Efficient, programmable, and site-specific homologous recombination remains a longstanding goal of genetics and genome editing. Early attempts at directing recombination to loci of interest relied on the transfection of donor DNA with long flanking sequences that are homologous to a target locus. This strategy was hampered by very low efficiency and thus the need for a stringent selection to identify integrants. More recent efforts have exploited the ability of double-stranded DNA breaks (DSBs) to induce homology-directed repair (HDR). Homing endonucleases and later programmable endonucleases such as zinc finger nucleases, TALE nucleases, Cas9, and fCas9 have been used to introduce targeted DSBs and induce HDR in the presence of donor DNA. In most post-mitotic cells, however, DSB-induced HDR is strongly down regulated and generally inefficient. Moreover, repair of DSBs by error-prone repair pathways such as non-homologous end-joining (NHEJ) or single-strand annealing (SSA) causes random insertions or deletions (indels) of nucleotides at the DSB site at a higher frequency than HDR. The efficiency of HDR can be increased if cells are subjected to conditions forcing cell-cycle synchronization or if the enzymes involved in NHEJ are inhibited. However, such conditions can cause many random and unpredictable events, limiting potential applications. The instant disclosure provides a fusion protein that can recombine DNA sites containing a minimal recombinase core site flanked by guide RNA-specified sequences and represents a step toward programmable, scarless genome editing in unmodified cells that is independent of endogenous cellular machinery or cell state.
The instant disclosure describes the development of a fusion protein comprising a guide nucleotide sequence-programmable DNA binding protein domain, an optional linker, and a recombinase catalytic domain (e.g., a serine recombinase catalytic domain such as a Gin recombinase catalytic domain, a tyrosine recombinase catalytic domain, or any evolved recombinase catalytic domain). This fusion protein operates on a minimal gix core recombinase site (NNNNAAASSWWSSTTTNNNN, SEQ ID NO: 19) flanked by two guide RNA-specified DNA sequences. Recombination mediated by the described fusion protein is dependent on both guide RNAs, resulting in orthogonality among different guide nucleotide:fusion protein complexes, and functions efficiently in cultured human cells on DNA sequences matching those found in the human genome. The fusion protein of the disclosure can also operate directly on the genome of human cells (e.g., cultured human cells), catalyzing a deletion, insertion, inversion, translocation, or recombination between two recCas9 psuedosites located approximately 14 kilobases apart. This work provides engineered enzymes that can catalyze gene insertion, deletion, inversion, or chromosomal translocation with user-defined, single base-pair resolution in unmodified genomes.
In one aspect, the instant disclosure provides a fusion protein comprising: (i) a guide nucleotide sequence-programmable DNA binding protein domain; (ii) an optional linker; and (iii) a recombinase catalytic domain such as any serine recombinase catalytic domain (including but not limited to a Gin, Sin, Tn3, Hin, β, γδ, or PhiC31 recombinase catalytic domain), any tyrosine recombinase domain (including, but not limited to a Cre or FLP recombinase catalytic domain), or any evolved recombinase catalytic domain.
The guide nucleotide sequence-programmable DNA binding protein domain may be selected from the group consisting of nuclease inactive Cas9 (dCas9) domains, nuclease inactive Cpf1 domains, nuclease inactive Argonaute domains, and variants thereof. In certain embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain is a nuclease inactive Cas9 (dCas9) domain. In certain embodiments, the amino acid sequence of the dCas9 domain comprises mutations corresponding to a D10A and/or H840A mutation in SEQ ID NO: 1. In another embodiment, the amino acid sequence of the dCas9 domain comprises a mutation corresponding to a D10A mutation in SEQ ID NO: 1 and a mutation corresponding to an H840A mutation in SEQ ID NO: 1. In another embodiment, the amino acid sequence of the dCas9 domain further does not include the N-terminal methionine shown in SEQ ID NO: 1. In a certain embodiment, the amino acid sequence of the dCas9 domain comprises SEQ ID NO: 712. In one embodiment, the amino acid sequence of the dCas9 domain has a greater than 95% sequence identity with SEQ ID NO: 712. In one embodiment, the amino acid sequence of the dCas9 domain has a greater than 96, 97, 98, 99% or greater sequence identity with SEQ ID NO: 712. In some embodiments, the recombinase catalytic domain is a serine recombinase catalytic domain or a tyrosine recombinase catalytic domain.
In one embodiment, the amino acid sequence of the recombinase catalytic domain is a Gin recombinase catalytic domain. In some embodiments, the Gin recombinase catalytic domain comprises a mutation corresponding to one or more of the mutations selected from: a H106Y, I127L, I136R and/or G137F mutation in SEQ ID NO: 713. In an embodiment, the amino acid sequence of the Gin recombinase catalytic domain comprises mutations corresponding to two or more of the mutations selected from: a I127L, I136R and/or G137F mutation in SEQ ID NO: 713. In an embodiment, the amino acid sequence of the Gin recombinase catalytic domain comprises mutations corresponding to a I127L, I136R and G137F mutation in SEQ ID NO: 713. In another embodiment, the amino acid sequence of the Gin recombinase has been further mutated. In a specific embodiment, the amino acid sequence of the Gin recombinase catalytic domain comprises SEQ ID NO: 713.
In another embodiment, the amino acid sequence of the recombinase catalytic domain is a Hin recombinase, β recombinase, Sin recombinase, Tn3 recombinase, γδ recombinase, Cre recombinase; FLP recombinase; or a phiC31 recombinase catalytic domain.
In one embodiment, the amino acid sequence of the Cre recombinase is truncated. In another embodiment, the tyrosine recombinase catalytic domain is the 25 kDa carboxy-terminal domain of the Cre recombinase. In another embodiment, the Cre recombinase begins with amino acid R118, A127, E138, or R154 (preceded in each case by methionine). In one embodiment, the amino acid sequence of the recombinase has been further mutated. In certain embodiments, the recombinase catalytic domain is an evolved recombinase catalytic domain. In some embodiments, the amino acid sequence of the recombinase has been further mutated.
