done in the presence of methotrexate.


Some embodiments described herein relate to a method for enrichment of a genetically engineered cell. The term “enrichment” as used herein has its ordinary meaning as commonly understood to one of ordinary skill in the art, and includes enhancing the ratio of a desired cell type within a population of cells. Nonlimiting examples of enrichment include purifying a desired cell type out of a population, increasing the numbers of a desired cell type, and decreasing the numbers of an undesired cell type. In some embodiments, the method comprises decreasing activity of an at least first protein or cellular process that is essential for the survival and/or proliferation of a cell to the level such that the cell cannot survive and/or proliferate under normal in vitro propagation conditions. For example, a cell that has the activity of DHFR decreased by methotrexate cannot survive and/or proliferate under normal in vitro propagation conditions as extra supplements to the in vitro propagation conditions (e.g., hypoxanthine and thymidine (HT) may be required. Thus, as will be appreciated by one of skill in the art given the disclosure herein, in this context, normal conditions (or similar phrases) denote conditions that do not provide specific components that compensate for the specifically denoted alteration(s). As noted herein, this may be any protein or cellular system that influences growth, replication, cell cycle, gene regulation (including DNA repair, transcription, translation, and replication), stress response, metabolism, apoptosis, nutrient acquisition, protein turnover, cell surface integrity, essential enzyme activity, or any combination thereof in a given cell. It will also be understood that the term “suppression” can apply to any phenotype from a significant increase in one or more occurrence of cell death, metabolic arrest, cell cycle arrest, stress induction, protein turnover arrest, DNA stress, and/or growth arrest compared to a control, to complete cell death, metabolic arrest, cell cycle arrest, stress induction, protein turnover arrest, DNA stress, and/or growth arrest compared to a control.


In some embodiments, the method further comprises introducing the at least one nucleotide sequence disclosed herein that is operable for expression in a cell. In some embodiments, the nucleotide sequence comprises at least two parts. As noted herein, these parts function together towards the expression of an at least one essential protein. It will be understood that there can be any number of parts that will work together for the expression of an at least one essential protein.


In some embodiments, the nucleotide sequence comprises an at least one sequence encoding a fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a binding domain. In some embodiments, the first part of a nucleotide sequence comprises an at least one sequence encoding a fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a binding domain. In some embodiments, the second-part of the nucleotide sequence comprises an at least one sequence encoding an at least one protein to be expressed.


In some embodiments, the nucleotide sequence comprises an at least one sequence encoding a second fusion protein comprising a second non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second nucleotide sequence encoding the at least one protein to be expressed. In some embodiments, the second part of the nucleotide sequence comprises an at least one sequence encoding a second fusion protein comprising a second non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second nucleotide sequence encoding the at least one protein to be expressed. In some embodiments, the fusion proteins expressed together in a cell result in the successful expression of an at least one essential protein. While many of the examples disclosed herein relate to two fusion proteins combining, it will be understood to those skilled in the art that the same method disclosed herein can be used under any number of fusion proteins that can successfully combine into an at least one essential protein.


In some embodiments, when the first and second fusion proteins are expressed together in a cell, the function of the at least one essential protein for the survival and/or proliferation is restored. As disclosed herein, in some embodiments, when the first and second fusion proteins are expressed together in a cell, the function of the at least one essential cellular process for the survival and/or proliferation is restored. In some embodiments, the at least one essential protein or cellular process is the same essential protein or cellular process as the suppressed protein or cellular process. In some embodiments, the at least one essential protein comprises similar activity as the suppressed protein. In some embodiments, the at least one essential protein functions in the at least one suppressed cellular pathway or process. In some embodiments, the at least one essential protein functions in at least two essential cellular pathways or processes. In some embodiments, the expression of the at least one essential protein alleviates, activates, restores, or diminishes the suppression phenotype of the suppressed protein and/or cellular process. In some embodiments, the survival and/or proliferation of the cell is increased upon expression of the at least one essential protein. In some embodiments, the survival and/or proliferation of the cell is fully restored upon expression of the at least one essential protein.


In some embodiments, the method further comprises culturing the cell under in vitro propagation conditions that lead to the enrichment of the cell that expresses both the first fusion protein and second fusion protein.


In some embodiments one or more of the constructs, sequences, or subsequences within any one or more of Tables 1-5 can be employed in the present embodiments and/or arrangements and/or methods and/or compositions provided herein.









TABLE 1







Target sequences for gRNAs









Description
Sequence targeted
SEQ ID NO:





DHFR sgRNA-1
tgattatgggtaagaagacc
10





DHFR sgRNA-2
AACCTTAGGGAACCTCCACA
11





DHFR sgRNA-3
Cggcccggcagatacctgag
12





DHFR sgRNA-4
Gacatggtctggatagttgg
13





DHFR sgRNA-5
gtcgctgtgtcccagaacat
14





DHFR sgRNA-6
cagatacctgagcggtggcc
15





DHFR sgRNA-7
cacattaccttctactgaag
16





DHFR sgRNA-8
cgtcgctgtgtcccagaaca
17





DHFR sgRNA-9
accacaacctcttcagtaga
18





DHFR sgRNA-10
aaattaattctaccctttaa
19





TRAC sgRNA
GAGAATCAAAATCGGTGAAT
20





B2M
GAGTAGCGCGAGCACAGCTA
21
















TABLE 2







Fusion proteins and related elements











SEQ


Description
Sequence
ID NO:





mDHFRmt-A
MVRPLNCIVAVSQNMGIGKNGDFPWPPLRNESKYFQR
22


(N-term)
MTTTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVL




SRELKEPPRGAHFLAKSLDDALRLIEQPEL






mDHFRmt-B
ASKVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEF
23


(C-term)
ESDTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKFEV




YEKKD






GCN4
NTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEV
24



ARLKKLVGER






JUN
RIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKV
25



MNH






JUNMUT3AA
RIARLEEEVKTLEAQNSELASTANMLEEQVAQLKQKV
26



MNH






JUNMUT4AA
RIARLEEEVKTLEAQNSELASTANMLEEQVAQLEQKV
27





FOS
LTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAA
28



H






FOSMUT3AA
LTDTLQAKTDQLKDEKSALQTRIANLLKEKEKLEFILAA
29



H






FOSMUT4AA
LTDTLQAKTDQLKDEKSALQTRIANLLKKKEKLEFIL
30





FKBP12F36V
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVD
31



SSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKL




TISPDYAYGATGHPGIIPPHATLVFDVELLKLE






dn-TGFBR2
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMIV
32



TDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSIC




EKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILED




AASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYN




TSNPDLLLVIFQVTGISLLPPLGVAISVIIIFYCYRV






Linker 1
GGGGSGGGGS
33





Linker 2
SGGGS
34





JUNMUT3AA-
RIARLEEEVKTLEAQNSELASTANMLEEQVAQLKQKVG
35


mDHFR_A
GGGSGGGGSMVRPLNCIVAVSQNMGIGKNGDFPWPPL




RNESKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNR




PLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPEL






FOSMUT3AA-
LTDTLQAKTDQLKDEKSALQTRIANLLKEKEKLEFILGG
36


mDHFR_B
GGSGGGGSASKVDMVWIVGGSSVYQEAMNQPGHLRLF




VTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEK




GIKYKFEVYEKKD






juNMUT4AA-
RIARLEEEVKTLEAQNSELASTANMLEEQVAQLEQKVG
37


mDHFR_A
GGGSGGGGSMVRPLNCIVAVSQNMGIGKNGDFPWPPL




RNESKYFQRMTTTSSVEGKQNLVIMGRKTWFSIPEKNR




PLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIEQPEL






FOSMUT4AA_
LTDTLQAKTDQLKDEKSALQTRIANLLKKKEKLEFILGG
38


mDHFR_B
GGSGGGGSASKVDMVWIVGGSSVYQEAMNQPGHLRLF




VTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQEEK




GIKYKFEVYEKKD






GCN4-
NTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEV
39


mDHFRmt_A
ARLKKLVGERGGGGSGGGGSMVRPLNCIVAVSQNMGI




GKNGDFPWPPLRNESKYFQRMTTTSSVEGKQNLVIMGR




KTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLD




DALRLIEQPEL






GCN4-
NTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEV
40


mDHFRmt_B
ARLKKLVGERGGGGSGGGGSASKVDMVWIVGGSSVY




QEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLP




EYPGVLSEVQEEKGIKYKFEVYEKKD






JUN-
RIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKV
41


mDHFRmt_A-
MNHGGGGSGGGGSMVRPLNCIVAVSQNMGIGKNGDFP



2A
WPPLRNESKYFQRMTTTSSVEGKQNLVIMGRKTWFSIP




EKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIE




QPELGSGATNFSLLKQAGDVEENPGP






FOS-
LTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAA
42


mDHFRmt_B-
HGGGGSGGGGSASKVDMVWIVGGSSVYQEAMNQPGH



2A
LRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQ




EEKGIKYKFEVYEKKDGSGATNFSLLKQAGDVEENPGP






JUN-
RIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKV
43


mDHFRmt_A
MNHGGGGSGGGGSMVRPLNCIVAVSQNMGIGKNGDFP




WPPLRNESKYFQRMTTTSSVEGKQNLVIMGRKTWFSIP




EKNRPLKDRINIVLSRELKEPPRGAHFLAKSLDDALRLIE




QPEL






FOS-
LTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAA
44


mDHFRmt_B
HGGGGSGGGGSASKVDMVWIVGGSSVYQEAMNQPGH




LRLFVTRIMQEFESDTFFPEIDLGKYKLLPEYPGVLSEVQ




EEKGIKYKFEVYEKKD






GCN4-
NTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEV
45


mDHFRmt_A-
ARLKKLVGERGGGGSGGGGSMVRPLNCIVAVSQNMGI



2A
GKNGDFPWPPLRNESKYFQRMTTTSSVEGKQNLVIMGR




KTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFLAKSLD




DALRLIEQPELGSGATNFSLLKQAGDVEENPGP






GCN4-
NTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEV
46


mDHFRmt_B-
ARLKKLVGERGGGGSGGGGSASKVDMVWIVGGSSVY



2A
QEAMNQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLP




EYPGVLSEVQEEKGIKYKFEVYEKKDGSGATNFSLLKQ




AGDVEENPGP






FKBP12F36V-
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVD
62


mDHFRMUT-A
SSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKL




TISPDYAYGATGHPGIIPPHATLVFDVELLKLESGGGSM




VRPLNCIVAVSQNMGIGKNGDFPWPPLRNESKYFQRMT




TTSSVEGKQNLVIMGRKTWFSIPEKNRPLKDRINIVLSRE




LKEPPRGAHFLAKSLDDALRLIEQPEL






FKBP12F36V-
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKVD
63


mDHFRMUT-B
SSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKL




TISPDYAYGATGHPGIIPPHATLVFDVELLKLESGGGSAS




KVDMVWIVGGSSVYQEAMNQPGHLRLFVTRIMQEFES




DTFFPEIDLGKYKLLPEYPGVLSEVQEEKGIKYKFEVYE




KKD
















TABLE 3







Knockin templates











SEQ


Description
Sequence
ID NO:





NY-ESO-1
GCCAGAGTTATATTGCTGGGGTTTTGAAGAAGATCCT
47


1G4 TCR
ATTAAATAAAAGAATAAGCAGTATTATTAAGTAGCCC




TGCATTTCAGGTTTCCTTGAGTGGCAGGCCAGGCCTGG




CCGTGAACGTTCACTGAAATCATGGCCTCTTGGCCAA




GATTGATAGCTTGTGCCTGTCCCTGAGTCCCAGTCCAT




CACGAGCAGCTGGTTTCTAAGATGCTATTTCCCGTATA




AAGCATGAGACCGTGACTTGCCAGCCCCACAGAGCCC




CGCCCTTGTCCATCACTGGCATCTGGACTCCAGCCTGG




GTTGGGGCAAAGAGGGAAATGAGATCATGTCCTAACC




CTGATCCTCTTGTCCCACAGATATCCAGAACCCTGACC




CTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGA




CAAGTCTGTCTGCCTATTCGGATCTGGCGCCACCAATT




TCAGCCTGCTGAAACAGGCTGGCGACGTGGAAGAGAA




CCCCGGACCTATGTCTATCGGCCTGCTGTGTTGTGCCG




CTCTGTCTCTGCTTTGGGCCGGACCTGTTAATGCCGGC




GTGACCCAGACACCTAAGTTCCAGGTGCTGAAAACCG




GCCAGAGCATGACCCTGCAGTGCGCCCAGGATATGAA




CCACGAGTACATGAGCTGGTACAGACAGGACCCTGGC




ATGGGCCTGAGACTGATCCACTATTCTGTCGGAGCCG




GCATCACCGACCAGGGCGAAGTTCCTAATGGCTACAA




CGTGTCCAGAAGCACCACCGAGGACTTCCCACTGAGA




CTGCTGTCTGCCGCTCCTAGCCAGACCAGCGTGTACTT




TTGTGCCAGCAGCTACGTGGGCAACACCGGCGAGCTG




TTTTTTGGCGAGGGCAGCAGACTGACCGTGCTGGAGG




ACCTGAAGAACGTGTTCCCTCCAAAGGTGGCCGTGTT




CGAGCCTTCTGAGGCCGAGATCAGCCACACACAGAAA




GCCACACTCGTGTGTCTGGCCACCGGCTTCTACCCCGA




TCACGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAG




GTGCACAGCGGCGTCAGCACAGATCCCCAGCCTCTGA




AAGAACAGCCCGCTCTGAACGACAGCCGGTACTGTCT




GAGCAGCAGACTGAGAGTGTCCGCCACCTTCTGGCAG




AACCCCAGAAACCACTTCAGATGCCAGGTGCAGTTCT




ACGGCCTGAGCGAAAACGACGAGTGGACCCAGGACA




GGGCCAAGCCTGTGACACAGATCGTGTCTGCCGAAGC




CTGGGGCAGAGCCGATTGTGGCTTTACCAGCGAGAGC




TACCAGCAGGGCGTGCTGTCTGCCACAATCCTGTACG




AGATCCTGCTGGGCAAAGCCACTCTGTACGCCGTGCT




GGTGTCTGCCCTGGTGCTGATGGCCATGGTCAAGCGG




AAGGATAGCAGAGGCGGCAGCGGCGAAGGCAGAGGC




TCTCTTCTTACATGCGGCGACGTCGAAGAAAATCCTG




GGCCTATGAAGTCCCTGCGGGTGCTGCTGGTTATCCTG




TGGCTGCAGCTGAGCTGGGTCTGGTCCCAGAAACAAG




AAGTGACTCAGATCCCAGCCGCTCTGAGTGTGCCTGA




GGGCGAAAACCTGGTCCTGAACTGCAGCTTCACCGAC




AGCGCCATCTACAACCTGCAGTGGTTCAGGCAGGATC




CCGGCAAGGGACTGACAAGCCTGCTGCTGATTCAGAG




CAGCCAGAGAGAGCAGACCTCCGGCAGACTGAATGCC




AGCCTGGATAAGAGCAGCGGCCGCAGCACACTGTATA




TCGCCGCTTCTCAGCCTGGCGATAGCGCCACATATCTG




TGTGCCGTGCGACCTCTGTACGGCGGCAGCTACATCC




CTACATTTGGCAGAGGCACCAGCCTGATCGTGCACCC




CTACATTCAGAACCCCGATCCTGCCGTGTATCAGCTGA




GAGACAGCAAGTCCAGCGACAAGAGCGTGTGTTTGTT




CACCGATTTTGATTCTCAAACAAATGTGTCACAAAGT




AAGGATTCTGATGTGTATATCACAGACAAAACTGTGC




TAGACATGAGGTCTATGGACTTCAAGAGCAACAGTGC




TGTGGCCTGGAGCAACAAATCTGACTTTGCATGTGCA




AACGCCTTCAACAACAGCATTATTCCAGAAGACACCT




TCTTCCCCAGCCCAGGTAAGGGCAGCTTTGGTGCCTTC




GCAGGCTGTTTCCTTGCTTCAGGAATGGCCAGGTTCTG




CCCAGAGCTCTGGTCAATGATGTCTAAAACTCCTCTGA




TTGGTGGTCTCGG






NY-ESO-1
GCCAGAGTTATATTGCTGGGGTTTTGAAGAAGATCCT
48


1G4 TCR and
ATTAAATAAAAGAATAAGCAGTATTATTAAGTAGCCC



DHFR
TGCATTTCAGGTTTCCTTGAGTGGCAGGCCAGGCCTGG




CCGTGAACGTTCACTGAAATCATGGCCTCTTGGCCAA




GATTGATAGCTTGTGCCTGTCCCTGAGTCCCAGTCCAT




CACGAGCAGCTGGTTTCTAAGATGCTATTTCCCGTATA




AAGCATGAGACCGTGACTTGCCAGCCCCACAGAGCCC




CGCCCTTGTCCATCACTGGCATCTGGACTCCAGCCTGG




GTTGGGGCAAAGAGGGAAATGAGATCATGTCCTAACC




CTGATCCTCTTGTCCCACAGATATCCAGAACCCTGACC




CTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGA




CAAGTCTGTCTGCCTATTCGGATCTGGCGCCACCAATT




TCAGCCTGCTGAAACAGGCTGGCGACGTGGAAGAGAA




CCCCGGACCTATGTCTATCGGCCTGCTGTGTTGTGCCG




CTCTGTCTCTGCTTTGGGCCGGACCTGTTAATGCCGGC




GTGACCCAGACACCTAAGTTCCAGGTGCTGAAAACCG




GCCAGAGCATGACCCTGCAGTGCGCCCAGGATATGAA




CCACGAGTACATGAGCTGGTACAGACAGGACCCTGGC




ATGGGCCTGAGACTGATCCACTATTCTGTCGGAGCCG




GCATCACCGACCAGGGCGAAGTTCCTAATGGCTACAA




CGTGTCCAGAAGCACCACCGAGGACTTCCCACTGAGA




CTGCTGTCTGCCGCTCCTAGCCAGACCAGCGTGTACTT




TTGTGCCAGCAGCTACGTGGGCAACACCGGCGAGCTG




TTTTTTGGCGAGGGCAGCAGACTGACCGTGCTGGAAG




ATCTGAACAAGGTGTTCCCTCCAGAGGTGGCCGTGTT




CGAGCCTTCTGAGGCCGAGATCAGCCACACACAGAAA




GCCACACTCGTGTGCCTGGCCACCGGCTTTTTTCCCGA




TCACGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAG




GTGCACAGCGGCGTCAGCACAGATCCCCAGCCTCTGA




AAGAACAGCCCGCTCTGAACGACAGCCGGTACTGTCT




GTCCTCCAGACTGAGAGTGTCCGCCACCTTCTGGCAG




AACCCCAGAAACCACTTCAGATGCCAGGTGCAGTTCT




ACGGCCTGAGCGAGAACGATGAGTGGACCCAGGATA




GAGCCAAGCCTGTGACACAGATCGTGTCTGCCGAAGC




CTGGGGCAGAGCCGATTGTGGCTTTACCTCCGTGTCCT




ATCAGCAGGGCGTGCTGAGCGCCACAATCCTGTATGA




GATCCTGCTGGGCAAAGCCACTCTGTACGCCGTGCTG




GTGTCTGCCCTGGTGCTGATGGCCATGGTCAAGAGAA




AGGACTTCGGCAGCGGCGAAGGCAGAGGCTCTCTTCT




TACATGCGGCGACGTCGAAGAAAATCCTGGGCCTATG




GTAGGCTCCCTGAACTGTATAGTTGCGGTATCCCAAA




ATATGGGGATTGGAAAGAACGGAGACCTTCCGTGGCC




GCCCCTCCGAAATGAATTTCGATACTTTCAGAGAATG




ACAACTACCTCATCTGTAGAGGGAAAGCAAAATCTGG




TTATCATGGGAAAGAAAACGTGGTTCTCTATCCCTGA




AAAAAACAGACCTCTCAAAGGCAGGATAAATTTGGTA




TTGTCAAGAGAATTGAAGGAACCGCCACAAGGAGCTC




ATTTTCTCAGCAGATCTCTGGACGATGCACTCAAACTC




ACCGAACAACCAGAACTTGCTAATAAGGTTGATATGG




TCTGGATAGTTGGGGGCAGCAGTGTATATAAGGAAGC




CATGAACCATCCTGGCCATCTGAAGCTGTTTGTTACGA




GGATAATGCAGGACTTCGAGTCCGACACTTTTTTCCCA




GAGATTGACTTGGAAAAGTATAAACTCTTGCCTGAGT




ATCCTGGGGTTCTCTCCGATGTCCAAGAGGAGAAAGG




TATTAAATATAAGTTTGAAGTTTATGAAAAAAACGAT




GGATCTGGCGCCACCAATTTCAGCCTGCTGAAACAGG




CTGGCGACGTGGAAGAGAACCCCGGACCTATGAAGTC




CCTGCGGGTGCTGCTGGTTATCCTGTGGCTGCAGCTGA




GCTGGGTCTGGTCCCAGAAACAAGAAGTGACTCAGAT




CCCAGCCGCTCTGAGTGTGCCTGAGGGCGAAAACCTG




GTCCTGAACTGCAGCTTCACCGACAGCGCCATCTACA




ACCTGCAGTGGTTCAGGCAGGATCCCGGCAAGGGACT




GACAAGCCTGCTGCTGATTCAGAGCAGCCAGAGAGAG




CAGACCTCCGGCAGACTGAATGCCAGCCTGGATAAGA




GCAGCGGCCGCAGCACACTGTATATCGCCGCTTCTCA




GCCTGGCGATAGCGCCACATATCTGTGTGCCGTGCGA




CCTCTGTACGGCGGCAGCTACATCCCTACATTTGGCAG




AGGCACCAGCCTGATCGTGCACCCCTACATTCAGAAC




CCCGATCCTGCCGTGTATCAGCTGAGAGACAGCAAGT




CCAGCGACAAGAGCGTGTGTTTGTTCACCGATTTTGAT




TCTCAAACAAATGTGTCACAAAGTAAGGATTCTGATG




TGTATATCACAGACAAAACTGTGCTAGACATGAGGTC




TATGGACTTCAAGAGCAACAGTGCTGTGGCCTGGAGC




AACAAATCTGACTTTGCATGTGCAAACGCCTTCAACA




ACAGCATTATTCCAGAAGACACCTTCTTCCCCAGCCCA




GGTAAGGGCAGCTTTGGTGCCTTCGCAGGCTGTTTCCT




TGCTTCAGGAATGGCCAGGTTCTGCCCAGAGCTCTGG




TCAATGATGTCTAAAACTCCTCTGATTGGTGGTCTCGG






NY-ESO-1
GCCAGAGTTATATTGCTGGGGTTTTGAAGAAGATCCT
49


1G4 TCR and
ATTAAATAAAAGAATAAGCAGTATTATTAAGTAGCCC



DHFRm
TGCATTTCAGGTTTCCTTGAGTGGCAGGCCAGGCCTGG



(methotrexate-
CCGTGAACGTTCACTGAAATCATGGCCTCTTGGCCAA



resistant)
GATTGATAGCTTGTGCCTGTCCCTGAGTCCCAGTCCAT




CACGAGCAGCTGGTTTCTAAGATGCTATTTCCCGTATA




AAGCATGAGACCGTGACTTGCCAGCCCCACAGAGCCC




CGCCCTTGTCCATCACTGGCATCTGGACTCCAGCCTGG




GTTGGGGCAAAGAGGGAAATGAGATCATGTCCTAACC




CTGATCCTCTTGTCCCACAGATATCCAGAACCCTGACC




CTGCCGTGTACCAGCTGAGAGACTCTAAATCCAGTGA




CAAGTCTGTCTGCCTATTCGGATCTGGCGCCACCAATT




TCAGCCTGCTGAAACAGGCTGGCGACGTGGAAGAGAA




CCCCGGACCTATGTCTATCGGCCTGCTGTGTTGTGCCG




CTCTGTCTCTGCTTTGGGCCGGACCTGTTAATGCCGGC




GTGACCCAGACACCTAAGTTCCAGGTGCTGAAAACCG




GCCAGAGCATGACCCTGCAGTGCGCCCAGGATATGAA




CCACGAGTACATGAGCTGGTACAGACAGGACCCTGGC




ATGGGCCTGAGACTGATCCACTATTCTGTCGGAGCCG




GCATCACCGACCAGGGCGAAGTTCCTAATGGCTACAA




CGTGTCCAGAAGCACCACCGAGGACTTCCCACTGAGA




CTGCTGTCTGCCGCTCCTAGCCAGACCAGCGTGTACTT




TTGTGCCAGCAGCTACGTGGGCAACACCGGCGAGCTG




TTTTTTGGCGAGGGCAGCAGACTGACCGTGCTGGAAG




ATCTGAACAAGGTGTTCCCTCCAGAGGTGGCCGTGTT




CGAGCCTTCTGAGGCCGAGATCAGCCACACACAGAAA




GCCACACTCGTGTGCCTGGCCACCGGCTTTTTTCCCGA




TCACGTGGAACTGTCTTGGTGGGTCAACGGCAAAGAG




GTGCACAGCGGCGTCAGCACAGATCCCCAGCCTCTGA




AAGAACAGCCCGCTCTGAACGACAGCCGGTACTGTCT




GTCCTCCAGACTGAGAGTGTCCGCCACCTTCTGGCAG




AACCCCAGAAACCACTTCAGATGCCAGGTGCAGTTCT




ACGGCCTGAGCGAGAACGATGAGTGGACCCAGGATA




GAGCCAAGCCTGTGACACAGATCGTGTCTGCCGAAGC




CTGGGGCAGAGCCGATTGTGGCTTTACCTCCGTGTCCT




ATCAGCAGGGCGTGCTGAGCGCCACAATCCTGTATGA




GATCCTGCTGGGCAAAGCCACTCTGTACGCCGTGCTG




GTGTCTGCCCTGGTGCTGATGGCCATGGTCAAGAGAA




AGGACTTCGGCAGCGGCGAAGGCAGAGGCTCTCTTCT




TACATGCGGCGACGTCGAAGAAAATCCTGGGCCTATG




GTAGGCTCCCTGAACTGTATAGTTGCGGTATCCCAAA




ATATGGGGATTGGAAAGAACGGAGACtTTCCGTGGCC




GCCCCTCCGAAATGAATccCGATACTTTCAGAGAATGA




CAACTACCTCATCTGTAGAGGGAAAGCAAAATCTGGT




TATCATGGGAAAGAAAACGTGGTTCTCTATCCCTGAA




AAAAACAGACCTCTCAAAGGCAGGATAAATTTGGTAT




TGTCAAGAGAATTGAAGGAACCGCCACAAGGAGCTCA




TTTTCTCAGCAGATCTCTGGACGATGCACTCAAACTCA




CCGAACAACCAGAACTTGCTAATAAGGTTGATATGGT




CTGGATAGTTGGGGGCAGCAGTGTATATAAGGAAGCC




ATGAACCATCCTGGCCATCTGAAGCTGTTTGTTACGAG




GATAATGCAGGACTTCGAGTCCGACACTTTTTTCCCAG




AGATTGACTTGGAAAAGTATAAACTCTTGCCTGAGTA




TCCTGGGGTTCTCTCCGATGTCCAAGAGGAGAAAGGT




ATTAAATATAAGTTTGAAGTTTATGAAAAAAACGATG




GATCTGGCGCCACCAATTTCAGCCTGCTGAAACAGGC




TGGCGACGTGGAAGAGAACCCCGGACCTATGAAGTCC




CTGCGGGTGCTGCTGGTTATCCTGTGGCTGCAGCTGAG




CTGGGTCTGGTCCCAGAAACAAGAAGTGACTCAGATC




CCAGCCGCTCTGAGTGTGCCTGAGGGCGAAAACCTGG




TCCTGAACTGCAGCTTCACCGACAGCGCCATCTACAA




CCTGCAGTGGTTCAGGCAGGATCCCGGCAAGGGACTG




ACAAGCCTGCTGCTGATTCAGAGCAGCCAGAGAGAGC




AGACCTCCGGCAGACTGAATGCCAGCCTGGATAAGAG




CAGCGGCCGCAGCACACTGTATATCGCCGCTTCTCAG




CCTGGCGATAGCGCCACATATCTGTGTGCCGTGCGAC




CTCTGTACGGCGGCAGCTACATCCCTACATTTGGCAG




AGGCACCAGCCTGATCGTGCACCCCTACATTCAGAAC




CCCGATCCTGCCGTGTATCAGCTGAGAGACAGCAAGT




CCAGCGACAAGAGCGTGTGTTTGTTCACCGATTTTGAT




TCTCAAACAAATGTGTCACAAAGTAAGGATTCTGATG




TGTATATCACAGACAAAACTGTGCTAGACATGAGGTC




TATGGACTTCAAGAGCAACAGTGCTGTGGCCTGGAGC




AACAAATCTGACTTTGCATGTGCAAACGCCTTCAACA




ACAGCATTATTCCAGAAGACACCTTCTTCCCCAGCCCA




GGTAAGGGCAGCTTTGGTGCCTTCGCAGGCTGTTTCCT




TGCTTCAGGAATGGCCAGGTTCTGCCCAGAGCTCTGG




TCAATGATGTCTAAAACTCCTCTGATTGGTGGTCTCGG






JUNMUT4AA -
gccagagttatattgctggggttttgaagaagatcctattaaataaaagaataagcagtatta
50


mDHRF_A_1G4_
ttaagtagccctgcatttcaggtttccttgagtggcaggccaggcctggccgtgaacgttca



TRAC
ctgaaatcatggcctcttggccaagattgatagcttgtgcctgtccctgagtcccagtccat




cacgagcagctggtttctaagatgctatttcccgtataaagcatgagaccgtgacttgccag




ccccacagagccccgcccttgtccatcactggcatctggactccagcctgggttggggca




aagagggaaatgagatcatgtcctaaccctgatcctcttgtcccacagatatccagaaccc




tgaccctgccgtgtaccagctgagagactctaaatccagtgacaagtctgtctgcctattcg




gatctggcgccaccaatttcagcctgctgaaacaggctggcgacgtggaagagaacccc




ggacctATGTCTATCGGCCTGCTGTGTTGTGCCGCTCTGT




CTCTGCTTTGGGCCGGACCTGTTAATGCCGGCGTGACC




CAGACACCTAAGTTCCAGGTGCTGAAAACCGGCCAGA




GCATGACCCTGCAGTGCGCCCAGGATATGAACCACGA




GTACATGAGCTGGTACAGACAGGACCCTGGCATGGGC




CTGAGACTGATCCACTATTCTGTCGGAGCCGGCATCA




CCGACCAGGGCGAAGTTCCTAATGGCTACAACGTGTC




CAGAAGCACCACCGAGGACTTCCCACTGAGACTGCTG




TCTGCCGCTCCTAGCCAGACCAGCGTGTACTTTTGTGC




CAGCAGCTACGTGGGCAACACCGGCGAGCTGTTTTTT




GGCGAGGGCAGCAGACTGACCGTGCTGGAAGATCTGC




GGAACGTGTTCCCTCCAAAGGTGGCCGTGTTTGAGCC




TAGCGAGGCCGAGATCAGCCACACACAGAAAGCCAC




ACTCGTGTGTCTGGCCACCGGCTTCTATCCCGATCACG




TGGAACTGTCTTGGTGGGTCAACGGCAAAGAGGTGCA




CAGCGGCGTCAGCACAGATCCCCAGCCTCTGAAAGAA




CAGCCCGCTCTGAACGACAGCCGGTACTGTCTGTCCTC




CAGACTGAGAGTGTCCGCCACCTTCTGGCAGAACCCC




AGAAACCACTTCAGATGCCAGGTGCAGTTCTACGGCC




TGAGCGAGAACGACAAGTGGCCTGAGGGATCTGCCAA




GCCTGTGACACAGATCGTGTCTGCCGAAGCTTGGGGC




AGAGCCGATTGTGGCTTTACCAGCGAGAGCTACCAGC




AGGGCGTTCTGTCTGCCACCATCCTGTACGAGATCCTG




CTGGGCAAAGCCACTCTGTACGCCGTGCTGGTGTCTG




CCCTGGTGCTGATGGCCATGGTCAAGCGGAAGGATAG