In some embodiments, the linker (e.g., the first, second, or third linker) may have a length of about 0 angstroms to about 81 angstroms. The linker typically has a length of about 33 angstroms to about 81 angstroms. The linker may be peptidic, non-peptidic, or a combination of both types of linkers. In certain embodiments, the linker is a peptide linker. In certain embodiments, the peptide linker comprises an XTEN linker SGSETPGTSESATPES (SEQ ID NO: 7), SGSETPGTSESA (SEQ ID NO: 8), or SGSETPGTSESATPEGGSGGS (SEQ ID NO: 9), an amino acid sequence comprising one or more repeats of the tri-peptide GGS, or any of the following amino acid sequences: VPFLLEPDNINGKTC (SEQ ID NO: 10), GSAGSAAGSGEF (SEQ ID NO: 11), SIVAQLSRPDPA (SEQ ID NO: 12), MKIIEQLPSA (SEQ ID NO: 13), VRHKLKRVGS (SEQ ID NO: 14), GHGTGSTGSGSS (SEQ ID NO: 15), MSRPDPA (SEQ ID NO: 16), or GGSM (SEQ ID NO: 17). In another embodiment, the peptide linker comprises one or more repeats of the tri-peptide GGS. In one embodiment, the peptide linker comprises from one to five repeats of the tri-peptide GGS. In another embodiment, the peptide linker comprises from six to ten repeats of the tri-peptide GGS. In a specific embodiment, the peptide linker comprises eight repeats of the tri-peptide GGS. In another embodiment, the peptide linker is from 18 to 27 amino acids long. In certain embodiments, the peptide linker is 24 amino acids long. In certain embodiments, the peptide linker has the amino acid sequence GGSGGSGGSGGSGGSGGSGGSGGS (SEQ ID NO: 183).
In certain embodiments, the linker is a non-peptide linker. In certain embodiments, the non-peptide linker comprises polyethylene glycol (PEG), polypropylene glycol (PPG), co-poly(ethylene/propylene) glycol, polyoxyethylene (POE), polyurethane, polyphosphazene, polysaccharides, dextran, polyvinyl alcohol, polyvinylpyrrolidones, polyvinyl ethyl ether, polyacryl amide, polyacrylate, polycyanoacrylates, lipid polymers, chitins, hyaluronic acid, heparin, or an alkyl linker. In certain embodiments, the alkyl linker has the formula: —NH—(CH2)s—C(O)—, wherein s is any integer between 1 and 100, inclusive. In certain embodiments, s is any integer from 1-20, inclusive.
In another embodiment, the fusion protein further comprises a nuclear localization signal (NLS) domain. In certain embodiments, the NLS domain is bound to the guide nucleotide sequence-programmable DNA binding protein domain or the recombinase catalytic domain via one or more second linkers.
In one embodiment, the fusion protein comprises the structure NH2-[recombinase catalytic domain]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domainHoptional, second linker sequence]-[NLS domain]-COOH. In certain embodiments, the fusion protein has greater than 85%, 90%, 95%, 98%, or 99% sequence identity with the amino acid sequence shown in SEQ ID NO: 719. In a specific embodiment, the fusion protein comprises the amino acid sequence shown in SEQ ID NO: 719. In one embodiment, the fusion protein consists of the amino acid sequence shown in SEQ ID NO: 719.
In another embodiment, the fusion protein further comprises one or more affinity tags. In one embodiment, the affinity tag is selected from the group consisting of a FLAG tag, a polyhistidine (poly-His) tag, a polyarginine (poly-Arg) tag, a Myc tag, and an HA tag. In an embodiment, the affinity tag is a FLAG tag. In a specific embodiment, the FLAG tag has the sequence PKKKRKV (SEQ ID NO: 702). In another embodiment, the one or more affinity tags are bound to the guide nucleotide sequence-programmable DNA binding protein domain, the recombinase catalytic domain, or the NLS domain via one or more third linkers. In certain embodiments, the third linker is a peptide linker.
The elements of the fusion protein described herein may be in any order, without limitation. In some embodiments, the fusion protein has the structure NH2-[recombinase catalytic domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH, NH2-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH, or NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH.
In some embodiments, the fusion protein has the structure NH2-[optional affinity tag]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-COOH, NH2-[optional affinity tag]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[NLS domain]-COOH, or NH2-[optional affinity tag]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-COOH.
In a certain embodiment, the fusion protein has greater than 85%, 90%, 95%, 98%, or 99% sequence identity with the amino acid sequence shown in SEQ ID NO: 185. In a specific embodiment, the fusion protein has the amino acid sequence shown in SEQ ID NO: 185. In certain embodiments, the recombinase catalytic domain of the fusion protein has greater than 85%, 90%, 95%, 98%, or 99% sequence identity with the amino acid sequence shown in amino acids 1-142 of SEQ ID NO: 185, which is identical to the sequence shown in SEQ ID NO: 713. In certain embodiments, the dCas9 domain has greater than 90%, 95%, or 99% sequence identity with the amino acid sequence shown in amino acids 167-1533 of SEQ ID NO: 185, which is identical to the sequence shown in SEQ ID NO: 712. In certain embodiments, the fusion protein of the instant disclosure has greater than 90%, 95%, or 99% sequence identity with the amino acid sequence shown in amino acids 1-1544 of SEQ ID NO: 185, which is identical to the sequence shown in SEQ ID NO: 719. In one embodiment, the fusion protein is bound to a guide RNA (gRNA).
In one aspect, the instant disclosure provides a dimer of the fusion protein described herein. In certain embodiments, the dimer is bound to a target DNA molecule. In certain embodiments, each fusion protein of the dimer is bound to the same strand of the target DNA molecule. In certain embodiments, each fusion protein of the dimer is bound to an opposite strand of the target DNA molecule. In certain embodiments, the gRNAs of the dimer hybridize to gRNA binding sites flanking a recombinase site of the target DNA molecule. In certain embodiments, the recombinase site comprises a res, gix, hix, six, resH, LoxP, FTR, or att core, or related core sequence. In certain embodiments, the recombinase site comprises a gix core or gix-related core sequence. In further embodiments, the distance between the gix core or gix-related core sequence and at least one gRNA binding site is from 3 to 7 base pairs. In certain embodiments, the distance between the gix core or gix-related core sequence and at least one gRNA binding site is from 5 to 6 base pairs.
In certain embodiments, a first dimer binds to a second dimer thereby forming a tetramer of the fusion protein. In one aspect, the instant disclosure provides a tetramer of the fusion protein described herein. In certain embodiments, the tetramer is bound to a target DNA molecule. In certain embodiments, each dimer is bound to an opposite strand of DNA. In other embodiments, each dimer is bound to the same strand of DNA.
In another aspect, the instant disclosure provides methods for site-specific recombination between two DNA molecules, comprising: (a) contacting a first DNA with a first fusion protein, wherein the guide nucleotide sequence-programmable DNA binding protein domain binds a first gRNA that hybridizes to a first region of the first DNA; (b) contacting the first DNA with a second fusion protein, wherein the guide nucleotide sequence-programmable DNA binding protein domain of the second fusion protein binds a second gRNA that hybridizes to a second region of the first DNA; (c) contacting a second DNA with a third fusion protein, wherein the guide nucleotide sequence-programmable DNA binding protein domain of the third fusion protein binds a third gRNA that hybridizes to a first region of the second DNA; and (d) contacting the second DNA with a fourth fusion protein, wherein the guide nucleotide sequence-programmable DNA binding protein domain of the fourth fusion protein binds a fourth gRNA that hybridizes to a second region of the second DNA; wherein the binding of the fusion proteins in steps (a)-(d) results in the tetramerization of the recombinase catalytic domains of the fusion proteins, under conditions such that the DNAs are recombined, and wherein the first, second, third, and/or fourth fusion protein is any of the fusion proteins described herein.
In one embodiment, the first and second DNA molecules have different sequences. In another embodiment, the gRNAs of steps (a) and (b) hybridize to opposing strands of the first DNA, and the gRNAs of steps (c) and (d) hybridize to opposing strands of the second DNA. In another embodiment, wherein the gRNAs of steps (a) and (b); and/or the gRNAs of steps (c) and (d) hybridize to regions of their respective DNAs that are no more than 10, no more than 15, no more than 20, no more than 25, no more than 30, no more than 40, no more than 50, no more than 60, no more than 70, no more than 80, no more than 90, or no more than 100 base pairs apart. In certain embodiments, the gRNAs of steps (a) and (b), and/or the gRNAs of steps (c) and (d) hybridize to regions of their respective DNAs at gRNA binding sites that flank a recombinase site (see, for example,
The method for site-specific recombination provided herein may also be used with a single DNA molecule. In one aspect, the instant disclosure provides a method for site-specific recombination between two regions of a single DNA molecule, comprising: (a) contacting the DNA with a first fusion protein, wherein the guide nucleotide sequence-programmable DNA binding protein domain binds a first gRNA that hybridizes to a first region of the DNA; (b) contacting the DNA with a second fusion protein, wherein the guide nucleotide sequence-programmable DNA binding protein domain of the second fusion protein binds a second gRNA that hybridizes to a second region of the DNA; (c) contacting the DNA with a third fusion protein, wherein the guide nucleotide sequence-programmable DNA binding protein domain of the third fusion protein binds a third gRNA that hybridizes to a third region of the DNA; and (d) contacting the DNA with a fourth fusion protein, wherein the guide nucleotide sequence-programmable DNA binding protein domain of the fourth fusion protein binds a fourth gRNA that hybridizes to a fourth region of the DNA; wherein the binding of the fusion proteins in steps (a)-(d) results in the tetramerization of the recombinase catalytic domains of the fusion proteins, under conditions such that the DNA is recombined, and wherein the first, second, third, and/or fourth fusion protein is any of the fusion proteins described.
In certain embodiments, the two regions of the single DNA molecule that are recombined have different sequences. In another embodiment, the recombination results in the deletion of a region of the DNA molecule. In a specific embodiment, the region of the DNA molecule that is deleted is prone to cross-over events in meiosis. In one embodiment, the first and second gRNAs of steps (a)-(d) hybridize to the same strand of the DNA, and the third and fourth gRNAs of steps (a)-(d) hybridize to the opposing strand of the DNA. In another embodiment, the gRNAs of steps (a) and (b) hybridize to regions of the DNA that are no more than 50, no more than 60, no more than 70, no more than 80, no more than 90, or no more than 100 base pairs apart, and the gRNAs of steps (c) and (d) hybridize to regions of the DNA that are no more than 10, no more than 15, no more than 20, no more than 25, no more than 30, no more than 40, no more than 50, no more than 60, no more than 70, no more than 80, no more than 90, or no more than 100 base pairs apart. In certain embodiments, the gRNAs of steps (a) and (b); and/or the gRNAs of steps (c) and (d) hybridize to gRNA binding sites flanking a recombinase site. In certain embodiments, the recombinase site comprises a res, gix, hix, six, resH, LoxP, FTR, or att core or related core sequence. In one embodiment, the recombinase site comprises a gix core or gix-related core sequence. In certain embodiments, the distance between the gix core or gix-related core sequence and at least one gRNA binding site is from 3 to 7 base pairs. In certain embodiments, the distance between the gix core or gix-related core sequence and at least one gRNA binding site is from 5 to 6 base pairs.
The DNA described herein may be in a cell. In certain embodiments, the cell is a eukaryotic cell. In certain embodiments, the cell is a plant cell. In certain embodiments, the cell is a prokaryotic cell. In some embodiments, the cell may be a mammalian cell. In some embodiments, the cell may be a human cell. In certain embodiments, the cell is in a subject. In some embodiments, the subject may be a mammal. In certain embodiments, the subject is a human. In certain embodiments, the cell may be a plant cell.