CAGAGGCGGAAGCGGAGAAGGCAGAGGCTCTCTGCTT




ACATGCGGAGATGTGGAAGAAAATCCTGGACCAAGA




ATCGCCCGCCTGGAAGAAgAgGTCAAGACCCTGgAGGC




CCAGAACAGCGAGCTGGCCTCTACCGCCAACATGCTG




gaAGAACAGGTCGCCCAGCTGgAGCAGAAAGTCGGCG




GCGGAGGATCTGGCGGAGGCGGATCTATGGTTCGACC




CCTGAATTGCATCGTGGCCGTGTCTCAGAACATGGGC




ATCGGCAAGAACGGCGACTTCCCTTGGCCTCCTCTGC




GGAACGAGAGCAAGTACTTCCAGAGAATGACCACCAC




CAGCAGCGTGGAAGGCAAGCAGAACCTGGTCATCATG




GGCAGAAAGACCTGGTTCAGCATCCCCGAGAAGAACA




GGCCCCTGAAGGACCGGATCAACATCGTGCTGAGCAG




AGAGCTGAAAGAGCCTCCTAGAGGCGCCCACTTTCTG




GCCAAGTCTCTGGACGATGCCCTGCGGCTGATTGAGC




AGCCTGAACTTGGCAGCGGCGCCACAAACTTTTCACT




GCTGAAGCAAGCCGGGGATGTCGAAGAGAATCCAGG




GCCTATGAAGTCCCTGCGGGTGCTGCTGGTTATCCTGT




GGCTGCAGCTGAGCTGGGTCTGGTCCCAGAAACAAGA




AGTGACTCAGATCCCAGCCGCTCTGAGTGTGCCTGAG




GGCGAAAACCTGGTCCTGAACTGCAGCTTCACCGACA




GCGCCATCTACAACCTGCAGTGGTTCAGGCAGGATCC




CGGCAAGGGACTGACAAGCCTGCTGCTGATTCAGAGC




AGCCAGAGAGAGCAGACCTCCGGCAGACTGAATGCC




AGCCTGGATAAGAGCAGCGGCCGCAGCACACTGTATA




TCGCCGCTTCTCAGCCTGGCGATAGCGCCACATATCTG




TGTGCCGTGCGACCTCTGTACGGCGGCAGCTACATCC




CTACATTTGGCAGAGGCACCAGCCTGATCGTGCACCC




Ctacattcagaaccccgatcctgccgtgtatcagctgagagacagcaagtccagcgaca




agagcgtgtgtttgttcaccgattttgattctcaaacaaatgtgtcacaaagtaaggattctga




tgtgtatatcacagacaaaactgtgctagacatgaggtctatggacttcaagagcaacagt




gctgtggcctggagcaacaaatctgactttgcatgtgcaaacgccttcaacaacagcatta




ttccagaagacaccttcttccccagcccaggtaagggcagctttggtgccttcgcaggctg




tttccttgcttcaggaatggccaggttctgcccagagctctggtcaatgatgtctaaaactcc




tctgattggtggtctcgg






FOSMUT4AA-
gaagttctccttctgctaggtagcattcaaagatcttaatcttctgggtttccgttttctcgaatg
51


mDHFR_B_
aaaaatgcaggtccgagcagttaactggctggggcaccattagcaagtcacttagcatct



TGFBR2_B2M
ctggggccagtctgcaaagcgagggggcagccttaatgtgcctccagcctgaagtccta



(crB2M-4)
gaatgagcgcccggtgtcccaagctggggcgcgcaccccagatcggagggcgccgat




gtacagacagcaaactcacccagtctagtgcatgccttcttaaacatcacgagactctaag




aaaaggaaactgaaaacgggaaagtccctctctctaacctggcactgcgtcgctggcttg




gagacaggtgacggtccctgcgggccttgtcctgattggctgggcacgcgtttaatataa




gtggaggcgtcgcgctggcgggcattcctgaagctgacagcattcgggccgagatgtct




cgctccgtggccttagctGGAtctGGAGAAGGCAGAGGCagcCTGC




TTACATGCGGAGATGTGGAAGAAAATCCTGGACCAAT




GGGAAGAGGCCTGCTGAGAGGACTGTGGCCTCTGCAC




ATTGTGCTGTGGACCAGAATCGCCAGCACAATCCCTC




CACACGTGCAGAAAAGCGTGAACAACGACATGATCGT




GACCGACAACAATGGCGCCGTGAAGTTCCCTCAGCTG




TGCAAGTTCTGCGACGTGCGGTTCAGCACCTGTGACA




ACCAGAAAAGCTGCATGAGCAACTGCAGCATCACCAG




CATCTGCGAGAAGCCCCAAGAAGTGTGCGTCGCCGTC




TGGCGGAAGAACGACGAGAACATCACCCTGGAAACC




GTGTGTCACGACCCCAAGCTGCCCTACCACGACTTCAT




CCTGGAAGATGCCGCCTCTCCTAAGTGCATCATGAAG




GAAAAGAAGAAGCCCGGCGAGACATTCTTCATGTGCA




GCTGCTCCAGCGACGAGTGCAACGACAACATCATCTT




CAGCGAAGAGTACAACACCAGCAATCCCGACCTGCTG




CTGGTCATCTTCCAGGTGACCGGCATCAGCCTGCTGCC




TCCACTGGGAGTTGCCATCAGCGTGATCATCATCTTTT




ACTGCTACCGCGTGggatctggcgccaccaatttcagcctgctgaaacagg




ctggcgacgtggaagagaaccccggacctCTGACCGACACACTGCAG




GCCaAGACAGACCAACTGaAAGATGAGAAGTCTGCCC




TGCAGACCagGATCGCTAACCTGCTGAAAaAGAAAGAG




AAGCTCGAGTTCATCCTGGGTGGCGGAGGATCTGGCG




GAGGCGGATCTGCCAGCAAGGTGGACATGGTCTGGAT




CGTCGGCGGCTCCTCTGTGTACCAAGAGGCCATGAAT




CAGCCCGGACACCTGAGGCTGTTCGTGACCAGAATCA




TGCAAGAGTTCGAGAGCGACACATTCTTCCCAGAGAT




CGACCTGGGCAAGTACAAGCTGCTGCCTGAGTATCCC




GGCGTGCTGTCTGAGGTGCAAGAGGAAAAGGGCATCA




AGTATAAGTTCGAGGTGTACGAGAAAAAGGATGGATC




CGGCGAAGGCAGAGGATCTCTGCTGACATGTGGCGAC




GTGGAAGAGAACCCTGGACCTATGGATACCTGCCACA




TTGCCAAGAGCTGCGTGCTGATCCTGCTGGTCGTTCTG




CTGTGTGCCGAGCGAGCACAGGGCCTCGAGTGCTACA




ATTGCATTGGCGTGCCACCTGAGACAAGCTGCAACAC




CACCACCTGTCCTTTCAGCGACGGCTTCTGTGTGGCCC




TGGAAATCGAAGTGATCGTGGACAGCCACCGGTCCAA




AGTGAAGTCCAACCTGTGCCTGCCTATCTGCCCCACCA




CACTGGACAACACCGAGATCACAGGCAACGCCGTGAA




CGTGAAAACCTACTGCTGCAAAGAGGACCTCTGCAAC




GCCGCTGTTCCAACAGGTGGAAGCTCTTGGACTATGG




CCGGCGTGCTGCTGTTTAGCCTGGTGTCTGTTCTGCTG




CAGACCTTCCTGGGATCAGGCGCCACGAATTTTAGCC




TGCTCAAACAGGCGGGCGACGTAGAAGAGAACCCaGG




ACCTgtgctcgcgctactctctctttctggcctggaggctatccagcgtgagtctctcct




accctcccgctctggtccttcctctcccgctctgcaccctctgtggccctcgctgtgctctct




cgctccgtgacttcccttctccaagttctccttggtggcccgccgtggggctagtccaggg




ctggatctcggggaagcggcggggtggcctgggagtggggaagggggtgcgcaccc




gggacgcgcgctacttgcccctttcggcggggagcaggggagacctttggcctacggc




gacgggagggtcgggacaaagtttagggcgtcgataagcgtcagagcgccgaggttgg




gggagggtttctcttccgctctttcgcggggcctctggctcccccagcgcagctggagtg




ggggacgggtaggctcgtcccaaaggcgcggcgctgaggtttgtgaacgcgtggagg




ggcgcttggggtctgggggaggcgtcgcccg






FOSMUT4AA-
agtatcttggggccaaatcatgtagactcttgagtgatgtgttaaggaatgctatgagtgctg
52


mDHFR_B_
agagggcatcagaagtccttgagagcctccagagaaaggctcttaaaaatgcagcgcaa



TGFBR2_B2M
tctccagtgacagaagatactgctagaaatctgctagaaaaaaaacaaaaaaggcatgtat



(crB2M-5)
agaggaattatgagggaaagataccaagtcacggtttattcttcaaaatggaggtggcttgt




tgggaaggtggaagctcatttggccagagtggaaatggaattgggagaaatcgatgacc




aaatgtaaacacttggtgcctgatatagcttgacaccaagttagccccaagtgaaataccct




ggcaatattaatgtgtcttttcccgatattcctcaggtactccaaagattcaggtttactcacgt




catccagcagagaatggaaagtcaaatttcctgaattgctatgtgtctgggtttcatccatcc




gacattGGAtctGGAGAAGGCAGAGGCagcCTGCTTACATGC




GGAGATGTGGAAGAAAATCCTGGACCAATGGGAAGA




GGCCTGCTGAGAGGACTGTGGCCTCTGCACATTGTGC




TGTGGACCAGAATCGCCAGCACAATCCCTCCACACGT




GCAGAAAAGCGTGAACAACGACATGATCGTGACCGA




CAACAATGGCGCCGTGAAGTTCCCTCAGCTGTGCAAG




TTCTGCGACGTGCGGTTCAGCACCTGTGACAACCAGA




AAAGCTGCATGAGCAACTGCAGCATCACCAGCATCTG




CGAGAAGCCCCAAGAAGTGTGCGTCGCCGTCTGGCGG




AAGAACGACGAGAACATCACCCTGGAAACCGTGTGTC




ACGACCCCAAGCTGCCCTACCACGACTTCATCCTGGA




AGATGCCGCCTCTCCTAAGTGCATCATGAAGGAAAAG




AAGAAGCCCGGCGAGACATTCTTCATGTGCAGCTGCT




CCAGCGACGAGTGCAACGACAACATCATCTTCAGCGA




AGAGTACAACACCAGCAATCCCGACCTGCTGCTGGTC




ATCTTCCAGGTGACCGGCATCAGCCTGCTGCCTCCACT




GGGAGTTGCCATCAGCGTGATCATCATCTTTTACTGCT




ACCGCGTGggatctggcgccaccaatttcagcctgctgaaacaggctggcgacgt




ggaagagaaccccggacctCTGACCGACACACTGCAGGCCaAGA




CAGACCAACTGaAAGATGAGAAGTCTGCCCTGCAGAC




CagGATCGCTAACCTGCTGAAAaAGAAAGAGAAGCTCG




AGTTCATCCTGGGTGGCGGAGGATCTGGCGGAGGCGG




ATCTGCCAGCAAGGTGGACATGGTCTGGATCGTCGGC




GGCTCCTCTGTGTACCAAGAGGCCATGAATCAGCCCG




GACACCTGAGGCTGTTCGTGACCAGAATCATGCAAGA




GTTCGAGAGCGACACATTCTTCCCAGAGATCGACCTG




GGCAAGTACAAGCTGCTGCCTGAGTATCCCGGCGTGC




TGTCTGAGGTGCAAGAGGAAAAGGGCATCAAGTATAA




GTTCGAGGTGTACGAGAAAAAGGATGGATCCGGCGA




AGGCAGAGGATCTCTGCTGACATGTGGCGACGTGGAA




GAGAACCCTGGACCTATGGATACCTGCCACATTGCCA




AGAGCTGCGTGCTGATCCTGCTGGTCGTTCTGCTGTGT




GCCGAGCGAGCACAGGGCCTCGAGTGCTACAATTGCA




TTGGCGTGCCACCTGAGACAAGCTGCAACACCACCAC




CTGTCCTTTCAGCGACGGCTTCTGTGTGGCCCTGGAAA




TCGAAGTGATCGTGGACAGCCACCGGTCCAAAGTGAA




GTCCAACCTGTGCCTGCCTATCTGCCCCACCACACTGG




ACAACACCGAGATCACAGGCAACGCCGTGAACGTGA




AAACCTACTGCTGCAAAGAGGACCTCTGCAACGCCGC




TGTTCCAACAGGTGGAAGCTCTTGGACTATGGCCGGC




GTGCTGCTGTTTAGCCTGGTGTCTGTTCTGCTGCAGAC




CTTCCTGGGATCAGGCGCCACGAATTTTAGCCTGCTCA




AACAGGCGGGCGACGTAGAAGAGAACCCaGGACCTgaa




gttgacttactgaagaatggagagagaattgaaaaagtggagcattcagacttgtctttcag




caaggactggtctttctatctcttgtactacactgaattcacccccactgaaaaagatgagta




tgcctgccgtgtgaaccatgtgactttgtcacagcccaagatagttaagtggggtaagtctt




acattcttttgtaagctgctgaaagttgtgtatgagtagtcatatcataaagctgctttgatata




aaaaaggtctatggccatactaccctgaatgagtcccatcccatctgatataaacaatctgc




atattgggattgtcagggaatgttcttaaagatcagattagtggcacctgctgagatactgat




gcacagcatggtttctgaaccagtagtttccctgcagttgagcagggagcagcagcagca




cttgcacaaatacatatacactcttaacacttcttacctactggcttcctctagcttttg






FKBP12F36V-
gccagagttatattgctggggttttgaagaagatcctattaaataaaagaataagcagtatta
53


mDHFR_A_1G4_
ttaagtagccctgcatttcaggtttccttgagtggcaggccaggcctggccgtgaacgttca



TRAC
ctgaaatcatggcctcttggccaagattgatagcttgtgcctgtccctgagtcccagtccat



repair
cacgagcagctggtttctaagatgctatttcccgtataaagcatgagaccgtgacttgccag



template
ccccacagagccccgcccttgtccatcactggcatctggactccagcctgggttggggca




aagagggaaatgagatcatgtcctaaccctgatcctcttgtcccacagatatccagaaccc




tgaccctgccgtgtaccagctgagagactctaaatccagtgacaagtctgtctgcctattcg




gatctggcgccaccaatttcagcctgctgaaacaggctggcgacgtggaagagaacccc




ggacctATGTCTATCGGCCTGCTGTGTTGTGCCGCTCTGT




CTCTGCTTTGGGCCGGACCTGTTAATGCCGGCGTGACC




CAGACACCTAAGTTCCAGGTGCTGAAAACCGGCCAGA




GCATGACCCTGCAGTGCGCCCAGGATATGAACCACGA




GTACATGAGCTGGTACAGACAGGACCCTGGCATGGGC




CTGAGACTGATCCACTATTCTGTCGGAGCCGGCATCA




CCGACCAGGGCGAAGTTCCTAATGGCTACAACGTGTC




CAGAAGCACCACCGAGGACTTCCCACTGAGACTGCTG




TCTGCCGCTCCTAGCCAGACCAGCGTGTACTTTTGTGC




CAGCAGCTACGTGGGCAACACCGGCGAGCTGTTTTTT




GGCGAGGGCAGCAGACTGACCGTGCTGGAAGATCTGC




GGAACGTGTTCCCTCCAAAGGTGGCCGTGTTTGAGCC




TAGCGAGGCCGAGATCAGCCACACACAGAAAGCCAC




ACTCGTGTGTCTGGCCACCGGCTTCTATCCCGATCACG




TGGAACTGTCTTGGTGGGTCAACGGCAAAGAGGTGCA




CAGCGGCGTCAGCACAGATCCCCAGCCTCTGAAAGAA




CAGCCCGCTCTGAACGACAGCCGGTACTGTCTGTCCTC




CAGACTGAGAGTGTCCGCCACCTTCTGGCAGAACCCC




AGAAACCACTTCAGATGCCAGGTGCAGTTCTACGGCC




TGAGCGAGAACGACAAGTGGCCTGAGGGATCTGCCAA




GCCTGTGACACAGATCGTGTCTGCCGAAGCTTGGGGC




AGAGCCGATTGTGGCTTTACCAGCGAGAGCTACCAGC




AGGGCGTTCTGTCTGCCACCATCCTGTACGAGATCCTG




CTGGGCAAAGCCACTCTGTACGCCGTGCTGGTGTCTG




CCCTGGTGCTGATGGCCATGGTCAAGCGGAAGGATAG




CAGAGGCGGAAGCGGAGAAGGCAGAGGCTCTCTGCTT




ACATGCGGAGATGTGGAAGAAAATCCTGGACCAATGG




GAGTTCAAGTGGAGACAATATCACCAGGCGATGGAAG




GACATTCCCCAAGCGAGGGCAAACGTGTGTGGTACAC




TACACTGGCATGTTGGAGGACGGAAAGAAAGTCGACA




GTTCCCGCGACCGGAATAAGCCTTTCAAATTCATGCTC




GGCAAGCAGGAGGTCATTCGGGGTTGGGAGGAAGGG




GTCGCGCAAATGAGTGTCGGACAACGCGCAAAACTTA




CTATTTCCCCAGATTACGCCTACGGAGCCACAGGTCA




CCCTGGTATCATACCACCCCACGCGACTCTGGTTTTTG




ATGTCGAATTGCTGAAATTGGAATCTGGCGGAGGCTC




TATGGTTCGACCCCTGAATTGCATCGTGGCCGTGTCTC




AGAACATGGGCATCGGCAAGAACGGCGACTTCCCTTG




GCCTCCTCTGCGGAACGAGAGCAAGTACTTCCAGAGA




ATGACCACCACCAGCAGCGTGGAAGGCAAGCAGAAC




CTGGTCATCATGGGCAGAAAGACCTGGTTCAGCATCC




CCGAGAAGAACAGGCCCCTGAAGGACCGGATCAACA




TCGTGCTGAGCAGAGAGCTGAAAGAGCCTCCTAGAGG




CGCCCACTTTCTGGCCAAGTCTCTGGACGATGCCCTGC




GGCTGATTGAGCAGCCTGAACTTGGCAGCGGCGCCAC




AAACTTTTCACTGCTGAAGCAAGCCGGGGATGTCGAA




GAGAATCCAGGGCCTATGAAGTCCCTGCGGGTGCTGC




TGGTTATCCTGTGGCTGCAGCTGAGCTGGGTCTGGTCC




CAGAAACAAGAAGTGACTCAGATCCCAGCCGCTCTGA




GTGTGCCTGAGGGCGAAAACCTGGTCCTGAACTGCAG




CTTCACCGACAGCGCCATCTACAACCTGCAGTGGTTC




AGGCAGGATCCCGGCAAGGGACTGACAAGCCTGCTGC




TGATTCAGAGCAGCCAGAGAGAGCAGACCTCCGGCAG




ACTGAATGCCAGCCTGGATAAGAGCAGCGGCCGCAGC




ACACTGTATATCGCCGCTTCTCAGCCTGGCGATAGCGC




CACATATCTGTGTGCCGTGCGACCTCTGTACGGCGGC




AGCTACATCCCTACATTTGGCAGAGGCACCAGCCTGA




TCGTGCACCCCtacattcagaaccccgatcctgccgtgtatcagctgagagaca




gcaagtccagcgacaagagcgtgtgtttgttcaccgattttgattctcaaacaaatgtgtca




caaagtaaggattctgatgtgtatatcacagacaaaactgtgctagacatgaggtctatgga




cttcaagagcaacagtgctgtggcctggagcaacaaatctgactttgcatgtgcaaacgc




cttcaacaacagcattattccagaagacaccttcttccccagcccaggtaagggcagcttt




ggtgccttcgcaggctgtttccttgcttcaggaatggccaggttctgcccagagctctggtc




aatgatgtctaaaactcctctgattggtggtctcgg






FKBP12F36V -
gaagttctccttctgctaggtagcattcaaagatcttaatcttctgggtttccgttttctcgaatg
54


mDHFR_B_
aaaaatgcaggtccgagcagttaactggctggggcaccattagcaagtcacttagcatct



TGFBR2_B2M
ctggggccagtctgcaaagcgagggggcagccttaatgtgcctccagcctgaagtccta



(crB2M-4)
gaatgagcgcccggtgtcccaagctggggcgcgcaccccagatcggagggcgccgat




gtacagacagcaaactcacccagtctagtgcatgccttcttaaacatcacgagactctaag




aaaaggaaactgaaaacgggaaagtccctctctctaacctggcactgcgtcgctggcttg




gagacaggtgacggtccctgcgggccttgtcctgattggctgggcacgcgtttaatataa




gtggaggcgtcgcgctggcgggcattcctgaagctgacagcattcgggccgagatgtct




cgctccgtggccttagctGGAtctGGAGAAGGCAGAGGCagcCTGC




TTACATGCGGAGATGTGGAAGAAAATCCTGGACCAAT




GGGAAGAGGCCTGCTGAGAGGACTGTGGCCTCTGCAC




ATTGTGCTGTGGACCAGAATCGCCAGCACAATCCCTC




CACACGTGCAGAAAAGCGTGAACAACGACATGATCGT




GACCGACAACAATGGCGCCGTGAAGTTCCCTCAGCTG




TGCAAGTTCTGCGACGTGCGGTTCAGCACCTGTGACA




ACCAGAAAAGCTGCATGAGCAACTGCAGCATCACCAG




CATCTGCGAGAAGCCCCAAGAAGTGTGCGTCGCCGTC




TGGCGGAAGAACGACGAGAACATCACCCTGGAAACC




GTGTGTCACGACCCCAAGCTGCCCTACCACGACTTCAT




CCTGGAAGATGCCGCCTCTCCTAAGTGCATCATGAAG




GAAAAGAAGAAGCCCGGCGAGACATTCTTCATGTGCA




GCTGCTCCAGCGACGAGTGCAACGACAACATCATCTT




CAGCGAAGAGTACAACACCAGCAATCCCGACCTGCTG




CTGGTCATCTTCCAGGTGACCGGCATCAGCCTGCTGCC




TCCACTGGGAGTTGCCATCAGCGTGATCATCATCTTTT




ACTGCTACCGCGTGggatctggcgccaccaatttcagcctgctgaaacagg




ctggcgacgtggaagagaaccccggacctATGGGTGTGCAGGTGGAA




ACAATCTCTCCGGGAGACGGTCGCACTTTCCCGAAGC




GCGGGCAAACCTGTGTCGTACATTACACTGGCATGTT




GGAAGATGGAAAAAAGGTCGATAGTTCTCGCGACCGC




AATAAGCCATTCAAATTCATGCTGGGGAAGCAGGAGG




TTATTCGCGGATGGGAGGAAGGAGTTGCCCAAATGTC




TGTGGGACAAAGGGCCAAGTTGACTATTAGTCCCGAC




TACGCATACGGGGCGACCGGACACCCCGGTATAATAC




CCCCTCACGCCACTCTGGTCTTCGACGTAGAGCTTTTG




AAACTCGAGTCAGGGGGCGGATCTGCCAGCAAGGTGG




ACATGGTCTGGATCGTCGGCGGCTCCTCTGTGTACCAA




GAGGCCATGAATCAGCCCGGACACCTGAGGCTGTTCG




TGACCAGAATCATGCAAGAGTTCGAGAGCGACACATT




CTTCCCAGAGATCGACCTGGGCAAGTACAAGCTGCTG




CCTGAGTATCCCGGCGTGCTGTCTGAGGTGCAAGAGG




AAAAGGGCATCAAGTATAAGTTCGAGGTGTACGAGAA




AAAGGATGGATCCGGCGAAGGCAGAGGATCTCTGCTG




ACATGTGGCGACGTGGAAGAGAACCCTGGACCTATGG




ATACCTGCCACATTGCCAAGAGCTGCGTGCTGATCCT




GCTGGTCGTTCTGCTGTGTGCCGAGCGAGCACAGGGC




CTCGAGTGCTACAATTGCATTGGCGTGCCACCTGAGA




CAAGCTGCAACACCACCACCTGTCCTTTCAGCGACGG




CTTCTGTGTGGCCCTGGAAATCGAAGTGATCGTGGAC




AGCCACCGGTCCAAAGTGAAGTCCAACCTGTGCCTGC




CTATCTGCCCCACCACACTGGACAACACCGAGATCAC




AGGCAACGCCGTGAACGTGAAAACCTACTGCTGCAAA




GAGGACCTCTGCAACGCCGCTGTTCCAACAGGTGGAA




GCTCTTGGACTATGGCCGGCGTGCTGCTGTTTAGCCTG




GTGTCTGTTCTGCTGCAGACCTTCCTGGGATCAGGCGC




CACGAATTTTAGCCTGCTCAAACAGGCGGGCGACGTA




GAAGAGAACCCaGGACCTgtgctcgcgctactctctctttctggcctggag




gctatccagcgtgagtctctcctaccctcccgctctggtccttcctctcccgctctgcaccct




ctgtggccctcgctgtgctctctcgctccgtgacttcccttctccaagttctccttggtggccc




gccgtggggctagtccagggctggatctcggggaagcggcggggtggcctgggagtg




gggaagggggtgcgcacccgggacgcgcgctacttgcccctttcggcggggagcagg




ggagacctttggcctacggcgacgggagggtcgggacaaagtttagggcgtcgataag




cgtcagagcgccgaggttgggggagggtttctcttccgctctttcgcggggcctctggctc




ccccagcgcagctggagtgggggacgggtaggctcgtcccaaaggcgcggcgctgag




gtttgtgaacgcgtggaggggcgcttggggtctgggggaggcgtcgcccg



FKBP12F36V -
agtatcttggggccaaatcatgtagactcttgagtgatgtgttaaggaatgctatgagtgctg
55


mDHFR_B_
agagggcatcagaagtccttgagagcctccagagaaaggctcttaaaaatgcagcgcaa



TGFBR2_B2M
tctccagtgacagaagatactgctagaaatctgctagaaaaaaaacaaaaaaggcatgtat



(crB2M-5)
agaggaattatgagggaaagataccaagtcacggtttattcttcaaaatggaggtggcttgt




tgggaaggtggaagctcatttggccagagtggaaatggaattgggagaaatcgatgacc




aaatgtaaacacttggtgcctgatatagcttgacaccaagttagccccaagtgaaataccct




ggcaatattaatgtgtcttttcccgatattcctcaggtactccaaagattcaggtttactcacgt




catccagcagagaatggaaagtcaaatttcctgaattgctatgtgtctgggtttcatccatcc




gacattGGAtctGGAGAAGGCAGAGGCagcCTGCTTACATGC




GGAGATGTGGAAGAAAATCCTGGACCAATGGGAAGA




GGCCTGCTGAGAGGACTGTGGCCTCTGCACATTGTGC




TGTGGACCAGAATCGCCAGCACAATCCCTCCACACGT




GCAGAAAAGCGTGAACAACGACATGATCGTGACCGA




CAACAATGGCGCCGTGAAGTTCCCTCAGCTGTGCAAG




TTCTGCGACGTGCGGTTCAGCACCTGTGACAACCAGA




AAAGCTGCATGAGCAACTGCAGCATCACCAGCATCTG




CGAGAAGCCCCAAGAAGTGTGCGTCGCCGTCTGGCGG




AAGAACGACGAGAACATCACCCTGGAAACCGTGTGTC




ACGACCCCAAGCTGCCCTACCACGACTTCATCCTGGA




AGATGCCGCCTCTCCTAAGTGCATCATGAAGGAAAAG




AAGAAGCCCGGCGAGACATTCTTCATGTGCAGCTGCT




CCAGCGACGAGTGCAACGACAACATCATCTTCAGCGA




AGAGTACAACACCAGCAATCCCGACCTGCTGCTGGTC




ATCTTCCAGGTGACCGGCATCAGCCTGCTGCCTCCACT




GGGAGTTGCCATCAGCGTGATCATCATCTTTTACTGCT




ACCGCGTGggatctggcgccaccaatttcagcctgctgaaacaggctggcgacgt




ggaagagaaccccggacctATGGGTGTGCAGGTGGAAACAATC




TCTCCGGGAGACGGTCGCACTTTCCCGAAGCGCGGGC




AAACCTGTGTCGTACATTACACTGGCATGTTGGAAGA




TGGAAAAAAGGTCGATAGTTCTCGCGACCGCAATAAG




CCATTCAAATTCATGCTGGGGAAGCAGGAGGTTATTC




GCGGATGGGAGGAAGGAGTTGCCCAAATGTCTGTGGG




ACAAAGGGCCAAGTTGACTATTAGTCCCGACTACGCA




TACGGGGCGACCGGACACCCCGGTATAATACCCCCTC




ACGCCACTCTGGTCTTCGACGTAGAGCTTTTGAAACTC




GAGTCAGGGGGCGGATCTGCCAGCAAGGTGGACATG




GTCTGGATCGTCGGCGGCTCCTCTGTGTACCAAGAGG




CCATGAATCAGCCCGGACACCTGAGGCTGTTCGTGAC




CAGAATCATGCAAGAGTTCGAGAGCGACACATTCTTC




CCAGAGATCGACCTGGGCAAGTACAAGCTGCTGCCTG




AGTATCCCGGCGTGCTGTCTGAGGTGCAAGAGGAAAA




GGGCATCAAGTATAAGTTCGAGGTGTACGAGAAAAAG




GATGGATCCGGCGAAGGCAGAGGATCTCTGCTGACAT




GTGGCGACGTGGAAGAGAACCCTGGACCTATGGATAC




CTGCCACATTGCCAAGAGCTGCGTGCTGATCCTGCTG




GTCGTTCTGCTGTGTGCCGAGCGAGCACAGGGCCTCG




AGTGCTACAATTGCATTGGCGTGCCACCTGAGACAAG




CTGCAACACCACCACCTGTCCTTTCAGCGACGGCTTCT




GTGTGGCCCTGGAAATCGAAGTGATCGTGGACAGCCA




CCGGTCCAAAGTGAAGTCCAACCTGTGCCTGCCTATCT




GCCCCACCACACTGGACAACACCGAGATCACAGGCAA




CGCCGTGAACGTGAAAACCTACTGCTGCAAAGAGGAC




CTCTGCAACGCCGCTGTTCCAACAGGTGGAAGCTCTT




GGACTATGGCCGGCGTGCTGCTGTTTAGCCTGGTGTCT




GTTCTGCTGCAGACCTTCCTGGGATCAGGCGCCACGA




ATTTTAGCCTGCTCAAACAGGCGGGCGACGTAGAAGA




GAACCCaGGACCTgaagttgacttactgaagaatggagagagaattgaaaaa




gtggagcattcagacttgtctttcagcaaggactggtctttctatctcttgtactacactgaatt




cacccccactgaaaaagatgagtatgcctgccgtgtgaaccatgtgactttgtcacagccc




aagatagttaagtggggtaagtcttacattcttttgtaagctgctgaaagttgtgtatgagtag




tcatatcataaagctgctttgatataaaaaaggtctatggccatactaccctgaatgagtccc




atcccatctgatataaacaatctgcatattgggattgtcagggaatgttcttaaagatcagatt




agtggcacctgctgagatactgatgcacagcatggtttctgaaccagtagtttccctgcagt




tgagcagggagcagcagcagcacttgcacaaatacatatacactcttaacacttcttacct




actggcttcctctagcttttg
















TABLE 4







Target sequences for siRNAs









Description
Sequence targeted
SEQ ID NO:





DHFR siRNA-1
GAGCAGGTTCTCATTGATAACAAGC
56





DHFR siRNA-2
ATCAATTGAGGTACGGAGAAACTGA
57





DHFR siRNA-3
GTCATGGTTGGTTCGCTAAACTGCA
58





DHFR siRNA-4
GCAGGTTCTCATTGATAACAAGCTC
59





DHFR siRNA-5
GTTGACTTTAGATCTATAATTATTT
60





DHFR siRNA-6
AAATCATCAATTGAGGTACGGAGAA
61
















TABLE 5







Novel sequences











SEQ


Descrip-

ID


tion
Sequence
NO:





JUNMUT8AA
TIARLEEEVKTLEAKESELASTANMLEEKVAQLEQ
6



KV






FOSMUT8AA
LRDTLQAKTDQLKDNQSALQTRIANLLKKQEKLE
7



FIL






JUNMUT8AA-
TIARLEEEVKTLEAKESELASTANMLEEKVAQLEQ
8


mDHFR_A
KVGGGGSGGGGSMVRPLNCIVAVSQNMGIGKNG




DFPWPPLRNESKYFQRMTTTSSVEGKQNLVIMGR




KTWFSIPEKNRPLKDRINIVLSRELKEPPRGAHFL




AKSLDDALRLIEQPEL






FOSMUT8AA-
LRDTLQAKTDQLKDNQSALQTRIANLLKKQEKLE
9


mDHFR_B
FILGGGGSGGGGSASKVDMVWIVGGSSVYQEAM




NQPGHLRLFVTRIMQEFESDTFFPEIDLGKYKLLP




EYPGVLSEVQEEKGIKYKFEVYEKKD









EXAMPLE 1

This Example demonstrates that simultaneous knock-out of DHFR and knock-in of a TCR gene construct containing a nuclease-resistant DHFR gene leads to a 5-fold enrichment of T cells with successful TCR knock-in.


Materials and Methods for FIG. 3-FIG. 7

Human primary T cells were isolated and activated by anti-CD3/CD28 beads (ThermoFisher, Cat. #: 111.32D, 3:1 beads:T cells ratio) from two buffy coats isolated from different donors BC23 and BC26. Two days after activation, cells were harvested, and electroporation was performed with cells together with the following components: (1) DHFR sgRNA-1/Cas9 RNP, (2) DHFR sgRNA-2/Cas9 RNP, (3) TRAC sgRNA/Cas9 RNP+knockin template encoding NY-ESO-1 1G4 TCR, (4) TRAC sgRNA/Cas9 RNP+knockin template encoding NY-ESO-1 1G4 TCR and DHFR, (5) TRAC sgRNA/Cas9 RNP+knockin template encoding NY-ESO-1 1G4 TCR and DHFR+DHFR sgRNA-1/Cas9 RNP. The RNP complex was prepared by first annealing crRNA (32 pmol) with TracrRNA (32 pmol) at 95° C. for 5 min, after incubation at room temperature for 10 min, 16 pmol of Cas9 nuclease was added and incubated for 15 min at room temperature. The RNP complex was left on ice until use or at −80° C. for long term storage. The electroporation were performed by mixing 1 million activated T cells (in 20 μl P3 buffer) with 16 pmol RNP complex and 1 μg repair template, electroporation was subsequently started with a Lonza 4D-Nucleofector device with pulse code EH-115. For cells electroporated in conditions (1) and (2), they were harvested at day 5 post electroporation, genomic DNA was isolated, DHFR locus was amplified by PCR and TIDE analysis was performed (FIG. 3 and FIG. 4). For cells electroporated in conditions (3), (4) and (5), cells were harvested for FACS analysis of TCR expression at day 6 (FIG. 5) and day 10 post electroporation (FIG. 6 and FIG. 7 left). At day 12 post electroporation, total cell number was also counted and TCR knockin cells were calculated and plotted (FIG. 7 right).



FIG. 3 depicts the results of a TIDE analysis to determine the knockout efficiency of sgRNA sgDHFR-1 in human T cells from two donors (75% and 18% for BC23 and BC26, respectively) providing evidence that the endogenous DHFR gene can be genetically inactivated within human primary T cells. TIDE stands for “Tracking of Indels by Decomposition,” which is a method to measure insertions and deletions (indels) generated in a pool of cells by genome editing tools such as CRISPR/Cas9.



FIG. 4 depicts the results of a TIDE analysis to determine the knockout efficiency of sgRNA sgDHFR-2 in human T cells from two donors (34% and 75% for BC23 and BC26, respectively) providing evidence that the endogenous DHFR gene can be genetically inactivated within human primary T cells.



FIG. 5 depicts the results of a FACS analysis to check NY-ESO-1 1G4 TCR knockin efficiency in T cells from two donors (BC23 and BC 26) by staining with an anti-Vβ13.1 (Biolegend, cat #362406) antibody that binds to the β-chain of the 1G4 TCR. The T cells have been electroporated with a TRAC RNP (to generate a DNA double strand break at the TRAC locus) and various repair templates (all containing the NY-ESO-1 1G4 TCR sequence) which repair the double strand DNA break and are therefore incorporated at this site.


Left columns show knockin of a repair template only encoding the NY-ESO-1 1G4 TCR, middle columns show knockin of a repair template encoding the 1G4 TCR linked with the nuclease-resistant DHFR gene (IG4 TCR-DHFR KI), right columns show knockin of 1G4 TCR-DHFR repair template combined with simultaneous knockout of endogenous DHFR using DHFR specific sgRNA. Simultaneous knockout of endogenous DHFR leads to efficient selection of T cells with delivery of the 1G4-DHFR repair template at day 6 post-electroporation as the frequency of T cells with the knockin increased from 9% to 51% (5.7 fold enrichment) and 23% to 70% (3 fold enrichment) for BC23 and BC26, respectively. The data indicate the method described in the invention can enrich genetically-modified cells without requiring physical or drug-mediated selection and without the introduction of a genetic sequence encoding an exogenous gene to enable selection.



FIG. 6 depicts the results of a FACS analysis to check NY-E50-1 1G4 TCR knockin efficiency in T cells from two donors (BC23 and BC 26) when the nuclease resistant DHFR transgene is included in the TCRα/β-encoding DNA repair template in combination with knockout of endogenous DHFR. Left columns show knockin of NY-E50-1 1G4 TCR only, middle columns show knockin of 1G4 TCR-DHFR, right columns show knockin of 1G4 TCR-DHFR with simultaneous knockout of endogenous DHFR. The data demonstrate that simultaneous knockout of endogenous DHFR leads to efficient selection of T cells with the 1G4-DHFR KI at day 10 post-electroporation as the frequency of T cells with the knockin increased from 10% to 61% (6.1 fold enrichment) and 30% to 85% (2.8 fold enrichment) for BC23 and BC26, respectively. The data indicate the method described in the invention can enrich genetically-modified cells without requiring physical or drug-mediated selection and without the introduction of a genetic sequence encoding an exogenous gene to allow for selection.


The above data indicate that the method can enrich genetically-engineered cells without requiring physical or drug-mediated selection and without the introduction of a genetic sequence encoding an exogenous gene to enable selection.


There are various strategies to achieve enrichment of gene-edited T cells by knockin of a DNA repair template encoding the therapeutic gene(s) of interest (e.g. TCRα and TCRβ) and an siRNA- or inhibitor-resistant DHFR gene and using an siRNA or an inhibitor (Methotrexate) to suppress endogenous DHFR function rather than knocking it out.



FIG. 7 provides a left panel that shows that TCR expression levels were comparable between 1G4-TCR KI (knockin) T cells and 1G4-TCR-DHFR KI+DHFR KO T cells based on the FACS analysis of TCRVβ13.1 antibody fluorescence intensity in human T cells from two donors (BC23 and BC26). The anti-Vβ13.1 antibody binds to the β-chain of the 1G4 TCR. This data demonstrates that TCR expression achieved with the invention is comparable to site-specific integration of unmodified TCR transgenes.


Right panel shows that the total number of TCR knockin cells are comparable between 1G4-TCR knockin and 1G4-TCR-DHFR KI+DHFR KO T cells in both donor T cells at day 12 post electroporation, demonstrating that T cells modified using the method proliferate after genetic engineering.


Materials and Methods for FIG. 8-FIG. 10

Human primary T cells were isolated and activated by anti-CD3/CD28 beads from four buffy coats from different donors BC29, BC30, BC31 and BC32. Two days after activation, cells were harvested, and electroporation was performed with cells together with the following components: (1) TRAC sgRNA/Cas9 RNP+knockin template encoding NY-ESO-1 1G4 TCR, (2) TRAC sgRNA/Cas9 RNP+knockin template encoding NY-ESO-1 1G4 TCR and DHFR, (3) TRAC sgRNA/Cas9 RNP+knockin template encoding NY-ESO-1 1G4 TCR and DHFR+DHFR sgRNA-1/Cas9 RNP. Electroporation and transduction parameters were the same as above. Cells were harvested for FACS analysis of TCR expression at day 5 (FIG. 8, FIG. 9 and FIG. 10 left). At day 12 post electroporation, total cell number was also counted and TCR knockin cells were calculated and plotted (FIG. 10 right).



FIG. 8 depicts the results of a FACS analysis to check NY-ESO-1 1G4 TCR knockin efficiency in T cells from four donors (BC29, BC30, BC31, and BC32) at day 5 post electroporation when the nuclease resistant DHFR transgene is included in the TCRα/β-encoding DNA repair template in combination with knockout of endogenous DHFR. Left columns show knockin of NY-ESO-1 1G4 TCR, middle columns show knockin of 1G4 TCR-DHFR, right columns show knockin of 1G4 TCR-DHFR with simultaneous knockout of endogenous DHFR; The anti-Vβ13.1 antibody binds to the β-chain of the 1G4 TCR. The data shows that the knockin efficiency for BC23 increased from 25% to 73%; from 24% to 50% for BC30; from 17% to 60% for BC31 and from 17% to 41% for BC32 at day 5 post electroporation. This indicates that the method described in the invention can enrich genetically-modified cells without requiring physical or drug-mediated selection and without the introduction of a genetic sequence encoding an exogenous gene to enable selection.



FIG. 9 provides the quantification data of FIG. 8 indicating that the method can enrich genetically-modified cells without requiring physical or drug-mediated selection and without the introduction of a genetic sequence encoding an exogenous gene to enable selection.



FIG. 10 provides a left panel showing that TCR expression levels are comparable between 1G4-TCR KI and 1G4-TCR-DHFR KI+DHFR KO cells based on the FACS analysis of TCRVβ13.1 fluorescence intensity in human T cells from four donors (BC29, BC30, BC31, and BC32), the anti-Vβ13.1 antibody binds to the β-chain of the 1G4 TCR. Right panel shows that the total number of TCR knockin cells for 1G4-TCR knockin condition is higher compared to either the 1G4-DHFR-KI T cells or 1G4-TCR-DHFR KI+DHFR KO T cells in four donor T cells.


Materials and Methods for FIG. 11-FIG. 12

Human primary T cells were isolated and activated by anti-CD3/CD28 beads from buffy coats BC33 and BC35. Two days after activation, cells were harvested, and electroporation was performed with cells together with the following components: (1) DHFR sgRNA/Cas9 RNP targeting 10 different sites in the DHFR locus, (2) DHFR siRNA targeting 6 different sites in the DHFR mRNA. Three days post electroporation, cells were incubated with MTX-fluorescein overnight and then were harvested for FACS analysis of fluorescein expression (FIG. 12).



FIG. 11 provides the results of using MTX-fluorescein labeling to determine DHFR expression, left panel shows cells without labeling are largely negative for the fluorescein staining; the middle and right figures are cells that have been labeled with MTX-fluorescein; the middle figure shows that control cells (wild-type) are largely positive for the fluorescein staining; the right panel shows that cells that have been electroporated with a DHFR sgRNA are predominantly negative for the MTX-fluorescein staining. This data suggests that fluorescein-labelled MTX can be used to identify DHFR-knockout cells.



FIG. 12, left panel shows the method described in FIG. 11 to screen for efficient guide RNAs which target DHFR; right panel, use of the method described in FIG. 11 to screen for efficient siRNAs which target DHFR.


The results above demonstrate that: 1) DHFR selection strategy can enrich TCR knockin cells robustly, and 2) MTX labelling is able to quantify DHFR expression.


EXAMPLE 2

This example shows that a method according to some embodiments could efficiently enrich genetically-modified T cells by introducing a mutant DHFR gene and subsequently selecting with the clinically-approved drug methotrexate (MTX).


T cells from three donors (BC37, BC38, and BC39) were either knocked in using CRISPR/Cas9 with a control repair template encoding the NY-ESO-1 1G4 TCR (1G4 KI) or a repair template encoding the 1G4 TCR linked with the methotrexate (MTX)-resistant DHFR mutant gene (1G4-DHFRm KI). The T cells were then stained with an anti-Vβ13.1 (Biolegend, cat #362406) antibody that binds to the β-chain of the 1G4 TCR. For cells that were repaired with 1G4-DHFRm KI templates, they were treated with 0.1 μM MTX at day 3 post electroporation for 4 days. For cells that were repaired with 1G4 KI templates, they were left untreated until FACS analysis was performed. FACS analysis was performed on day 11 post electroporation.



FIG. 13A are FACS plots showing the T cells with knockin of the control repair template 1G4 KI, FIG. 13B are FACS plots showing the T cells with knockin of the repair template 1G4-DHFRm KI, and FIG. 13C are bar charts showing the quantification of FIG. 13A and FIG. 13B with two technical replicates.


The data in FIG. 13A-C shows that introduction of MTX-resistant DHFRm and subsequent treatment of the cells with MTX leads to an efficient selection of knockin T cells, as the frequency of T cells with successful knockin increased from 26% to 85% (3.3 fold enrichment), 15% to 73% (4.9 fold enrichment) and 26% to 83% (3.2 fold enrichment) for BC37, BC38, and BC39, respectively. The data indicates that the method described in the invention can efficiently enrich genetically-modified cells by introducing a mutant DHFR gene and subsequently selecting with the clinically-approved drug MTX.



FIG. 14 are bar plots showing the T cell expansion of the two knockin conditions described in FIG. 13. Total cell numbers were counted at day 10 post electroporation and TCR knockin cell numbers were calculated based on the FACS analysis of the knockin efficiency. The data indicated that by applying the MTX selection strategy, the yield of TCR knockin cells is 2-3-fold higher compared with the conventional non-selected method, in three donors.


EXAMPLE 3

This example shows that a method according to some embodiments that efficiently enriched genetically-modified T cells did not significantly alter the proportion of CD4+ cells. CD4+ cells are one of the two main subsets of human T cells (the other being CD8+ T cells). An abnormal proportion of CD4+ cells would indicate impaired immune function.



FIG. 15 shows FACS analysis of the proportion of CD4+ cells in the two knockin conditions described in FIG. 13 by staining with an anti-CD4 antibody (BD Bioscience, cat #: 345768). The data indicated that the proportion of CD4+ cells was comparable between the two conditions, and therefore the MTX-selection strategy did not significantly alter the proportion of CD4+ cells.


EXAMPLE 4

This example shows that a method according to some embodiments did not significantly alter the phenotype of the enriched genetically-modified T cells.



FIG. 16 shows FACS analysis of the phenotype of TCR knockin cells in the two knockin conditions described in FIG. 13 by staining with an anti-CD45RA (BD Biosciences, cat #: 563963) and an anti-CD62L antibody (BD Biosciences, cat #: 562330). The CD45RA+CD62L+ population reflects a naïve stem cell-like phenotype, which is highly functional. The data indicated that the proportion of CD45RA+CD62L+ cells was comparable between the two knockin conditions, and therefore the MTX-selection strategy did not significantly alter the phenotype of the cells.



FIG. 17 shows FACS analysis of the phenotype of TCR knockin cells in the two knockin conditions described in FIG. 13 by staining with an anti-CD27 (BD Biosciences, cat #: 740972) and an anti-CD28 antibody (BD Biosciences, cat #: 559770). The co-receptors CD27 and CD28 are T cell costimulatory molecules and therefore, the double-positive cells are considered highly functional T cells. The data indicated that the proportion of CD27+CD28+ cells was comparable between the two knockin conditions, and therefore the MTX-selection strategy did not significantly alter the phenotype of the cells.


EXAMPLE 5

This example shows the enriched genetically-modified T cells generated by a method according to some embodiments have similar cytolytic capacity as T cells generated without selection.