In one aspect, the instant disclosure provides a polynucleotide encoding any of the fusion proteins disclosed herein. In certain embodiments, the instant disclosure provides a vector comprising the polynucleotide encoding any of the fusion proteins disclosed herein.
In another aspect, the instant disclosure provides a cell comprising a genetic construct for expressing any fusion protein disclosed herein.
In one aspect, the instant disclosure provides a kit comprising any fusion protein disclosed herein. In another aspect, the instant disclosure provides a kit comprising a polynucleotide encoding any fusion protein disclosed herein. In another aspect, the instant disclosure provides a kit comprising a vector for recombinant protein expression, wherein the vector comprises a polynucleotide encoding any fusion protein disclosed herein. In another aspect, the instant disclosure provides a kit comprising a cell that comprises a genetic construct for expressing any fusion protein disclosed herein. In one embodiment, the kit further comprises one or more gRNAs and/or vectors for expressing one or more gRNAs.
The details of certain embodiments of the invention are set forth in the Detailed Description of Certain Embodiments, as described below. Other features, objects, and advantages of the invention will be apparent from the Definitions, Examples, Figures, and Claims.
As used herein, the singular forms “a,” “an,” and “the” include the singular and the plural reference unless the context clearly indicates otherwise. Thus, for example, a reference to “an agent” includes a single agent and a plurality of such agents.
Non-limiting, exemplary RNA-programmable DNA-binding proteins include Cas9 nucleases, Cas9 nickases, nuclease inactive Cas9 (dCas9), CasX, CasY, Cpf1, C2c1, C2c2, C2C3, and Argonaute. The term “Cas9” or “Cas9 nuclease” refers to an RNA-guided nuclease comprising a Cas9 protein, or a fragment thereof (e.g., a protein comprising an active or inactive DNA cleavage domain of Cas9, and/or the gRNA binding domain of Cas9). Cas9 has two cleavage domains, which cut specific DNA strands (e.g., sense and antisense strands). Cas9 nickases can be generated that cut either strand (including, but not limited to D10A and H840A of spCas9). A Cas9 domain (e.g., nuclease active Cas9, nuclease inactive Cas9, or Cas9 nickases) may be used without limitation in the fusion proteins and methods described herein. Further, any of the guide nucleotide sequence-programmable DNA binding proteins described herein may be useful as nickases.
A Cas9 nuclease is also referred to sometimes as a casn1 nuclease or a CRISPR (clustered regularly interspaced short palindromic repeat)-associated nuclease. CRISPR is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements, and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). In type II CRISPR systems correct processing of pre-crRNA requires a trans-encoded small RNA (tracrRNA), endogenous ribonuclease 3 (rnc), and a Cas9 protein. The tracrRNA serves as a guide for ribonuclease 3-aided processing of pre-crRNA. Subsequently, Cas9/crRNA/tracrRNA endonucleolytically cleaves a linear or circular dsDNA target complementary to the spacer. The target strand not complementary to crRNA is first cut endonucleolytically, then trimmed 3′-5′ exonucleolytically. In nature, DNA-binding and cleavage typically requires protein and both RNA sequences. However, single guide RNAs (“sgRNA”, or simply “gRNA”) can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M., Chylinski K., Fonfara I., Hauer M., Doudna J. A., Charpentier E. Science 337:816-821(2012), the entire contents of which is hereby incorporated by reference. Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self. Cas9 nuclease sequences and structures are well known to those of skill in the art (see, e.g., “Complete genome sequence of an M1 strain of Streptococcus pyogenes.” Ferretti et al., J. J., McShan W. M., Ajdic D. J., Savic D. J., Savic G., Lyon K., Primeaux C., Sezate S., Suvorov A. N., Kenton S., Lai H. S., Lin S. P., Qian Y., Jia H. G., Najar F. Z., Ren Q., Zhu H., Song L., White J., Yuan X., Clifton S. W., Roe B. A., McLaughlin R. E., Proc. Natl. Acad. Sci. U.S.A. 98:4658-4663(2001); “CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III.” Deltcheva E., Chylinski K., Sharma C. M., Gonzales K., Chao Y., Pirzada Z. A., Eckert M. R., Vogel J., Charpentier E., Nature 471:602-607(2011); and “A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity.” Jinek M., Chylinski K., Fonfara I., Hauer M., Doudna J. A., Charpentier E. Science 337:816-821(2012), the entire contents of each of which are incorporated herein by reference). Cas9 orthologs have been described in various species, including, but not limited to, S. pyogenes and S. thermophilus. Additional suitable Cas9 nucleases and sequences will be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier, “The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference. In some embodiments, a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain, that is, the Cas9 is a nickase. As one example, the Cas9 nuclease (e.g., Cas9 nickase) may cleave the DNA strand that is bound to the gRNA. As another example, the Cas9 nuclease (e.g., Cas9 nickase) may cleave the DNA strand that is not bound to the gRNA. In another embodiment, any of the guide nucleotide sequence-programmable DNA binding proteins may have an inactive (e.g., an inactivated) DNA cleavage domain, that is, the guide nucleotide sequence-programmable DNA binding protein is a nickase. As one example, the guide nucleotide sequence-programmable DNA binding protein may cleave the DNA strand that is bound to the gRNA. As another example, the guide nucleotide sequence-programmable DNA binding protein may cleave the DNA strand that is not bound to the gRNA.
Additional exemplary Cas9 sequences may be found in International Publication No.: WO/2017/070633, published Apr. 27, 2017, and entitled “Evolved Cas9 Proteins for Gene Editing.”
A nuclease-inactivated Cas9 protein may interchangeably be referred to as a “dCas9” protein (for nuclease “dead” Cas9). In some embodiments, dCas9 corresponds to, or comprises in part or in whole, the amino acid set forth as SEQ ID NO: 1, below. In some embodiments, variants of dCas9 (e.g., variants of SEQ ID NO: 1) are provided. For example, in some embodiments, variants having mutations other than D10A and H840A are provided, which e.g., result in nuclease inactivated Cas9 (dCas9). Such mutations, by way of example, include other amino acid substitutions at D10 and H840, or other substitutions within the nuclease domains of Cas9 (e.g., substitutions in the HNH nuclease subdomain and/or the RuvC1 subdomain). In some embodiments, variants or homologues of dCas9 (e.g., variants of SEQ ID NO: 1) are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to SEQ ID NO: 1. In some embodiments, variants of dCas9 (e.g., variants of SEQ ID NO: 1) are provided having amino acid sequences which are shorter, or longer than SEQ ID NO: 1, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids, or more.
Methods for generating a Cas9 protein (or a fragment thereof) having an inactive DNA cleavage domain are known (See, e.g., Jinek et al., Science. 337:816-821(2012); Qi et al., “Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression” (2013) Cell. 28; 152(5):1173-83, the entire contents of each of which are incorporated herein by reference). For example, the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvC1 subdomain. The HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvC1 subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9. For example, the mutations D10A and H840A completely inactivate the nuclease activity of S. pyogenes Cas9 (See e.g., Jinek et al., Science. 337:816-821(2012); Qi et al., Cell. 28; 152(5):1173-83 (2013)). In some embodiments, proteins comprising fragments of Cas9 are provided. For example, in some embodiments, a protein comprises one of two Cas9 domains: (1) the gRNA binding domain of Cas9; or (2) the DNA cleavage domain of Cas9. In some embodiments, proteins comprising Cas9, or fragments thereof, are referred to as “Cas9 variants.” A Cas9 variant shares homology to Cas9, or a fragment thereof. For example, a Cas9 variant is at least about 70% identical, at least about 80% identical, at least about 85% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to wild type Cas9. In some embodiments, the Cas9 variant comprises a fragment of Cas9 (e.g., a gRNA binding domain or a DNA-cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 85% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to the corresponding fragment of wild type Cas9. In some embodiments, wild type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCBI Reference Sequence: NC_017053.1, SEQ ID NO: 2 (nucleotide); SEQ ID NO: 3 (amino acid)). In some embodiments the Cas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to wild type Cas9. In some embodiments, the Cas9 domain comprises an amino acid sequence that has 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 21, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50 or more or more mutations compared to wild type Cas9. In some embodiments, the Cas9 domain comprises an amino acid sequence that has at least 10, at least 15, at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 150, at least 200, at least 250, at least 300, at least 350, at least 400, at least 500, at least 600, at least 700, at least 800, at least 900, at least 1000, at least 1100, or at least 1200 identical contiguous amino acid residues as compared to wild type Cas9. In some embodiments, the Cas9 variant comprises a fragment of Cas9 (e.g., a gRNA binding domain or a DNA-cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to the corresponding fragment of wild type Cas9. In some embodiments, the fragment is at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95% identical, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% of the amino acid length of a corresponding wild type Cas9.
In some embodiments, the fragment is at least 100 amino acids in length. In some embodiments, the fragment is at least 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, or 1300 amino acids in length.
In some embodiments, wild type Cas9 corresponds to or comprises, SEQ ID NO: 4 (nucleotide) and/or SEQ ID NO: 5 (amino acid).
In some embodiments, Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs: NC_016782.1, NC_016786.1); Spiroplasma syrphidicola (NCBI Ref: NC_021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma taiwanense (NCBI Ref: NC_021846.1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquisl (NCBI Ref: NC_018721.1); Streptococcus thermophiles (NCBI Ref: YP_820832.1), Listeria innocua (NCBI Ref: NP_472073.1); Campylobacter jejuni (NCBI Ref: YP_002344900.1); or Neisseria meningitidis (NCBI Ref: YP_002342100.1) or to a Cas9 from any other organism.
Cas9 recognizes a short motif (PAM motif) in the CRISPR repeat sequences in the target DNA sequence. A “PAM motif,” or “protospacer adjacent motif,” as used herein, refers a DNA sequence immediately following the DNA sequence targeted by the Cas9 nuclease in the CRISPR bacterial adaptive immune system. PAM is a component of the invading virus or plasmid, but is not a component of the bacterial CRISPR locus. Naturally, Cas9 will not successfully bind to or cleave the target DNA sequence if it is not followed by the PAM sequence. PAM is a targeting component (not found in the bacterial genome) which distinguishes bacterial self from non-self DNA, thereby preventing the CRISPR locus from being targeted and destroyed by the Cas9 nuclease activity.