Human melanoma A375 cells (HLA-A*02:01+NY-ESO-1+) were plated in a six-well plate and different numbers of NY-ESO-1 1G4 TCR knockin T cells as generated in Example 2 (from Donor BC37) were added (E:T ratio from 0:1 to 2:1). After 5 days, the remaining tumor cells were fixed with formaldehyde and stained with crystal violet solution. As shown in FIG. 18, the left plate was co-cultured with unedited T cells, the middle plate was co-cultured with 1G4-knockin T cells (1G4 KI) and the right plate was with MTX-selected 1G4-DHFRm-knockin T cells (1G4-DHFRm KI+MTX). The results indicated that this co-culture assay can demonstrate TCR-specific tumor cell killing, as unedited T cells that do not have NY-ESO-1 1G4 TCR expression cannot kill the tumor cells, while 1G4 TCR knockin T cells (middle and right plates) can efficiently eliminate tumor cells at medium to high E:T ratios. The results also demonstrated that T cells generated by the MTX-selection method (right plate) have similar cytolytic capacity as T cells generated without selection (middle plate).



FIG. 19 shows tumor-T cell co-culture assay with T cells derived from two additional donors (BC38 and BC39). The results confirmed that T cells generated by the MTX-selection method (right column) have similar cytolytic capacity as T cells generated without selection (left column).


EXAMPLE 6

This example shows the enriched genetically-modified T cells generated by a method according to some embodiments have similar IFNγ and IL2 production capacity as T cells generated without selection.


IFNγ is a cytokine that plays a central role in immune responses, and it is considered one of the key features of activated T cells. To study the IFNγ production capacity of the enriched genetically-modified T cells (as generated in Example 2), human melanoma A375 (HLA-A*02:01+NY-ESO-1+) cells were plated in 96-well plates and different numbers of NY-ESO-1 1G4 TCR knockin T cells (from two donors, FIG. 20, first row: donor BC37, second row: donor BC39) were added (E:T ratio of 1:2 to 1:8, first three columns). As a positive control for stimulation, PMA and Ionomycin (PMA+ION, right column) were added. The T cells were stimulated overnight in the presence of brefeldin A (Golgi-plug BD Biosciences, cat #: 554724) to prevent the cytokine secretion and collected for FACS analysis of IFNγ production by intracellular staining with an anti-IFNγ antibody (BD Biosciences, cat #: 340452) and an anti-IL2 antibody (BD Biosciences, cat #: 340448). The proportion of IFNγ-producing T cells were plotted as shown in FIG. 20. The data indicated that the T cells generated by the MTX-selection method (1G4-DHFRm KI+MTX) have similar IFNγ production capacity as T cells generated without selection (1G4 KI).



FIG. 21 are bar plots showing the IFNγ production capacity of T cells when stimulated with tumor cells. As in FIG. 20, T cells were stimulated with A375 cells at different E:T ratios, and IFNγ expression levels (determined by Mean Fluorescence Intensity, MFI) were plotted here. The data indicated that the T cells generated by the MTX-selection method (1G4-DHFRm KI+MTX) produce a similar amount of IFNγ compared with T cells generated without selection (1G4 KI).



FIG. 22 are bar plots showing the IL2 production capacity of T cells when stimulated with tumor cells. As in FIG. 20 and FIG. 21, T cells were stimulated with A375 cells at different E:T ratios. The proportion of IL2-producing cells (left panel) and their expression levels (MFI, right panel) were plotted here. The left panel indicated that the T cells generated by the MTX-selection method (1G4-DHFRm KI+MTX) have a higher proportion of IL2-producing cells as T cells generated without selection (1G4 KI), while the right panel indicated that the T cells generated by the MTX-selection method (1G4-DHFRm KI+MTX) produce a similar amount of IL2 compared with T cells generated without selection (1G4 KI).


EXAMPLE 7

This example shows the enriched genetically-modified T cells generated by a method according to some embodiments have similar proliferation capacity as T cells generated without selection.



FIG. 23 are histograms showing the T cell proliferation capacity when stimulated with tumor cells. A375 cells were plated on 24 well plates, and different ratios of CFSE-labeled T cells (E:T of 1:2 and 1:4) were added to the plate. T cells were harvested 3 days later for FACS analysis of CFSE dilution. The data indicated that the proliferation capacity of T cells generated by the MTX-selection method (1G4-DHFRm KI+MTX) upon stimulation with tumor cells was comparable with T cells generated without selection (1G4 KI).


EXAMPLE 8

This example shows that the split-DHFR strategy can efficiently enrich double engineered T cells, and that this enrichment operates in a MTX dose-dependent manner.



FIG. 28 shows the FACS results of BC45 and BC46 double transduction. Activated human primary T cells isolated from two buffy coats, BC45 and BC46, were double-infected with BEAV retroviral vectors encoding an MTX-resistant murine DHFRFS mutant (mDHFRmt) split into a N-terminal and C-terminal protein half (vector A and B) fused to homodimerizing (GCN4) or heterodimerizing (JUN-FOS) leucine zippers. Vector A and B also encoded a Ly6G or CD90.2 transduction marker, respectively. FACS analysis of transduction efficiency was performed at day 3 post virus infection. The data indicated that cells were efficiently transduced with vector pair 17-18 (GCN4-mDHFRmt_A and GCN4-mDHFRmt_B) and vector pair 30-31 (JUN-mDHFRmt_A-2A and FOS-mDHFRmt_B-2A). The double transduction efficiency for these vector pairs varied from 34.4% to 72.4%. In contrast, the double transduction efficiency for vector pair 21-22 (JUN-mDHFRmt_A and FOS-mDHFRmt_B) and vector pair 23-24 (GCN4-mDHFRmt_A-2A and GCN4-mDHFRmt_B-2A) was relatively low (from 0.058% to 0.12%). To determine whether the double transduced cells could be enriched, cells of pair 17-18 and pair 30-31 were mixed with a large amount of untransduced cells to mimic a low transduction efficiency setting.



FIG. 29 shows the results of MTX selection of BC 45 cells. BC45 cells from FIG. 28 were left untreated (row 1), or were treated with 25 nM (row 2) or 50 nM (row 3) MTX for 4 days (after determination of transduction efficiency), after which enrichment of double transduced cells was measured by FACS analysis. The data indicated that cells infected with vector pair 17-18 were enriched from 11% to 41% (25 nM MTX; 3.7 fold) and 67% (50 nM MTX; 6.1 fold), that cells infected with vector pair 21-22 were enriched from 0.12% to 0.53% (50 nM MTX; 4.4 fold), that cells infected with vector pair 23-24 were enriched from 0.18% to 2.18% (50 nM MTX; 12 fold), and that cells infected with vector pair 30-31 were enriched from 6% to 32% (25 nM MTX; 5.3 fold) and 63% (50 nM MTX; 10.5 fold). Together, these data showed that the split-DHFR strategy can efficiently enrich double engineered T cells, and that this enrichment operates in a MTX dose-dependent manner.



FIG. 30 shows the results of MTX selection of BC 46 cells. BC46 cells from FIG. 28 were left untreated (row 1), or were treated with 25 nM (row 2) or 50 nM (row 3) MTX for 4 days (after determination of transduction efficiency), after which enrichment of double transduced cells was measured by FACS analysis. The data indicated that cells infected with vector pair 17-18 were enriched from 13% to 38% (25 nM MTX; 2.9 fold) and 68% (50 nM MTX; 5.2 fold), that cells infected with vector pair 21-22 were enriched from 0.05% to 0.31% (50 nM MTX; 6.2 fold), that cells infected with vector pair 23-24 were enriched from 0.14% to 0.82% (50 nM MTX; 5.9 fold), and that cells infected with vector pair 30-31 were enriched from 7% to 25% (25 nM MTX; 3.6 fold) and 58% (50 nM MTX; 8.3 fold). Together, these data showed that the split-DHFR strategy can efficiently enrich double engineered T cells, and that this enrichment operates in a MTX dose-dependent manner.



FIG. 31 shows the results of selecting BC 45 cells in higher MTX concentration. BC45 cells from FIG. 29 were continuously treated with 100 nM MTX for another 3 days, after which enrichment of double transduced cells was measured by FACS analysis. The data indicated that cells infected with vector pair 17-18 were enriched from 7.85% to 65.9% (row 2; 8.4 fold) and 75.8% (row 3; 9.7 fold), that cells infected with vector pair 21-22 were enriched from 0.03% to 0.34% (row 2; 11.3 fold) and 2.82% (row 3; 94 fold), that cells infected with vector pair 23-24 were enriched from 0.08% to 2.33% (row 2; 29 fold) and 11% (row 3; 138 fold), and that cells infected with vector pair 30-31 were enriched from 4.4% to 68% (row 2; 15.5 fold) and 83% (row 3; 18.9 fold). Together, these data showed that the split-DHFR strategy can efficiently enrich double engineered T cells, and that this enrichment operates in a MTX dose-dependent manner.



FIG. 32 shows the results of selecting BC 46 cells in higher MTX concentration. BC46 cells from FIG. 30 were continuously treated with 100 nM MTX for another 3 days, after which enrichment of double transduced cells was measured by FACS analysis. The data indicated that cells infected with vector pair 17-18 were enriched from 9.86% to 59% (row 2; 6 fold) and 80% (row 3; 8.1 fold), that cells infected with vector pair 21-22 were enriched from 0.05% to 0.2% (row 2; 4 fold) and 1.16% (row 3; 23.2 fold), that cells infected with vector pair 23-24 were enriched from 0.07% to 0.4% (row 2; 5.7 fold) and 1.83% (row 3; 26.1 fold), and that cells infected with vector pair 30-31 were enriched from 4.5% to 47% (row 2; 10.4 fold) and 76% (row 3; 16.9 fold). Together, these data showed that the split-DHFR strategy can efficiently enrich double engineered T cells, and that this enrichment operates in a MTX dose-dependent manner.


EXAMPLE 9

This example shows that a split-DHFR system using mutant JUN-FOS leucine zippers can enrich double engineered T cells with comparable efficiency as one using wildtype JUN-FOS leucine zippers.



FIGS. 43A and 43B show the results of MTX selection of double engineered BC54 T cells. Activated human primary T cells isolated from a buffy coat, BC54, were double-infected with BEAV retroviral vectors encoding an MTX-resistant murine DHFRFS mutant (mDHFR) split into an N-terminal and C-terminal protein half (vector A and B), fused to heterodimerizing JUN-FOS leucine zippers. JUNWT depicts a wildtype JUN leucine zipper, FOSWT depicts a wildtype FOS leucine zipper, JUNMUT3AA depicts a mutant JUN leucine zipper containing three acidic amino acids from FOS, FOSMUT3AA depicts a mutant FOS leucine zipper containing three basic amino acids from JUN. Vector A and B also encoded a Ly6G and CD90.2 transduction marker, respectively. Starting at 4 days post transduction, cells were either left untreated (row 1), or were treated with 100 nM MTX for 2 days (row 2), after which enrichment of double transduced cells was measured by FACS analysis. The data indicated that cells infected with vector pair JUNWT-mDHFR_A+FOSWT-mDHFR_B were enriched from 7.97% to 54.1% (6.8 fold), that cells infected with vector pair JUNMUT3AA-mDHFR_A+FOSMUT3AA-mDHFR_B were enriched from 10.3% to 57.9% (5.6 fold), that cells infected with vector pair JUNWT-mDHFR_A+FOSMUT3AA-mDHFR_B were enriched from 6.26% to 12.0% (1.9 fold), and that cells infected with vector pair JUNMUT3AA-mDHFR_A+FOSWT-mDHFR_B were enriched from 7.73% to 30.5% (3.9 fold). Together, these data showed that a split-DHFR system using mutant JUN-FOS leucine zippers with three charge-pair mutations can efficiently enrich double engineered T cells, but that three charge-pair mutations are insufficient to abolish interaction with wildtype JUN and FOS leucine zippers.



FIGS. 44A-44D show the results of MTX selection of double engineered BC76 T cells. Activated human primary T cells isolated from a buffy coat, BC76, were double-infected with retroviral vectors encoding an MTX-resistant murine DHFRFS mutant (mDHFR) split into an N-terminal and C-terminal protein half (vector A and B), fused to heterodimerizing JUN-FOS leucine zippers. JUNWT depicts a wildtype JUN leucine zipper, FOSWT depicts a wildtype FOS leucine zipper, JUNMUT3AA depicts a mutant JUN leucine zipper containing three acidic amino acids from FOS, FOSMUT3AA depicts a mutant FOS leucine zipper containing three basic amino acids from JUN, JUNMUT4AA depicts a mutant JUN leucine zipper containing four acidic amino acids from FOS, FOSMUT4AA depicts a mutant FOS leucine zipper containing four basic amino acids from JUN. Vector A and B also encoded a Ly6G and CD90.2 transduction marker, respectively. Starting at 4 days post transduction, cells were either left untreated (row 1), or were treated with 100 nM MTX for 10 days (row 2), after which enrichment of double transduced cells was measured by FACS analysis. The data indicated that cells infected with vector pair JUNWT-mDHFR_A+FOSWT-mDHFR_B were enriched from 0.61% to 80.4% (132 fold), that cells infected with vector pair JUNMUT3AA-mDHFR_A+FOSMUT3AA-mDHFR_B were enriched from 0.98% to 70.9% (72 fold), that cells infected with vector pair JUNWT-mDHFR_A+FOSMUT3AA-mDHFR_B were enriched from 0.97% to 3.01% (3.1 fold), that cells infected with vector pair JUNMUT3AA-mDHFR_A+FOSWT-mDHFR_B were enriched from 1.09% to 20.9% (19 fold), that cells infected with vector pair JUNMUT4AA-mDHFR_A+FOSMUT4AA-mDHFR_B were enriched from 1.04% to 72.6% (70 fold), that cells infected with vector pair JUNWT-mDHFR_A+FOSMUT4AA-mDHFR_B were enriched from 1.00% to 1.42% (1.4 fold), and that cells infected with vector pair JUNMUT4AA-mDHFR_A+FOSWT-mDHFR_B were enriched from 0.86% to 2.23% (2.6 fold). Together, these data showed that a split-DHFR system using mutant JUN-FOS leucine zippers with four charge-pair mutations can efficiently enrich double engineered T cells, and that four charge-pair mutations are sufficient to largely abolish interaction with wildtype JUN and FOS leucine zippers.


EXAMPLE 10

This example shows that a split-DHFR system using mutant FKBP12 dimerization domains can enrich double engineered T cells in the presence of the chemical dimerization inducer AP1903.



FIGS. 45A-45B show the results of MTX selection of double engineered BC81 T cells. Activated human primary T cells isolated from a buffy coat, BC81, were double-infected with retroviral vectors encoding an MTX-resistant murine DHFRFS mutant (mDHFR) split into an N-terminal and C-terminal protein half (vector A and B), fused to homodimerizing mutant FKBP12 domains. Untransduced depicts non-transduced cells, FKBP12F36V depicts an FKBP12 protein containing an F36V mutation, which enhances binding to the AP1903 dimerizer drug. Vector A and B also encoded a Ly6G and CD90.2 transduction marker, respectively. Starting at 4 days post transduction, cells were either left untreated (columns 1 and 2) or were treated with 10 nM AP1903 for 4 hours (column 3). Subsequently, cells were left untreated (row 1), or were treated with 100 nM MTX for 8 days (row 2), after which enrichment of double transduced cells was measured by FACS analysis. The data indicated that cells infected with vector pair FKBP12F36V-mDHFR_A+FKBP12F36V-mDHFR_B without AP1903 treatment were enriched from 0.051% to 0.042% (0.82 fold), and that cells infected with vector pair FKBP12F36V-mDHFR_A+FKBP12F36V-mDHFR_B with AP1903 treatment were enriched from 0.061% to 18.1% (297 fold). Together, these data showed that a split-DHFR system using mutant FKBP12 dimerization domains can efficiently enrich double engineered T cells, and that this enrichment operates in an AP1903-dependent manner.


EXAMPLE 11

This example shows that a split-DHFR system using mutant FKBP12 dimerization domains or mutant JUN-FOS leucine zippers can enrich double engineered T cells that have knock-in of a first exogenous protein into a first locus and a second exogenous protein into a second locus.



FIG. 46 shows the results of MTX selection of double engineered BC78 T cells. Activated human primary T cells isolated from a buffy coat, BC78, were electroporated with Cas9 RNPs and repair templates encoding an MTX-resistant murine DHFRFS mutant (mDHFR) split into an N-terminal and C-terminal protein half (repair template A and B), fused to homodimerizing mutant FKBP12 domains, or heterodimerizing mutant JUN-FOS leucine zippers. Unedited depicts unelectroporated cells, FKBP12F36V-mDHFR_A depicts TRAC locus knock-in of a repair template encoding the NY-ESO-1 1G4 TCR and an FKBP12 protein containing an F36V mutation, FKBP12F36V-mDHFR_B depicts B2M locus knock-in of a repair template encoding a dominant-negative TGFBR2, Ly6G and an FKBP12 protein containing an F36V mutation, JUNMUT4AA-mDHFR_A depicts TRAC locus knock-in of a repair template encoding the NY-ESO-1 1G4 TCR and a mutant JUN leucine zipper containing four acidic amino acids from FOS, and FOSMUT4AA-mDHFR_B depicts B2M locus knock-in of a repair template encoding a dominant-negative TGFBR2, Ly6G and a mutant FOS leucine zipper containing four basic amino acids from JUN. Starting at 4 days post electroporation, cells were either left untreated (columns 1 and 3) or were treated with 10 nM AP1903 for 1 hour (column 2). Subsequently, cells were left untreated (row 1), or were treated with 100 nM MTX for 6 days (row 2), after which enrichment of double engineered cells was measured by FACS analysis. The data indicated that cells edited with repair template pair FKBP12F36V-mDHFR_A+FKBP12F36V-mDHFR_B were enriched from 0.21% to 22.1% (105 fold), and that cells edited with repair template pair JUNMUT4AA-mDHFR_A+FOSMUT4AA-mDHFR_B were enriched from 0.22% to 11.8% (54 fold). Together, these data showed that a split-DHFR system using mutant FKBP12 dimerization domains or mutant JUN-FOS leucine zippers with four charge-pair mutations can efficiently enrich double engineered T cells that have knock-in of multiple exogenous proteins into two different loci.


EXAMPLE 12

This example shows that a split-DHFR system using mutant JUN-FOS leucine zippers can enrich double engineered T cells with comparable efficiency as one using wildtype JUN-FOS leucine zippers.



FIGS. 47A, 47B and 48 show the results of MTX selection of double engineered T cells from donor A and B. Activated human primary T cells isolated from two buffy coats A and B, were double-infected with retroviral vectors encoding an MTX-resistant murine DHFRFS mutant (mDHFR) split into an N-terminal and C-terminal protein half (vector A and B), fused to heterodimerizing JUN-FOS leucine zippers. JUNWT depicts a wildtype JUN leucine zipper, FOSWT depicts a wildtype FOS leucine zipper, JUNMUT3AA depicts a mutant JUN leucine zipper containing three acidic amino acids from FOS, FOSMUT3AA depicts a mutant FOS leucine zipper containing three basic amino acids from JUN. Vector A and B also encoded a Ly6G and CD90.2 transduction marker, respectively. Starting at 4 days post transduction, cells (from donor B) were either left untreated (FIGS. 47A and 47B, row 1), or were treated with 100 nM MTX for 4 days (FIGS. 47A and 47B, row 2), after which enrichment of double transduced cells was measured by FACS analysis. The data indicated that cells (from donor B) infected with vector pair JUNWT-mDHFR_A+FOSWT-mDHFR_B were enriched from 5.18% to 80.5% (15.5 fold), that cells infected with vector pair JUNMUT3AA-mDHFR_A+FOSMUT3AA-mDHFR_B were enriched from 8.37% to 88.1% (10.5 fold), that cells infected with vector pair JUNWT-mDHFR_A+FOSMUT3AA-mDHFR_B were enriched from 5.24% to 20.8% (4 fold), and that cells infected with vector pair JUNMUT3AA-mDHFR_A+FOSWT-mDHFR_B were enriched from 6.28% to 70.5% (11.2 fold). Together, these data showed that a split-DHFR system using mutant JUN-FOS leucine zippers with three charge-pair mutations can efficiently enrich double engineered T cells, but that three charge-pair mutations are insufficient to abolish interaction with wildtype JUN and FOS leucine zippers. FIG. 48 shows the FACS quantification data of cells from both donor A and donor B.



FIGS. 49 and 50 show the results of MTX selection of double engineered T cells from two donors. Activated human primary T cells isolated from buffy coats from two donors (A and B), were double-infected with retroviral vectors encoding an MTX-resistant murine DHFRFS mutant (mDHFR) split into an N-terminal and C-terminal protein half (vector A and B), fused to heterodimerizing JUN-FOS leucine zippers of shorter length (all FOS JUN leucine zippers described in this slides are of shorter length). JUNWT depicts a wildtype JUN leucine zipper, FOSWT depicts a wildtype FOS leucine zipper, JUNMUT3AA depicts a mutant JUN leucine zipper containing three acidic amino acids from FOS, FOSMUT3AA depicts a mutant FOS leucine zipper containing three basic amino acids from JUN, JUNMUT4AA depicts a mutant JUN leucine zipper containing four acidic amino acids from FOS, FOSMUT4AA depicts a mutant


FOS leucine zipper containing four basic amino acids from JUN. Vector A and B also encoded a Ly6G and CD90.2 transduction marker, respectively. Starting at 4 days post transduction, cells were either left untreated, or were treated with 100 nM MTX for 6 days, after which enrichment of double transduced cells was measured by FACS analysis. The data (FIG. 49) indicated that cells infected with vector pair JUNWT-mDHFR_A+FOSWT-mDHFR_B were enriched 66±6.6 (donor A) and 7.6±1.1 (donor B) fold, that cells infected with vector pair JUNMUT3AA-mDHFR_A+FOSMUT3AA-mDHFR_B were enriched 49±1.5 (donor A), 6.6±0.9 (donor B) fold, that cells infected with vector pair JUNWT-mDHFR_A+FOSMUT3AA-mDHFR_B were enriched 1.7±0.1 (donor A) and 1.4±0.17 (donor B) fold, that cells infected with vector pair JUNMUT3AA-mDHFR_A+FOSWT-mDHFR_B were enriched 3.2±0.66 (donor A) and 1.5±0.38 (donor B) fold. The data (FIG. 50) indicated that cells infected with vector pair JUNMUT4AA-mDHFR_A+FOSMUT4AA-mDHFR_B were enriched from enriched 39±13 (donor A) and 4.7±0.32 (donor B) fold, that cells infected with vector pair JUNWT-mDHFR_A+FOSMUT4AA-mDHFR_B were enriched 1.5±0.13 (donor A) and 1.2±0.043 (donor B), and that cells infected with vector pair JUNMUT4AA-mDHFR_A+FOSWT-mDHFR_B were enriched 2.2±0.43 (donor A) and 1.5±0.21 (donor B). Together, these data showed that a split-DHFR system using mutant a shorter JUN-FOS leucine zippers with either three or four charge-pair mutations can efficiently enrich double engineered T cells, and that either three or four charge-pair mutations are sufficient to largely abolish interaction with wildtype JUN and FOS leucine zippers.


EXAMPLE 13

This example shows that a split-DHFR system using eight charge-pair mutations JUN-FOS leucine zippers cannot enrich double engineered T cells.



FIGS. 51A, 51B, and 52 show the results of MTX selection of double engineered T cells from donor A and B. Activated human primary T cells isolated from two buffy coats A and B, were double-infected with retroviral vectors encoding an MTX-resistant murine DHFRFS mutant (mDHFR) split into an N-terminal and C-terminal protein half (vector A and B), fused to heterodimerizing JUN-FOS leucine zippers. sJUN depicts a shorter wildtype JUN leucine zipper, sFOS depicts a wildtype FOS leucine zipper, sJUNMUT8AA depicts a shorter mutant JUN leucine zipper containing eight acidic amino acids from FOS, sFOSMUT8AA depicts a mutant FOS leucine zipper containing eight basic amino acids from JUN. Vector A and B also encoded a Ly6G and CD90.2 transduction marker, respectively. Starting at 4 days post transduction, cells (from donor B) were either left untreated (FIGS. 51A and 51B, row 1), or were treated with 100 nM MTX for 6 days (FIGS. 51A and 51B, row 2), after which enrichment of double transduced cells was measured by FACS analysis. The data (FIGS. 51A and 51B) indicated that cells (from donor A) infected with vector pair sJUN-mDHFR_A+sFOS-mDHFR_B were enriched from 6.52% to 80.4% (12.3 fold), that cells infected with vector pair sJUNMUT8AA-mDHFR_A+sFOSMUT8AA-mDHFR_B were enriched from 0.48% to 1.07% (2.2 fold), that cells infected with vector pair sJUN-mDHFR_A+sFOSMUT8AA-mDHFR_B were enriched from 3.91% to 6% (1.5 fold), and that cells infected with vector pair sJUNMUT8AA-mDHFR_A+sFOS-mDHFR_B were enriched from 0.82% to 0.73% (0.9 fold). The data from FIG. 52 shows the quantification of FACS plot from both donor A and B. In conclusion, these data showed that a split-DHFR system using mutant JUN-FOS leucine zippers with eight charge-pair mutations cannot enrich double engineered T cells.


EXAMPLE 14

This example shows that a split-DHFR system using mutant FKBP12 dimerization domains can enrich double engineered T cells in the presence of the chemical dimerization inducer AP1903.



FIG. 53 shows the results of MTX selection of double engineered T cells from donor A and B. Activated human primary T cells isolated from two buffy coats donor A and B, were double-infected with retroviral vectors encoding an MTX-resistant murine DHFRFS mutant (mDHFR) split into an N-terminal and C-terminal protein half (vector A and B), fused to homodimerizing mutant FKBP12 domains. Untransduced depicts non-transduced cells, FKBP12F36V depicts an FKBP12 protein containing an F36V mutation, which enhances binding to the AP1903 dimerizer drug. Vector A and B also encoded a Ly6G and CD90.2 transduction marker, respectively. Starting at 4 days post transduction, cells were either left untreated or were treated with 10 nM AP1903 for 4 hours. Subsequently, cells were left untreated, or were treated with 100 nM MTX for 6 days, after which enrichment of double transduced cells was measured by FACS analysis. The data indicated that cells infected with vector pair FKBP12F36V-mDHFR_A+FKBP12F36V-mDHFR_B with AP1903 treatment were enriched 188±53 (donor A) and 39±18 (donor B), respectively. Together, these data showed that a split-DHFR system using mutant FKBP12 dimerization domains can efficiently enrich double engineered T cells.


EXAMPLE 15

This example shows that B2M guides can mediate efficient cutting at B2M locus.



FIG. 54 shows the results of screening of efficient guides targeting B2M locus. Activated human primary T cells isolated from a buffy coat, were electroporated with five Cas9 RNPs targeting distinct B2M locus. Two days post electroporation, cells were FACS analyzed by measuring HLA-ABC expression. The data indicated that crB2M-4 and crB2M-5 can target B2M locus with knockout efficiency above 80%. Based on this data, crB2M-4 and crB2M-5 were chosen for subsequent knockin experiments.


Exemplary Arrangements (a):

1. A method for selection or enrichment of a genetically engineered cell comprising:

    • i) introducing into a cell at least one two-part nucleotide sequence capable of expressing both the first-part and second-part nucleotide sequences in the cell,
    • wherein the cell has an essential protein for the survival and/or proliferation that is reduced to a level that the cell cannot survive and/or proliferate in a normal cell culture medium,
    • wherein the at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, and
    • wherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding the essential protein for the survival and/or proliferation, or a variant thereof, and a second-part nucleotide sequence encoding a protein to be expressed, wherein the second-part nucleotide sequence encodes a protein of interest; and
    • ii) culturing the cell in the normal cell culture medium without a pharmacologic exogenous selection pressure for selection or enrichment of the cell that expresses both the first-part and second-part nucleotide sequences.


2. A method for selection or enrichment of a genetically engineered cell comprising:

    • i) reducing the level of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions;
    • ii) introducing into the cell at least a two-part nucleotide sequence that is capable of expressing both the first-part and second-part nucleotide sequences in the cell and comprises a first-part nucleotide sequence encoding the first protein, or a variant thereof, and a second-part nucleotide sequence encoding a second protein to be expressed,
    • wherein the at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, and
    • wherein the second-part protein is a protein of interest, and
    • iii) culturing the cell under normal in vitro propagation conditions without a pharmacologic exogenous selection pressure for enrichment of the cell that expresses both the first protein and second protein.


3. The method of any one of arrangements 1 or 2, wherein the reduction in level of the essential protein can be permanent or transient.


4. The method of any one of arrangements 2-3, wherein the reduction in level of the essential protein comprises a knock-out of the gene encoding the essential protein.


5. The method of arrangement 4, wherein the knock-out is mediated by CRISPR Ribonucleoprotein (RNP), TALEN, MegaTAL, or any other nucleases.


6. The method of any one of arrangements 2-3, wherein the reduction in level of the essential protein comprises transient reduction in the level of the essential protein at the RNA level.


7. The method of arrangement 6, wherein the transient suppression is through siRNA, miRNA, or CRISPR interference (CRISPRi).


8. The method of any one of arrangements 1-7, wherein the cell is a T cell, NK cell, NKT cell, iNKT cell, hematopoietic stem cell, mesenchymal stem cell, iPSC, neural precursor cell, a cell type in retinal gene therapy, or any other cell.


9. The method of any one of arrangements 1-8, wherein the first-part nucleotide sequence is altered in nucleotide sequence to achieve nuclease, siRNA, miRNA, or CRISPRi resistance.


10. The method of arrangement 9, wherein the first part nucleotide sequence encodes a protein having an identical amino acid sequence to the essential first protein.


11. The method of any one of the preceding arrangements, wherein the first-part nucleotide sequence is altered to encode an altered protein that does not have an identical amino acid sequence to the first protein.


12. The method of arrangement 11, wherein the altered protein has specific features that the first protein does not have.


13. The method of arrangement 12, wherein specific features include, but are not limited to, one or more of the following: reduced activity, increased activity, and altered half-life.


14. The method of any of the preceding arrangements, wherein both the first-part and the second-part nucleotide sequences can be driven by a same promoter or different promoters.


15. The method of any one of the preceding arrangements, wherein the second-part nucleotide sequence comprises at least a therapeutic gene.


16. The method of any one of the preceding arrangements, wherein the second-part nucleotide sequence encodes a neo-antigen T-cell receptor complex (TCR) containing a TCR alpha chain and a TCR beta chain.


17. The method of any one of the preceding arrangements, wherein the essential or first protein is dihydrofolate reductase (DHFR), Inosine Monophosphate Dehydrogenase 2 (IMPDH2), O-6-Methylguanine-DNA Methyltransferase (MGMT), Deoxycytidine kinase (DCK), Hypoxanthine Phosphoribosyltransferase 1 (HPRT1), Interleukin 2 Receptor Subunit Gamma (IL2RG), Actin Beta (ACTB), Eukaryotic Translation Elongation Factor 1 Alpha 1 (EEF1A1), Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH), Phosphoglycerate Kinase 1 (PGK1), or Transferrin Receptor (TFRC).


18. The method of any one of the preceding arrangements, wherein the first-part nucleotide sequence comprises a nuclease-resistant or siRNA-resistant DHFR gene, and the second-part nucleotide sequence comprises a TRA gene and a TRB gene.


19. The method of arrangement 18, wherein the TRA, TRB, and DHFR genes are operably configured to be expressed from a single open reading frame.


20. The method of arrangement 19, wherein the TRA, TRB, and DHFR genes are separated by an at least one linker.


21. The method of arrangement 20, wherein the order of the at least one linker, TRA, TRB, and DHFR genes is the following:


TRA-linker-TRB-linker-DHFR,


TRA-linker-DHFR-linker-TRB,


TRB-linker-TRA-linker-DHFR,


TRB-linker-DHFR-linker-TRA,


DHFR-linker-TRA-linker-TRB, or


DHFR-linker-TRB-linker-TRA.


22. The method of arrangement 20 or 21, wherein the at least one linker is an at least one self-cleaving 2A peptide and/or an at least one IRES element.


23. The method of any one of arrangements 18-22, wherein the DHFR, TRA, and TRB genes are driven by an endogenous TCR promoter or any other suitable promoters including, but not limited to the following promoters: TRAC, TRBC1/2, DHFR, EEF1A1, ACTB, B2M, CD52, CD2, CD3G, CD3D, CD3E, LCK, LAT, PTPRC, IL2RG, ITGB2, TGFBR2, PDCD1, CTLA4, FAS, TNFRSF1A (TNFR1), TNFRSF10B (TRAILR2), ADORA2A, BTLA, CD200R1, LAG3, TIGIT, HAVCR2 (TIM3), VSIR (VISTA), IL10RA, IL4RA, EIF4A1, FTH1, FTL, HSPA5, and PGK1.


24. The method of any one of the preceding arrangements, wherein the two-part nucleotide sequence is integrated into the genome of the cell.


25. The method of any one of the preceding arrangements, wherein the at least one two part nucleotide sequence becomes operable for expression when inserted into the pre-determined site in the target genome and both the first-part and second-part nucleotide sequences are driven by a promoter in the target genome.


26. The method of arrangement 24 or 25, wherein the integration is through nuclease-mediated site-specific integration, transposon-mediated gene delivery, or virus-mediate gene delivery.


27. The method of arrangement 26, wherein the nuclease-mediated site-specific integration is through CRISPR RNP, optionally a CRISPR/Cas9 RNP.


28. The method of arrangement 27, further comprising using the Split intein system.


29. The method of any one of arrangements 1-23, wherein the introduced two-part nucleotide sequence is not integrated into the genome of the cell.


30. The method of any one of arrangements 1-27, wherein a CRISPR RNP that targets an endogenous TCR Constant locus, the first-part nucleotide sequence encoding a nuclease-resistant DHFR gene, and the second-part nucleotide sequence encoding a neo-antigen TCR are delivered to the cell.


31. The method of arrangement 30, wherein the endogenous TCR constant locus can be a TCR alpha Constant (TRAC) locus or a TCR beta Constant (TRBC) locus.


32. The method of arrangement 30 or 31, wherein the delivery is by electroporation, or methods based on mechanical or chemical membrane permeabilization.


33. The method of any one of arrangements 1-5, 8-28, or 30-32, wherein a first CRISPR RNP is used to knock-out endogenous dihydrofolate reductase (DHFR) gene, and a second CRISPR RNP is used to knock-in into an endogenous TCR constant locus the first-part nucleotide sequence comprising the CRISPR nuclease-resistant DHFR gene and the second-part nucleotide sequence encoding a therapeutic TCR gene.


34. The method of arrangement 33, wherein the second CRISPR RNP is a TRAC RNP that cuts the TRAC locus for knock-in.


35. The method of any one of arrangements 5, 27, 30, 33, or 34, wherein the CRISPR RNP is a CRISPR/Cas9 RNP.


36. The method of any one of arrangements 1-35, wherein the normal cell culture medium is one that is suitable for non-modified cell's growth and/or proliferation.


37. The method of any one of arrangements 1-36, wherein the normal cell culture medium is without any exogenous selection pressure.


38. The method of any one of arrangements 5-37 wherein a CRISPR RNP is used to knock-in into a pre-determined site in the target genome a second two-part nucleotide, optionally wherein the pre-determined site in the target genome is the B2M gene.


39. A method for selection or enrichment of a genetically engineered cell comprising:

    • i) introducing into a cell at least one two-part nucleotide sequence capable of expressing both the first-part and second-part nucleotide sequences in the cell,
    • wherein the cell has the functional activity of an essential protein for the survival and/or proliferation that is reduced such that the cell cannot survive and/or proliferate in a normal cell culture medium,
    • wherein the at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, and
    • wherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encodes a first protein that provides a substantially equivalent function to the essential protein for the survival and/or proliferation and a second-part nucleotide sequence encodes a second protein to be expressed, wherein the second protein that is a protein of interest; and
    • ii) culturing the cell in cell culture medium containing at least one supplement leading to enrichment or selection of the cell that expresses both the first protein and the second protein.


40. A method for selection or enrichment of a genetically engineered cell comprising:

    • i) reducing the functional activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions;
    • ii) introducing into the cell at least a two-part nucleotide sequence that is capable of expressing both the first-part and second-part nucleotide sequences in the cell and comprises a first-part nucleotide sequence encodes a first protein that provides a substantially equivalent function to and a second-part nucleotide sequence encoding a second protein to be expressed,
    • wherein the at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, and
    • wherein the second protein is a protein of interest, and
    • iii) culturing the cell in cell culture medium containing at least one supplement leading to selection or enrichment of the cell that expresses both the first protein and the second protein.


41. The method of arrangement 39 or 40, wherein the cell is a T cell, NK cell, NKT cell, iNKT cell, hematopoietic stem cell, mesenchymal stem cell, iPSC, neural precursor cell, a cell type in retinal gene therapy, or any other cell.


42. The method of any one of arrangements 39-41, wherein the first-part nucleotide sequence is altered in nucleotide sequence to achieve nuclease, siRNA, miRNA, or CRISPRi resistance, and either a) encodes a protein having an identical amino acid sequence to the first protein or b) encodes a protein having an adjusted functionality to the first protein.


43. The method of any one of arrangements 39-42, wherein the first-part nucleotide sequence is altered to encode an altered protein that does not have an identical amino acid sequence to the first protein.


44. The method of arrangement 43, wherein the altered protein has specific features that the first protein does not have.


45. The method of arrangement 44, wherein the specific features include, but are not limited to, one or more of the following: reduced activity, increased activity, altered half-life resistance to small molecule inhibition, and increased activity after small molecule binding.


46. The method of any one of arrangements 39-45, wherein both the first-part and second-part nucleotide sequences can be driven by a same promoter or different promoters.


47. The method of any one of arrangements 39-46, wherein the second-part nucleotide sequence comprises at least a therapeutic gene.


48. The method of any one of arrangements 39-47, wherein the second-part nucleotide sequence encodes a neo-antigen T-cell receptor complex (TCR) containing a TCR alpha chain and a TCR beta chain.


49. The method of any one of arrangements 39-48, wherein the essential or first protein is dihydrofolate reductase (DHFR), Inosine Monophosphate Dehydrogenase 2 (IMPDH2), O-6-Methylguanine-DNA Methyltransferase (MGMT), Deoxycytidine kinase (DCK), Hypoxanthine Phosphoribosyltransferase 1 (HPRT1), Interleukin 2 Receptor Subunit Gamma (IL2RG), Actin Beta (ACTB), Eukaryotic Translation Elongation Factor 1 Alpha 1 (EEF 1A1), Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH), Phosphoglycerate Kinase 1 (PGK1), or Transferrin Receptor (TFRC).


50. The method of any one of arrangements 39-49, wherein the first-part nucleotide sequence comprises a protein inhibitor-resistant DHFR gene, and the second-part nucleotide sequence comprises a TRA gene and a TRB gene.


51. The method of arrangement 50, wherein the TRA, TRB, and DHFR genes are operably configured to be expressed from a single open reading frame.


52. The method of arrangement 51, wherein the TRA, TRB, and DHFR genes are separated by an at least one linker.


53. The method of arrangement 52, wherein the order of the at least one linker, TRA, TRB, and DHFR genes is the following:


TRA-linker-TRB-linker-DHFR,


TRA-linker-DHFR-linker-TRB,


TRB-linker-TRA-linker-DHFR,


TRB-linker-DHFR-linker-TRA,


DHFR-linker-TRA-linker-TRB, or


DHFR-linker-TRB-linker-TRA.


54. The method of arrangement 53, wherein the at least one linker is an at least one self-cleaving 2A peptide and/or an at least one IRES element.