Wild-type Streptococcus pyogenes Cas9 recognizes a canonical PAM sequence (e.g., Cas9 from Streptococcus thermophiles, Staphylococcus aureus, Neisseria meningitidis, or Treponema denticolaor) and Cas9 variants thereof have been described in the art to have different, or more relaxed PAM requirements. Typically, Cas9 proteins, such as Cas9 from S. pyogenes (spCas9), require a canonical NGG PAM sequence to bind a particular nucleic acid region, where the “N” in “NGG” is adenine (A), thymine (T), guanine (G), or cytosine (C), and the G is guanine. This may limit the ability to edit desired bases within a genome. In some embodiments, the base editing fusion proteins provided herein need to be positioned at a precise location, for example, where a target base is within a 4 base region (e.g., a “deamination window”), which is approximately 15 bases upstream of the PAM. See Komor, A. C., et al., “Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage” Nature 533, 420-424 (2016), the entire contents of which are hereby incorporated by reference. In some embodiments, the deamination window is within a 2, 3, 4, 5, 6, 7, 8, 9, or 10 base region. In some embodiments, the deamination window is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 bases upstream of the PAM. Accordingly, in some embodiments, any of the fusion proteins provided herein may contain a Cas9 domain that is capable of binding a nucleotide sequence that does not contain a canonical (e.g., NGG) PAM sequence. Cas9 domains that bind to non-canonical PAM sequences have been described in the art and would be apparent to the skilled artisan. For example, Cas9 domains that bind non-canonical PAM sequences have been described in Kleinstiver, B. P., et al., “Engineered CRISPR-Cas9 nucleases with altered PAM specificities” Nature 523, 481-485 (2015); and Kleinstiver, B. P., et al., “Broadening the targeting range of Staphylococcus aureus CRISPR-Cas9 by modifying PAM recognition” Nature Biotechnology 33, 1293-1298 (2015); the entire contents of each are hereby incorporated by reference. See also: Klenstiver et al., Nature 529, 490-495, 2016; Ran et al., Nature, April 9; 520(7546): 186-191, 2015; Hou et al., Proc Natl Acad Sci USA, 110(39):15644-9, 2014; Prykhozhij et al., PLoS One, 10(3): e0119372, 2015; Zetsche et al., Cell 163, 759-771, 2015; Gao et al., Nature Biotechnology, doi:10.1038/nbt.3547, 2016; Want et al., Nature 461, 754-761, 2009; Chavez et al., doi: dx dot doi dot org/10.1101/058974; Fagerlund et al., Genome Biol. 2015; 16: 25, 2015; Zetsche et al., Cell, 163, 759-771, 2015; and Swarts et al., Nat Struct Mol Biol, 21(9):743-53, 2014, the entire contents of each of which is incorporated herein by reference.
Thus, the guide nucleotide sequence-programmable DNA-binding protein of the present disclosure may recognize a variety of PAM sequences including, without limitation: NGG, NGAN (SEQ ID NO: 741), NGNG (SEQ ID NO: 742), NGAG (SEQ ID NO: 743), NGCG (SEQ ID NO: 744), NNGRRT (SEQ ID NO: 745), NGRRN (SEQ ID NO: 746), NNNRRT (SEQ ID NO: 747), NNNGATT (SEQ ID NO: 748), NNAGAAW (SEQ ID NO: 749), NAAAC (SEQ ID NO: 750), TTN, TTTN (SEQ ID NO: 751), and YTN, wherein Y is a pyrimidine, and N is any nucleobase.
One example of an RNA-programmable DNA-binding protein that has different PAM specificity is Clustered Regularly Interspaced Short Palindromic Repeats from Prevotella and Francisella 1 (Cpf1). Similar to Cas9, Cpf1 is also a class 2 CRISPR effector. It has been shown that Cpf1 mediates robust DNA interference with features distinct from Cas9. Cpf1 is a single RNA-guided endonuclease lacking tracrRNA, and it utilizes a T-rich protospacer-adjacent motif (TTN, TTTN (SEQ ID NO: 751), or YTN). Moreover, Cpf1 cleaves DNA via a staggered DNA double-stranded break. Out of 16 Cpf1-family proteins, two enzymes from Acidaminococcus and Lachnospiraceae are shown to have efficient genome-editing activity in human cells.
Also provided herein are nuclease-inactive Cpf1 (dCpf1) variants that may be used as a RNA-programmable DNA-binding protein domain. The Cpf1 protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9 but does not have a HNH endonuclease domain, and the N-terminal of Cpf1 does not have the alpha-helical recognition lobe of Cas9. It was shown in Zetsche et al., Cell, 163, 759-771, 2015 (the entire contents of which is incorporated herein by reference) that the RuvC-like domain of Cpf1 is responsible for cleaving both DNA strands and inactivation of the RuvC-like domain inactivates Cpf1 nuclease activity. For example, mutations corresponding to D917A, E1006A, or D1255A in Francisella novicida Cpf1 (SEQ ID NO: 714) inactivates Cpf1 nuclease activity. In some embodiments, the dCpf1 of the present disclosure comprises mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or D917A/E1006A/D1255A in SEQ ID NO: 714. It is to be understood that any mutations, e.g., substitution mutations, deletions, or insertions that inactivates the RuvC domain of Cpf1 may be used in accordance with the present disclosure.
In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain of the present disclosure has no requirements for a PAM sequence. One example of such a guide nucleotide sequence-programmable DNA-binding protein may be an Argonaute protein from Natronobacterium gregoryi (NgAgo). NgAgo is a ssDNA-guided endonuclease. NgAgo binds 5′ phosphorylated ssDNA of ˜24 nucleotides (gDNA) to guide it to its target site and will make DNA double-strand breaks at gDNA site. In contrast to Cas9, the NgAgo-gDNA system does not require a protospacer-adjacent motif (PAM). Using a nuclease inactive NgAgo (dNgAgo) can greatly expand the codons that may be targeted. The characterization and use of NgAgo have been described in Gao et al., Nat Biotechnol. Epub 2016 May 2. PubMed PMID: 27136078; Swarts et al., Nature. 507(7491) (2014):258-61; and Swarts et al., Nucleic Acids Res. 43(10) (2015):5120-9, the entire contents of each of which are incorporated herein by reference. The sequence of Natronobacterium gregoryi Argonaute is provided in SEQ ID NO: 718.
Also provided herein are Cas9 variants that have relaxed PAM requirements (PAMless Cas9). PAMless Cas9 exhibits an increased activity on a target sequence that does not comprise a canonical PAM (NGG) at its 3′-end as compared to Streptococcus pyogenes Cas9 as provided by SEQ ID NO: 1, e.g., increased activity by at least 5-fold, at least 10-fold, at least 50-fold, at least 100-fold, at least 500-fold, at least 1,000-fold, at least 5,000-fold, at least 10,000-fold, at least 50,000-fold, at least 100,000-fold, at least 500,000-fold, or at least 1,000,000-fold. Thus, the dCas9 or Cas9 nickase of the present disclosure may further comprise mutations that relax the PAM requirements, e.g., mutations that correspond to A262T, K294R, S409I, E480K, E543D, M694I, or E1219V in SEQ ID NO: 1.