55. The method of any one of arrangements 50-54, wherein the DHFR, TRA, and TRB genes are driven by an endogenous TCR promoter or any other suitable promoters including, but not limited to the following promoters: TRAC, TRBC1/2, DHFR, EEF1A1, ACTB, B2M, CD52, CD2, CD3G, CD3D, CD3E, LCK, LAT, PTPRC, IL2RG, ITGB2, TGFBR2, PDCD1, CTLA4, FAS, TNFRSF1A (TNFR1), TNFRSF10B (TRAILR2), ADORA2A, BTLA, CD200R1, LAG3, TIGIT, HAVCR2 (TIM3), VSIR (VISTA), IL10RA, IL4RA, EIF4A1, FTH1, FTL, HSPA5, and PGK1.


56. The method of any one of arrangements 39-55, wherein the two-part nucleotide sequence is integrated into the genome of the cell.


57. The method of any one of arrangements 39-56, wherein the at least one two part nucleotide sequence becomes operable for expression when inserted into the pre-determined site in the target genome and both the first-part and second-part nucleotide sequences are driven by a promoter in the target genome.


58. The method of arrangement 57, wherein the integration is through nuclease-mediated site-specific integration, transposon-mediated gene delivery, or virus-mediate gene delivery.


59. The method of arrangement 58, wherein the nuclease-mediated site-specific integration is through CRISPR RNP, optionally a CRISPR/Cas9 RNP.


60. The method of arrangement 59, further comprising using the Split intein system.


61. The method of any one of arrangements 39-55, wherein the introduced two-part nucleotide sequence is not integrated into the genome of the cell.


62. The method of any one of arrangements 39-60, wherein a CRISPR RNP that targets an endogenous TCR Constant locus, the first-part nucleotide sequence encoding a protein inhibitor-resistant DHFR gene, and the second-part nucleotide sequence encoding a neo-antigen TCR are delivered to the cell.


63. The method of arrangement 62, wherein the endogenous TCR constant locus can be a TCR alpha Constant (TRAC) locus or a TCR beta Constant (TRBC) locus.


64. The method of arrangement 62 or 63, wherein the delivery is by electroporation, or methods based on mechanical or chemical membrane permeabilization.


65. The method of any one of arrangements 62-64, wherein the CRISPR RNP is a TRAC RNP that cuts the TRAC locus for knock-in.


66. The method of any one of arrangements 59, 62, or 65 wherein the CRISPR RNP is a CRISPR/Cas9 RNP.


67. The method of any one of arrangements 39-66, wherein the supplement leading to enrichment or selection of the cell is an antibody that allows enrichment of the cells by flow cytometry or magnetic bead enrichment.


68. The method of any one of arrangements arrangement 39-67, wherein the supplement impairs survival and/or proliferation of cells without expressing both the first protein and the second protein.


69. The method of arrangement 68, wherein the first protein mediates resistance of the cell to the supplement mediated impairment of survival and/or proliferation of cells.


70. The method of any one of arrangements 39-69, wherein the supplement is methotrexate.


71. The method of any one of arrangements 69 or 70, wherein the first protein is a methotrexate-resistant DHFR mutant protein.


72. A method for selection or enrichment of a genetically engineered cell comprising:

    • i) introducing into a cell at least two two-part nucleotide sequences capable of expressing both a first-part and a second-part nucleotide sequence in the cell,
    • wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate,
    • wherein the first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a first protein of interest,
    • wherein the second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a second protein of interest,
    • wherein, when both the first and second fusion proteins are expressed together in a cell, the function of the essential protein for the survival and/or proliferation is restored; and
    • ii) culturing the cell under conditions leading to the selection of the cell that expresses both the first and second two-part nucleotide sequences.


73. A method for selection or enrichment of a genetically engineered cell comprising:

    • i) suppressing at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions;
    • ii) introducing at least two two-part nucleotide sequences that are capable of being expressed in the cell,
    • wherein the first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a first protein of interest,
    • wherein the second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a second protein protein of interest,
    • wherein, when both the first and second fusion proteins are expressed together in a cell, the function of the essential protein for the survival and/or proliferation is restored, and
    • iii) culturing the cell under in vitro propagation conditions that lead to the enrichment of the cell that expresses both the first fusion protein and second fusion protein.


74. The method of arrangement 72 or 73, wherein the essential protein is a DHFR protein.


75. The method of arrangement 74, wherein the first fusion protein comprises an N-terminal portion of DHFR and the second fusion protein comprises a C-terminal portion of DHFR.


76. The method of arrangement 74, wherein the first fusion protein comprises a C-terminal portion of DHFR and the second fusion protein comprises an N-terminal portion of DHFR.


77. The method of arrangement 74 or 75, wherein the N-terminal portion of DHFR comprises SEQ ID NO: 22.


78. The method of any one of arrangements 74-77, wherein the C-terminal portion of DHFR comprises SEQ ID NO: 23.


79. The method of any one of arrangements 72-78, wherein the second-part nucleotide sequence of either the first or second two-part nucleotide sequences is exogenous to the cell.


80. The method of any one of arrangements 72-79, wherein the second-part nucleotide sequence of either the first or second two-part nucleotide sequence is a TCR.


81. The method of any one of arrangements 72-80, wherein the first and second binding domains are derived from GCN4.


82. The method of any one of arrangements 72-81, wherein the first and/or second binding domains comprise SEQ ID NO: 24.


83. The method of any one of arrangements 72-82, wherein the first fusion protein and second fusion protein comprise SEQ ID NO: 39 or SEQ ID NO: 40.


84. The method of any one of arrangements 72-80, wherein the first and second binding domains are derived from FKBP12.


85. The method of arrangement 84, wherein the FKBP12 has an F36V mutation.


86. The method of any one of arrangements 72-80, 84, or 85, wherein the first and/or second binding domains comprise SEQ ID NO: 31.


87. The method of any one of arrangements 72-80 or 84-86, wherein the first fusion protein and second fusion protein comprise SEQ ID NO: 62 or SEQ ID NO: 63.


88. The method of any one of arrangements 72-80, wherein the first binding domain and the second binding domain are derived from JUN and FOS.


89. The method of arrangement 88, wherein the first binding domain and second binding domain have complementary mutations that preserve binding to each other.


90. The method of arrangement 89, wherein neither the first binding domain nor the second binding domain bind to a native binding partner.


91. The method of any one of arrangements 72-80 or 88-90, wherein each of the first binding domain and second binding domain have between 3 and 7 complementary mutations.


92. The method of arrangement 91 wherein the first binding domain and second binding domain each have 3 complementary mutations.


93. The method of any one of arrangements 72-80, or 88-92, wherein the first binding domain and second binding domain comprise SEQ ID NO: 26 or SEQ ID NO: 29.


94. The method of any one of arrangements 72-80, or 88-93, the first fusion protein and second fusion protein comprise SEQ ID NO: 35 or SEQ ID NO: 36.


95. The method of arrangement 91, wherein the first binding domain and second binding domain each have 4 complementary mutations.


96. The method of any one of arrangements 72-80, 88-91, or 95 wherein the first binding domain and second binding domain comprise SEQ ID NO: 27 and SEQ ID NO: 30.


97. The method of any one of arrangements 72-80, 88-91, 95, or 96 wherein the first fusion protein and second fusion protein comprise SEQ ID NO: 37 and SEQ ID NO: 38.


98. The method of any one of arrangements 72-97, wherein the at least two two-part nucleotide sequences are integrated into the genome of the cell.


99. The method of any one of arrangements 72-98, wherein the at least two two-part nucleotide sequences become operable for expression when inserted into pre-determined sites in the target genome and both the first-part and second-part nucleotide sequences are driven by a promoters in the target genome.


100. The method of arrangement 98 or 99, wherein the integration is through nuclease-mediated site-specific integration, transposon-mediated gene delivery, or virus-mediate gene delivery.


101. The method of arrangement 100, wherein the nuclease-mediated site-specific integration is through CRISPR RNP.


102. The method of any one of arrangements 72-101, wherein the first two-part nucleotide sequence is delivered to the cell by a CRISPR RNP that targets an endogenous TCR Constant locus, the first first-part nucleotide sequence encodes a non-functional portion of a DHFR protein, and the first second-part nucleotide sequence encodes a neo-antigen TCR.


103. The method of any one of arrangements 72-102, wherein the second two-part nucleotide sequence is delivered to the cell by a CRISPR RNP that targets an endogenous locus other than a TCR Constant locus, the second first-part nucleotide sequence encodes a non-functional portion of a DHFR protein, and the second second-part nucleotide sequence encodes a protein of interest.


104. The method of arrangement 103, wherein the first first-part nucleotide sequence and the second first-part nucleotide sequences encode fusion proteins comprising non-functional portions of a DHFR protein that have DHFR activity when the fusion proteins are co-expressed.


105. The method of any one of arrangements 102-104, wherein the endogenous TCR Constant locus can be a TCR alpha Constant (TRAC) locus or a TCR beta Constant (TRBC) locus.


106. The method of any one of arrangements 103-105, wherein the endogenous locus other than a TCR Constant locus is a B2M locus.


107. The method of any one of arrangements 102-106, wherein the delivery is by electroporation, or methods based on mechanical or chemical membrane permeabilization.


108. The method of any one of arrangements 101-107, wherein the CRISPR RNP is a CRISPR/Cas9 RNP.


109. The method of any one of arrangements 26-28, 30-38, 58-60, 62-71, or 100-108 in which the nuclease allows for in-frame exonic integration into a gene locus to express at least one part of one of the two-part nucleotides from the endogenous promotor, the endogenous splice sites, and the endogenous termination signal.


110. The method of any one of arrangements 26-28, 30-38, 58-60, 62-71, or 100-108 in which the nuclease allows for in-frame exonic integration into a gene locus to express at least one part of one of the two-part nucleotides from the endogenous promotor, the endogenous splice sites, and an exogenous termination signal.


111. The method of any one of arrangements 26-28, 30-38, 58-60, 62-71, or 100-108 in which the nuclease allows for intronic integration into a gene locus to express at least one part of one of the two-part nucleotides from the endogenous promotor, an exogenous splice acceptor site, and an exogenous termination signal.


112. The method of any one of arrangements 1-80 wherein the essential or first protein is split into at least two individually dysfunctional protein portions, wherein each of the at least two portions is fused to multimerization domain and wherein each of the at least two portions is integrated into distinct two-part nucleotide sequences to allow for selection of cells in which all distinct two-part nucleotide sequences are expressed, optionally wherein the function of the essential or first protein is restored.


113. The method of any one of arrangements 1-80 wherein the essential or first protein is split into a dysfunctional N-terminal and C-terminal protein half, each half fused to a homo- or heterodimerizing protein partner or to a split intein.


114. The method of any one of arrangements 112 or 113, wherein the essential or first protein is a DHFR protein.


115. The method of arrangement 114, wherein a first dysfunctional protein portion comprises an N-terminal portion of DHFR and a second dysfunctional protein portion comprises a C-terminal portion of DHFR.


116. The method of arrangement 115, wherein the N-terminal portion of DHFR comprises SEQ ID NO: 22.


117. The method of arrangement 116, wherein the C-terminal portion of DHFR comprises SEQ ID NO: 23.


118. The method of any one of arrangements 108-110 wherein the homodimerizing protein is GCN4, FKBP12, or a variant thereof.


119. The method of any one of arrangements 108-110, wherein the heterodimerizing proteins are Jun/Fos, or variants thereof.


120. The method of any one of arrangements 72-76, 80-83, or 108-111 wherein restoration of the function of the essential protein is induced, optionally by AP1903.


121. The method of any one of arrangements 72-108, wherein the culturing step is done in the presence of methotrexate.


122. The method any one of arrangements 1-121, wherein the protein of interest is a T cell receptor.


123. The method of arrangement 122, wherein the T cell receptor is specific for a viral or a tumor antigen.


124. The method of arrangement 123, wherein the tumor antigen is a tumor neo-antigen.


125. The method any one of the preceding arrangements, wherein the genetically engineered cell is a primary human T cell.


126. A method for enrichment of a genetically engineered T cell comprising

    • i) introducing a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor complex or Chimeric antigen receptor in the T cell by integration of the two-part nucleotide sequence downstream of the TRA or TRB promotor, and
    • ii) culturing the cell in cell culture medium containing methotrexate leading to enrichment of the cell that expresses both the first protein and the second protein.


127. A method for enrichment of a T cell engineered to express an exogenous T cell receptor gene comprising:

    • i) knocking-out an endogenous TRBC gene from its locus using a first CRISPR/Cas9 RNP;
    • ii) knocking-in, using a second CRISPR/Cas9 RNP, into the endogenous TRBC locus a first-part nucleotide sequence encoding a methotrexate-resistant DHFR gene and a second-part nucleotide sequence comprising a therapeutic TCR gene, wherein both nucleotide sequences are operably linked allowing for expression from the endogenous TRBC promotor; and
    • iii) culturing the cells in cell culture medium containing methotrexate leading to enrichment of T cells that express both the therapeutic TCR and the methotrexate-resistant DHFR gene.


128. A method for selection of a genetically engineered cell comprising:

    • i) introducing at least one two-part nucleotide sequence that is operable for expression in a cell,
    • wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate, and
    • wherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding the essential protein for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed, wherein the second-part nucleotide sequence is encoding a protein that is exogenous to the cell; and
    • ii) culturing the cell under conditions leading to the selection of the cell that expresses both the first-part and second-part nucleotide sequences.


129. A method for enrichment of a genetically engineered cell comprising:

    • i) decreasing activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions;
    • ii) introducing at least a two-part nucleotide sequence that is operable for expression in the cell and comprises a first-part nucleotide sequence encoding the first protein and a second-part nucleotide sequence encoding a second protein to be expressed, wherein the second-part protein is exogenous to the cell, and
    • iii) culturing the cell under in vitro propagation conditions that lead to the enrichment of the cell that expresses both the first protein and second protein.


130. A cell that is made according to any one of the arranged methods above.


131. A T cell comprising:

    • an endogenous dihydrofolate reductase (DHFR) being suppressed by the presence of methotrexate to a level that the cell cannot survive and/or proliferate, and
    • at least a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor.


132. A T cell comprising:

    • a knock-out of endogenous dihydrofolate reductase (DHFR), and
    • at least one two-part nucleotide sequence comprising:
    • a first-part nucleotide sequence encoding a DHFR protein, or variant thereof; and
    • a second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor.


133. A T cell comprising:

    • an endogenous dihydrofolate reductase (DHFR) configured to be suppressed by a presence of methotrexate to a level that the cell cannot survive and/or proliferate, and
    • at least two two-part nucleotide sequences,
    • wherein the first two-part nucleotide sequence comprises:
    • i) a first first-part nucleotide sequence encoding a non-functional or dysfunctional portion of a DHFR protein, or variant thereof; and
    • ii) a first second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor,
    • wherein the second two-part nucleotide sequence comprises:
    • iii) a second first-part nucleotide sequence encoding a non-functional or dysfunctional portion of a DHFR protein, or variant thereof; and
    • iv) a second second-part nucleotide sequence encoding a protein of interest operably expressed from the endogenous B2M promotor, and
    • wherein the cell is configured to have DHFR activity.


Exemplary Arrangements (b):

1. A method for selection of a genetically engineered cell comprising:

    • i) introducing at least one two-part nucleotide sequence that is operable for expression in a cell,
    • wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate in a normal cell culture medium, and
    • wherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding the essential protein for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed, wherein the second-part nucleotide sequence is encoding a protein that is exogenous to the cell; and
    • ii) culturing the cell in the normal cell culture medium for selection of the cell that expresses both the first-part and second-part nucleotide sequences.


2. A method for enrichment of a genetically engineered cell comprising:

    • i) decreasing activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions;
    • ii) introducing at least a two-part nucleotide sequence that is operable for expression in the cell and comprises a first-part nucleotide sequence encoding the first protein and a second-part nucleotide sequence encoding a second protein to be expressed, wherein the second-part protein is exogenous to the cell, and
    • iii) culturing the cell under normal in vitro propagation conditions for enrichment of the cell that expresses both the first protein and second protein.


3. The method of arrangement 2, wherein the decreasing activity can be permanently or transiently.


4. The method of arrangement 2, wherein the decreasing activity comprises knock-out of the gene encoding the essential protein.


5. The method of arrangement 4, wherein the knock-out is mediated by CRISPR/Cas9 Ribonucleoprotein (RNP), TALEN, MegaTAL, or any other nucleases.


6. The method of arrangement 2, wherein the decreasing activity comprises transient suppression of the activity of the essential protein.


7. The method of arrangement 6, wherein the transient suppression is through siRNA, miRNA, CRISPR interference (CRISPRi), or a protein inhibitor.


8. The method of arrangement 1 or 2, wherein the cell is a T cell, hematopoietic stem cell, mesenchymal stem cell, iPSC, neural precursor cell, a cell type in retinal gene therapy, or any other cell.


9. The method of arrangement 1 or 2, wherein the first-part nucleotide sequence is altered in nucleotide sequence to achieve nuclease, siRNA, miRNA, or CRISPRi resistance, but a) encodes a protein having an identical amino acid sequence to the first protein or b) encodes a protein having an adjusted functionality to the first protein.


10. The method of arrangement 1 or 2, wherein the first-part nucleotide sequence is altered to encode an altered protein that does not have an identical amino acid sequence to the first protein.


11. The method of arrangement 10, wherein the altered protein has specific features that the first protein does not have.


12. The method of arrangement 11, wherein the specific features include, but are not limited to, one or more of the following: reduced activity, increased activity, altered half-life, resistance to small molecule inhibition, and increased activity after small molecule binding.


13. The method of arrangement 1 or 2, wherein the at least one nucleotide sequence is operable for expressing both the first-part and second-part nucleotide sequences.


14. The method of arrangement 1 or 2, wherein both the first-part and second-part nucleotide sequences can be driven by a same promoter or different promoters.


15. The method of arrangement 1 or 2, wherein the second-part nucleotide sequence comprises at least a therapeutic gene.


16. The method of arrangement 1 or 2, wherein the second-part nucleotide sequence encodes a neo-antigen T-cell receptor complex (TCR) containing a TCR alpha chain and a TCR beta chain.


17. The method of arrangement 1 or 2, wherein the essential or first protein is dihydrofolate reductase (DHFR), Inosine Monophosphate Dehydrogenase 2 (IMPDH2), O-6-Methylguanine-DNA Methyltransferase (MGMT), Deoxycytidine kinase (DCK), Hypoxanthine Phosphoribosyltransferase 1 (HPRT1), Interleukin 2 Receptor Subunit Gamma (IL2RG), Actin Beta (ACTB), Eukaryotic Translation Elongation Factor 1 Alpha 1 (EEF1A1), Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH), Phosphoglycerate Kinase 1 (PGK1), or Transferrin Receptor (TFRC).


18. The method of arrangement 1 or 2, wherein the first-part nucleotide sequence comprises a nuclease-resistant, siRNA-resistant, or protein inhibitor-resistant DHFR gene, and the second-part nucleotide sequence comprises a TRA gene and a TRB gene.


19. The method of arrangement 18, wherein the protein inhibitor-resistant DHFR gene is a methotrexate-resistant DHFR gene.


20. The method of arrangement 18, wherein the TRA, TRB, and DHFR genes are operably configured to be expressed from a single open reading frame.


21. The method of arrangement 20, wherein the TRA, TRB, and DHFR genes are separated by linkers.


22. The method of arrangement 21, wherein the order of the linkers, TRA, TRB, and DHFR genes is in the following order:


TRA-linker-TRB-linker-DHFR,


TRA-linker-DHFR-linker-TRB,


TRB-linker-TRA-linker-DHFR,


TRB-linker-DHFR-linker-TRA,


DHFR-linker-TRA-linker-TRB, or


DHFR-linker-TRB-linker-TRA.


23. The method of arrangement 22, wherein the linkers are self-cleaving 2A peptides or IRES elements.


24. The method of arrangement 18, wherein the DHFR, TRA, and TRB genes are driven by an endogenous TCR promoter or any other suitable promoters including, but not limited to the following promoters: TRAC, TRBC1/2, DHFR, EEF1A1, ACTB, B2M, CD52, CD2, CD3G, CD3D, CD3E, LCK, LAT, PTPRC, IL2RG, ITGB2, TGFBR2, PDCD1, CTLA4, FAS, TNFRSF1A (TNFR1), TNFRSF10B (TRAILR2), ADORA2A, BTLA, CD200R1, LAG3, TIGIT, HAVCR2 (TIM3), VSIR (VISTA), IL10RA, IL4RA, EIF4A1, FTH1, FTL, HSPA5, and PGK1.