It should be appreciated that additional Cas9 proteins (e.g., a nuclease dead Cas9 (dCas9), a Cas9 nickase (nCas9), or a nuclease active Cas9), including variants and homologs thereof, are within the scope of this disclosure. Exemplary Cas9 proteins include, without limitation, those provided below. In some embodiments, the Cas9 protein is a nuclease dead Cas9 (dCas9). In some embodiments, the dCas9 comprises the amino acid sequence shown below. In some embodiments, the Cas9 protein is a Cas9 nickase (nCas9). In some embodiments, the nCas9 comprises the amino acid sequence shown below. In some embodiments, the Cas9 protein is a nuclease active Cas9. In some embodiments, the nuclease active Cas9 comprises the amino acid sequence shown below.
In some embodiments, Cas9 refers to a Cas9 from arehaea (e.g. nanoarchaea), which constitute a domain and kingdom of single-celled prokaryotic microbes. In some embodiments, Cas9 refers to CasX or CasY, which have been described in, for example, Burstein et al., “New CRISPR-Cas systems from uncultivated microbes.” Cell Res. 2017 Feb. 21. doi: 10.1038/cr.2017.21, the entire contents of which is hereby incorporated by reference. Using genome-resolved metagenomics, a number of CRISPR-Cas systems were identified, including the first reported Cas9 in the archaeal domain of life. This divergent Cas9 protein was found in little-studied nanoarchaea as part of an active CRISPR-Cas system. In bacteria, two previously unknown systems were discovered, CRISPR-CasX and CRISPR-CasY, which are among the most compact systems yet discovered. In some embodiments, Cas9 refers to CasX, or a variant of CasX. In some embodiments, Cas9 refers to a CasY, or a variant of CasY. It should be appreciated that other RNA-guided DNA binding proteins may be used as a guide nucleotide sequence-programmable DNA-binding protein, and are within the scope of this disclosure.
In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain of any of the fusion proteins provided herein may be a CasX or CasY protein. In some embodiments, guide nucleotide sequence-programmable DNA-binding protein domain is a CasX protein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain is a CasY protein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to a naturally-occurring CasX or CasY protein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain is a naturally-occurring CasX or CasY protein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of of the exemplary CasX or CasY proteins described herein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain comprises an amino acid sequence of any one of of the exemplary CasX or CasY proteins described herein. It should be appreciated that CasX and CasY from other bacterial species may also be used in accordance with the present disclosure.
The terms “conjugating,” “conjugated,” and “conjugation” refer to an association of two entities, for example, of two molecules such as two proteins, two domains (e.g., a binding domain and a cleavage domain), or a protein and an agent, e.g., a protein binding domain and a small molecule. In some aspects, the association is between a protein (e.g., RNA-programmable nuclease) and a nucleic acid (e.g., a guide RNA). The association can be, for example, via a direct or indirect (e.g., via a linker) covalent linkage. In some embodiments, the association is covalent. In some embodiments, two molecules are conjugated via a linker connecting both molecules. For example, in some embodiments where two proteins are conjugated to each other, e.g., a binding domain and a cleavage domain of an engineered nuclease, to form a protein fusion, the two proteins may be conjugated via a polypeptide linker, e.g., an amino acid sequence connecting the C-terminus of one protein to the N-terminus of the other protein.
The term “consensus sequence,” as used herein in the context of nucleic acid sequences, refers to a calculated sequence representing the most frequent nucleotide residues found at each position in a plurality of similar sequences. Typically, a consensus sequence is determined by sequence alignment in which similar sequences are compared to each other and similar sequence motifs are calculated. In the context of recombinase target site sequences, a consensus sequence of a recombinase target site may, in some embodiments, be the sequence most frequently bound, or bound with the highest affinity, by a given recombinase.
The term “engineered,” as used herein refers to a protein molecule, a nucleic acid, complex, substance, or entity that has been designed, produced, prepared, synthesized, and/or manufactured by a human. Accordingly, an engineered product is a product that does not occur in nature.
The term “effective amount,” as used herein, refers to an amount of a biologically active agent that is sufficient to elicit a desired biological response. In some embodiments, an effective amount of a recombinase may refer to the amount of the recombinase that is sufficient to induce recombination at a target site specifically bound and recombined by the recombinase. As will be appreciated by the skilled artisan, the effective amount of an agent, e.g., a nuclease, a recombinase, a hybrid protein, a fusion protein, a protein dimer, a complex of a protein (or protein dimer) and a polynucleotide, or a polynucleotide, may vary depending on various factors as, for example, on the desired biological response, the specific allele, genome, target site, cell, or tissue being targeted, and the agent being used.
A “guide nucleotide sequence-programmable DNA-binding protein,” as used herein, refers to a protein, a polypeptide, or a domain that is able to bind DNA, and the binding to its target DNA sequence is mediated by a guide nucleotide sequence. The “guide nucleotide” may be an RNA or DNA molecule (e.g., a single-stranded DNA or ssDNA molecule) that is complementary to the target sequence and can guide the DNA binding protein to the target sequence. As such, a guide nucleotide sequence-programmable DNA-binding protein may be a RNA-programmable DNA-binding protein, or an ssDNA-programmable DNA-binding protein. “Programmable” means the DNA-binding protein may be programmed to bind any DNA sequence that the guide nucleotide targets. The guide nucleotide sequence-programmable DNA-binding protein referred to herein may be any guide nucleotide sequence-programmable DNA-binding protein known in the art without limitation including, but not limited to, a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA-binding protein. The term “circularly permuted” refers to proteins in which the order of the amino acids in a protein has been altered, resulting in a protein structure with altered connectivity but a similar (overall) three-dimensional shape. Circular permutations are formed when the original n and c terminal amino acids are connected via a peptide bond; the peptide sequence is then broken in another location within the peptide sequence, causing a new n and c-terminus. Circular permutations may occur through a number of processes including evolutionary events, post-translational modifications, or artificially engineered mutations. For example, circular permutations may be used to improve the catalytic activity or thermostability of proteins. A circularly permuted guide nucleotide sequence-programmable DNA-binding protein may be used with any of the embodiments described herein. The term “bifurcated” typically refers to a monomeric protein that is split into two parts. Typically both parts are required for the function of the monomeric protein. Bifurcated proteins may or may not dimerize on their own to reconstitute a functional protein. Bifurcations may occur through a number of processes including evolutionary events, post-translational modifications, or artificially engineered mutations. Other protein domains, when fused to bifurcated domains, can be used to force the reassembly of the bifurcated protein. In some cases, protein domains, whose interaction depends on a small molecule, can be fused to each bifurcated domain, resulting in the small-molecule regulated dimerization of the bifurcated protein.