25. The method of arrangement 1 or 2, wherein the two-part nucleotide sequence is integrated into the genome of the cell.


26. The method of arrangement 25, wherein the integration is through nuclease-mediated site-specific integration, transposon-mediated gene delivery, or virus-mediate gene delivery.


27. The method of arrangement 26, wherein the nuclease-mediated site-specific integration is through CRISPR/Cas9 RNP.


28. The method of arrangement 27, further comprising using the Split intein system.


29. The method of arrangement 1 or 2, wherein the introduced two-part nucleotide sequence is not integrated into the genome of the cell.


30. The method of arrangement 1 or 2, wherein a CRISPR/Cas9 RNP that targets the endogenous TCR Constant locus, the first-part nucleotide sequence encoding a nuclease-resistant DHFR gene, and the second-part nucleotide sequence encoding a neo-antigen TCR are delivered to the cell.


31. The method of arrangement 30, wherein the endogenous TCR constant locus can be a TCR alpha Constant (TRAC) locus or a TCR beta Constant (TRBC) locus.


32. The method of arrangement 30, wherein the delivery is by electroporation, or methods based on mechanical or chemical membrane permeabilization.


33. The method of arrangement 2, wherein a first CRISPR/Cas9 RNP is used to knock-out endogenous dihydrofolate reductase (DHFR) gene, and a second CRISPR/Cas9 RNP is used to knock-in into an endogenous TCR constant locus the first-part nucleotide sequence comprising the CRISPR/Cas9 nuclease-resistant DHFR gene and the second-part nucleotide sequence encoding a therapeutic TCR gene.


34. The method of arrangement 33, wherein methotrexate is used to inhibit the first protein, and a CRISPR/Cas9 RNP is used to knock-in into an endogenous TCR constant locus the first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and the second-part nucleotide sequence comprising a therapeutic TCR gene.


35. he method of arrangement 33, wherein the second CRISPR/Cas9 RNP is a TRAC RNP that cuts the TRAC locus for knock-in.


36. The method of arrangement 1 or 2, wherein the normal cell culture medium is one that is suitable for non-modified cell's growth and/or proliferation.


37. The method of arrangement 1 or 2, wherein the normal cell culture medium is without an exogenous selection pressure, such as a drug molecule or an antibody that allows enrichment of the cells by flow cytometry or magnetic bead enrichment.


38. A cell that is made according to any of the above methods.


39. A cell comprising:

    • endogenous dihydrofolate reductase (DHFR) being suppressed to a level that the cell cannot survive and/or proliferate in a normal cell culture medium, and at least a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding DHFR and a second-part nucleotide sequence encoding a neo-antigen T-cell receptor complex.


40. A method for enrichment of a genetically engineered cell comprising:

    • i) introducing at least a two-part nucleotide sequence that is operable for expression in the cell and comprises a first-part nucleotide sequence encoding the first protein and a second-part nucleotide sequence encoding a second protein to be expressed, wherein the second-part protein is exogenous to the cell, and
    • ii) culturing the cell in cell culture medium containing at least one supplement leading to enrichment of the cell that expresses both the first protein and the second protein.


41. The method of arrangement 40, wherein the genetically engineered cell is a primary human T cell.


42. The method of arrangement 40, wherein the supplement impairs survival and/or proliferation of cells without expressing both the first protein and the second protein.


43. The method of arrangement 40, wherein at least one protein mediates resistance of the cell to the supplement mediated impairment of survival and/or proliferation of cells.


44. The method of arrangement 42, wherein the supplement is methotrexate.


45. The method of arrangement 40, wherein the first protein is a methotrexate-resistant DHFR mutant protein.


46. The method of arrangement 40, wherein the second protein is a T cell receptor.


47. The method of arrangement 46, wherein the T cell receptor is specific for a viral or a tumor antigen.


48. The method of arrangement 40, wherein the first-part nucleotide sequence is altered in nucleotide sequence to achieve nuclease, siRNA, miRNA, or CRISPRi resistance.


49. The method of arrangement 40, in which expression of the at least a two-part nucleotide sequence is achieved by site-specific integration into an endogenous gene locus of the cell.


50. The method of arrangement 49, in which site-specific integration into an endogenous gene locus of the cell is achieved by using CRISPR/Cas9, TALEN, MegaTAL or any other nuclease that allows for traceless integration into a gene locus to enable expression from the endogenous promotor of the gene locus.


51. The method of arrangement 50, in which the nuclease allows for in-frame exonic integration into a gene locus to enable expression from the endogenous promotor, the endogenous splice sites, and the endogenous termination signal.


52. The method of arrangement 50, in which the nuclease allows for in-frame exonic integration into a gene locus to enable expression from the endogenous promotor, the endogenous splice sites, and an exogenous termination signal.


53. The method of arrangement 50, in which the nuclease allows for intronic integration into a gene locus to enable expression from the endogenous promotor, an exogenous splice acceptor site, and an exogenous termination signal.


54. The method of arrangement 40, wherein a CRISPR/Cas9 RNP is used to knock-in into an endogenous TCR constant locus the first-part nucleotide sequence encoding a methotrexate-resistant DHFR mutant protein and the second-part nucleotide sequence comprising a therapeutic TCR gene.


55. The method of arrangements 50 and 54, further comprising a second CRISPR/Cas9 RNP that is used to knock-out the endogenous TRAC or TRBC gene.


56. A method for enrichment of a genetically engineered T cell comprising

    • i) introducing a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor complex or Chimeric antigen receptor in the T cell by integration of the two-part nucleotide sequence downstream of the TRA or TRB promotor, and
    • ii) culturing the cell in cell culture medium containing methotrexate leading to enrichment of the cell that expresses both the first protein and the second protein.


57. A method for enrichment of a T cell engineered to express an exogenous T cell receptor gene comprising:

    • i) knocking-out an endogenous TRBC gene from its locus using a first CRISPR/Cas9 RNP;
    • ii) knocking-in, using a second CRISPR/Cas9 RNP, into the endogenous TRBC locus a first-part nucleotide sequence encoding a methotrexate-resistant DHFR gene and a second-part nucleotide sequence comprising a therapeutic TCR gene, wherein both nucleotide sequences are operably linked allowing for expression from the endogenous TRBC promotor; and
    • iii) culturing the cells in cell culture medium containing methotrexate leading to enrichment of T cells that express both the therapeutic TCR and the methotrexate-resistant DHFR gene.


58. A T cell comprising:

    • an endogenous dihydrofolate reductase (DHFR) being suppressed by the presence of methotrexate to a level that the cell cannot survive and/or proliferate, and
    • at least a two-part nucleotide sequence comprising a first-part nucleotide sequence encoding a methotrexate-resistant DHFR protein and a second-part nucleotide sequence encoding a T-cell receptor operably expressed from the endogenous TRA or TRB promotor.


59. The method of arrangement 1, 2 or 40 wherein the essential or first protein is split into at least two individually dysfunctional protein portions, wherein each of the at least two portions is fused to multimerization domain and wherein each of the at least two portions is integrated into distinct two-part nucleotide sequences to allow for selection of cells in which all distinct two-part nucleotide sequences are expressed.


60. The method of arrangement 59, wherein the essential or first protein is split into a dysfunctional N-terminal and C-terminal protein half, each half fused to a homo- or heterodimerizing protein partner or to a split intein.


61. The method of arrangement 59, wherein the essential or first protein is a DHFR protein.


62. A method for selection of a genetically engineered cell comprising:

    • i) introducing at least one two-part nucleotide sequence that is operable for expression in a cell,
    • wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate, and
    • wherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding the essential protein for the survival and/or proliferation and a second-part nucleotide sequence encoding a protein to be expressed, wherein the second-part nucleotide sequence is encoding a protein that is exogenous to the cell; and
    • ii) culturing the cell under conditions leading to the selection of the cell that expresses both the first-part and second-part nucleotide sequences.


63. A method for enrichment of a genetically engineered cell comprising:

    • i) decreasing activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions;
    • ii) introducing at least a two-part nucleotide sequence that is operable for expression in the cell and comprises a first-part nucleotide sequence encoding the first protein and a second-part nucleotide sequence encoding a second protein to be expressed, wherein the second-part protein is exogenous to the cell, and
    • iii) culturing the cell under in vitro propagation conditions that lead to the enrichment of the cell that expresses both the first protein and second protein.


64. A method for selection of a genetically engineered cell comprising:

    • i) introducing at least two two-part nucleotide sequences that are operable for expression in a cell,
    • wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate,
    • wherein the first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a protein to be expressed,
    • wherein the second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a protein to be expressed,
    • wherein, when both the first and second fusion proteins are expressed together in a cell, the function of the essential protein for the survival and/or proliferation is restored; and
    • ii) culturing the cell under conditions leading to the selection of the cell that expresses both the first and second two-part nucleotide sequences.


65. A method for enrichment of a genetically engineered cell comprising:

    • i) decreasing activity of at least a first protein that is essential for the survival and/or proliferation of a cell to the level that the cell cannot survive and/or proliferate under normal in vitro propagation conditions;
    • ii) introducing at least two two-part nucleotide sequences that are operable for expression in a cell,
    • wherein the first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a protein to be expressed,
    • wherein the second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a protein to be expressed,
    • wherein, when both the first and second fusion proteins are expressed together in a cell, the function of the essential protein for the survival and/or proliferation is restored, and
    • iii) culturing the cell under in vitro propagation conditions that lead to the enrichment of the cell that expresses both the first fusion protein and second fusion protein.


66. The method of arrangement 64 or 65, wherein the essential protein is a DHFR protein.


67. The method of any one of arrangements 64-66, wherein the second-part nucleotide sequence of either the first or second two-part nucleotide sequences is exogenous to the cell.


68. The method of any one of arrangements 64-67, wherein the second-part nucleotide sequence of either the first or second two-part nucleotide sequence is a TCR.


69. The method of any one of arrangements 64-68, wherein the first and second binding domains are derived from GCN4.


70. The method of any one of arrangements 64-68, wherein the first and second binding domains are derived from FKBP12.


71. The method of arrangement 70, wherein the FKBP12 has an F36V mutation.


72. The method of any one of arrangements 64-68, wherein the first binding domain is derived from JUN and the second binding domains is derived from FOS.


73. The method of arrangement 72, wherein the first binding domain and second binding domain have complementary mutations that preserve binding to each other.


74. The method of arrangement 73, wherein neither the first binding domain nor the second binding domain bind to a native binding partner.


75. The method of any one of arrangements 72-74, wherein each of the first binding domain and second binding domain have between 3 and 7 complementary mutations.


76. The method of arrangement 75 wherein the first binding domain and second binding domain each have 3 complementary mutations.


77. The method of arrangement 75, wherein the first binding domain and second binding domain each have 4 complementary mutations.


78. The method of any of arrangements 64-68, 70, or 71, wherein the restoration of the function of the essential protein is induced, optionally by AP1903.


79. The method of any of arrangements 64-78, wherein the culturing step is done in the presence of methotrexate.

Claims
  • 1. A method for selection or enrichment of a genetically engineered cell comprising: i) introducing into a cell at least one two-part nucleotide sequence capable of expressing both the first-part and second-part nucleotide sequences in the cell,wherein the cell has an essential protein for the survival and/or proliferation that is reduced to a level that the cell cannot survive and/or proliferate in a normal cell culture medium,wherein the at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, andwherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encoding the essential protein for the survival and/or proliferation, or a variant thereof, and a second-part nucleotide sequence encoding a protein to be expressed, wherein the second part nucleotide sequence encodes a protein of interest; andii) culturing the cell in the normal cell culture medium without a pharmacologic exogenous selection pressure for selection or enrichment of the cell that expresses both the first-part and second-part nucleotide sequences.
  • 2. (canceled)
  • 3. The method of claim 1, wherein the reduction in level of the essential protein is permanent.
  • 4. (canceled)
  • 5. The method of claim 3, wherein the permanent reduction in expression level of the essential protein is mediated by CRISPR Ribonucleoprotein (RNP), TALEN, MegaTAL, or any other nuclease.
  • 6-16. (canceled)
  • 17. The method of claim 1, wherein the essential protein is dihydrofolate reductase (DHFR), Inosine Monophosphate Dehydrogenase 2 (IMPDH2), O-6-Methylguanine-DNA Methyltransferase (MGMT), Deoxycytidine kinase (DCK), Hypoxanthine Phosphoribosyltransferase 1 (HPRT1), Interleukin 2 Receptor Subunit Gamma (IL2RG), Actin Beta (ACTB), Eukaryotic Translation Elongation Factor 1 Alpha 1 (EEF1A1), Glyceraldehyde-3-Pho sphate Dehydrogenase (GAPDH), Phosphoglycerate Kinase 1 (PGK1), or Transferrin Receptor (TFRC).
  • 18-37. (canceled)
  • 38. The method of claim 5, wherein a CRISPR RNP is used to knock-in into a pre-determined site in the target genome a second two-part nucleotide, wherein the pre-determined site in the target genome is the B2M gene.
  • 39. A method for selection or enrichment of a genetically engineered cell comprising: i) introducing into a cell at least one two-part nucleotide sequence capable of expressing both the first-part and second-part nucleotide sequences in the cell,wherein the cell has the functional activity of an essential protein for the survival and/or proliferation that is reduced such that the cell cannot survive and/or proliferate in a normal cell culture medium,wherein the at least one two-part nucleotide sequence is operable for expression in the cell or becomes operable for expression when inserted into a pre-determined site in the target genome, andwherein the at least one two-part nucleotide sequence comprises a first-part nucleotide sequence encodes a first protein that provides a substantially equivalent function to the essential protein for the survival and/or proliferation and a second-part nucleotide sequence encodes a second protein to be expressed, wherein the second protein that is a protein of interest; andii) culturing the cell in cell culture medium containing at least one supplement leading to enrichment or selection of the cell that expresses both the first protein and the second protein.
  • 40. (canceled)
  • 41. The method of claim 39, wherein the cell is a T cell, NK cell, NKT cell, iNKT cell, hematopoietic stem cell, mesenchymal stem cell, iPSC, neural precursor cell, a cell type in retinal gene therapy, or any other cell.
  • 42-44. (canceled)
  • 45. The method of claim 39, wherein the first-part nucleotide sequence is altered to encode an altered protein that does not have an identical amino acid sequence to the first protein and has specific features the first protein does not have, the specific features comprising one or more of the following: reduced activity, increased activity, altered half-life resistance to small molecule inhibition, and increased activity after small molecule binding.
  • 46. (canceled)
  • 47. The method of claim 39, wherein the second-part nucleotide sequence comprises at least a therapeutic gene.
  • 48. The method of claim 39, wherein the second-part nucleotide sequence encodes a neo-antigen T-cell receptor complex (TCR) containing a TCR alpha chain and a TCR beta chain.
  • 49. (canceled)
  • 50. The method of claim 39, wherein the first-part nucleotide sequence comprises a protein inhibitor-resistant DHFR gene, and the second-part nucleotide sequence comprises a TRA gene and a TRB gene.
  • 51-54. (canceled)
  • 55. The method of claim 39, wherein the DHFR, TRA, and TRB genes are driven by an endogenous TCR promoter or any other suitable promoters including, but not limited to the following promoters: TRAC, TRBC1/2, DHFR, EEF1A1, ACTB, B2M, CD52, CD2, CD3G, CD3D, CD3E, LCK, LAT, PTPRC, IL2RG, ITGB2, TGFBR2, PDCD1, CTLA4, FAS, TNFRSF1A (TNFR1), TNFRSF10B (TRAILR2), ADORA2A, BTLA, CD200R1, LAG3, TIGIT, HAVCR2 (TIM3), VSIR (VISTA), IL10RA, IL4RA, EIF4A1, FTH1, FTL, HSPAS, and PGK1.
  • 56. (canceled)
  • 57. The method of claim 39, wherein the at least one two part nucleotide sequence becomes operable for expression when inserted into the pre-determined site in the target genome and both the first-part and second-part nucleotide sequences are driven by a promoter in the target genome.
  • 58-67. (canceled)
  • 68. The method of claim 39, wherein the supplement impairs survival and/or proliferation of cells without expressing both the first protein and the second protein and the first protein mediates resistance of the cell to the supplement mediated impairment of survival and/or proliferation of cells.
  • 69. (canceled)
  • 70. The method of claim 39, wherein the supplement is methotrexate.
  • 71. The method of claim 70, wherein the first protein is a methotrexate-resistant DHFR mutant protein.
  • 72. A method for selection or enrichment of a genetically engineered cell comprising: i) introducing into a cell at least two two-part nucleotide sequences capable of expressing both a first-part and a second-part nucleotide sequence in the cell,wherein the cell has an essential protein for the survival and/or proliferation that is suppressed to a level that the cell cannot survive and/or proliferate,wherein the first two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a first fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a first binding domain and a second-part nucleotide sequence encoding a first protein of interest,wherein the second two-part nucleotide sequence comprises a first-part nucleotide sequence encoding a second fusion protein comprising a non-functional portion of the essential protein for the survival and/or proliferation fused to a second binding domain and a second-part nucleotide sequence encoding a second protein of interest,wherein, when both the first and second fusion proteins are expressed together in a cell, the function of the essential protein for the survival and/or proliferation is restored; andii) culturing the cell under conditions leading to the selection of the cell that expresses both the first and second two-part nucleotide sequences.
  • 73. (canceled)
  • 74. The method of claim 72, wherein the essential protein is a DHFR protein, and (i) the first fusion protein comprises an N-terminal portion of DHFR and the second fusion protein comprises a C-terminal portion of DHFR or (ii) the first fusion protein comprises a C-terminal portion of DHFR and the second fusion protein comprises an N-terminal portion of DHFR.
  • 75-79. (canceled)
  • 80. The method of claim 72, wherein the second-part nucleotide sequence of either the first or second two-part nucleotide sequence is a TCR.
  • 81. The method of claim 72, wherein the first and second binding domains are derived from (i) GCN4, (ii) JUN and FOS, or (iii) FKBP12.
  • 82-102. (canceled)
  • 103. The method of claim 72, wherein the first two-part nucleotide sequence is delivered to the cell by a CRISPR RNP that targets an endogenous TCR Constant locus, the first first-part nucleotide sequence encodes a non-functional portion of a DHFR protein, and the first second-part nucleotide sequence encodes a neo-antigen TCR, and the second two-part nucleotide sequence is delivered to the cell by a CRISPR RNP that targets an endogenous B2M locus, the second first-part nucleotide sequence encodes a non-functional portion of a DHFR protein, and the second second-part nucleotide sequence encodes a protein of interest.
  • 104-108. (canceled)
  • 109. The method of claim 5, in which the nuclease allows for intronic and/or in-frame exonic integration into a gene locus to express at least one part of one of the two-part nucleotides from the endogenous promotor, the endogenous splice sites, and an endogenous or exogenous termination signal.
  • 110-119. (canceled)
  • 120. The method of claim 72, wherein restoration of the function of the essential protein is induced.
  • 121. The method of claim 72, wherein culturing is done in the presence of methotrexate.
  • 122-129. (canceled)
  • 130. A cell that is made according to the method of claim 1.
  • 131-133. (canceled)
  • 134. A cell that is made according to the method of claim 39.
  • 135. A cell that is made according to the method of claim 72.
INCORPORATION BY REFERENCE TO ANY PRIORITY APPLICATIONS

Any and all applications for which a foreign or domestic priority claim is identified in the Application Data Sheet as filed with the present application are hereby incorporated by reference under 37 CFR 1.57. This application claims priority to U.S. Provisional Application Ser. No. 63/062,854, filed Aug. 7, 2020, Ser. No. 63/135,460, filed Jan. 8, 2021, Ser No. 63/170,269, filed Apr. 2, 2021, and Ser. No. 63/221,808, filed Jul. 14, 2021, hereby incorporated by reference in their entireties.

Provisional Applications (4)
Number Date Country
63062854 Aug 2020 US
63135460 Jan 2021 US
63170269 Apr 2021 US
63221808 Jul 2021 US