The term “homologous,” as used herein, is an art-understood term that refers to nucleic acids or polypeptides that are highly related at the level of nucleotide and/or amino acid sequence. Nucleic acids or polypeptides that are homologous to each other are termed “homologues.” Homology between two sequences can be determined by sequence alignment methods known to those of skill in the art. In accordance with the invention, two sequences are considered to be homologous if they are at least about 50-60% identical, e.g., share identical residues (e.g., amino acid residues) in at least about 50-60% of all residues comprised in one or the other sequence, at least about 70% identical, at least about 80% identical, at least about 85% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical, for at least one stretch of at least 20, at least 30, at least 40, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 120, at least 150, or at least 200 amino acids.
The term “sequence identity” or “percent sequence identity” as used herein, may refer to the percentage of nucleic acid or amino acid residues within a given DNA or protein, respectively, that are identical to the reference sequence. See, for example: Christopher M. Holman, Protein Similarity Score: A Simplified Version of the BLAST Score as a Superior Alternative to Percent Identity for Claiming Genuses of Related Protein Sequences, 21 SANTA CLARA COMPUTER & HIGH TECH. L. J. 55, 60 (2004), which is herein incorporated by reference in its entirety.
The term “linker,” as used herein, refers to a bond (e.g., covalent bond), chemical group, or a molecule linking two molecules or moieties, e.g., two domains of a fusion protein, such as, for example, a nuclease-inactive Cas9 domain and a nucleic acid-editing domain (e.g., an adenosine deaminase). In some embodiments, a linker joins a gRNA binding domain of an RNA-programmable nuclease, including a Cas9 nuclease domain, and the catalytic domain of a nucleic-acid editing protein. In some embodiments, a linker joins a dCas9 and a nucleic-acid editing protein. Typically, the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two. In some embodiments, the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein). In some embodiments, the linker is an organic molecule, group, polymer, or chemical moiety. In some embodiments, the linker is 5-100 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 30-35, 35-40, 40-45, 45-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-150, or 150-200 amino acids in length. Longer or shorter linkers are also contemplated. In some embodiments, a linker comprises the amino acid sequence SGSETPGTSESATPES (SEQ ID NO: 7), which may also be referred to as the XTEN linker. In some embodiments, a linker comprises the amino acid sequence SGGS (SEQ ID NO: 758). In some embodiments, a linker comprises (SGGS)n (SEQ ID NO: 758), (GGGS)n (SEQ ID NO: 759), (GGGGS)n (SEQ ID NO: 722), (G)n, (EAAAK). (SEQ ID NO: 723), (GGS)n, or (XP)n motif, or a combination of any of these, wherein n is independently an integer between 1 and 30, and wherein X is any amino acid. In some embodiments, n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15.
The term “mutation,” as used herein, refers to a substitution of a residue within a sequence, e.g., a nucleic acid or amino acid sequence, with another residue, or a deletion or insertion of one or more residues within a sequence. Mutations are typically described herein by identifying the original residue followed by the position of the residue within the sequence and by the identity of the newly substituted residue. Various methods for making the amino acid substitutions (mutations) provided herein are well known in the art, and are provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)).
The term “nuclear localization sequence” or “NLS” refers to an amino acid sequence that promotes import of a protein into the cell nucleus, for example, by nuclear transport. Nuclear localization sequences are known in the art and would be apparent to the skilled artisan. For example, NLS sequences are described in Plank et al., international PCT application, PCT/EP2000/011690, filed Nov. 23, 2000, published as WO/2001/038547 on May 31, 2001, the contents of which are incorporated herein by reference for their disclosure of exemplary nuclear localization sequences. In some embodiments, a NLS comprises the amino acid sequence PKKKRKV (SEQ ID NO: 702) or MDSLLMNRRKFLYQFKNVRWAKGRRETYLC (SEQ ID NO: 761).
The term “nuclease,” as used herein, refers to an agent, for example, a protein, capable of cleaving a phosphodiester bond connecting two nucleotide residues in a nucleic acid molecule. In some embodiments, “nuclease” refers to a protein having an inactive DNA cleavage domain, such that the nuclease is incapable of cleaving a phosphodiester bond. In some embodiments, a nuclease is a protein, e.g., an enzyme that can bind a nucleic acid molecule and cleave a phosphodiester bond connecting nucleotide residues within the nucleic acid molecule. A nuclease may be an endonuclease, cleaving a phosphodiester bonds within a polynucleotide chain, or an exonuclease, cleaving a phosphodiester bond at the end of the polynucleotide chain. In some embodiments, a nuclease is a site-specific nuclease, binding and/or cleaving a specific phosphodiester bond within a specific nucleotide sequence, which is also referred to herein as the “recognition sequence,” the “nuclease target site,” or the “target site.” In some embodiments, a nuclease is a RNA-guided (i.e., RNA-programmable) nuclease, which is associated with (e.g., binds to) an RNA (e.g., a guide RNA, “gRNA”) having a sequence that complements a target site, thereby providing the sequence specificity of the nuclease. In some embodiments, a nuclease recognizes a single stranded target site, while in other embodiments, a nuclease recognizes a double-stranded target site, for example, a double-stranded DNA target site. The target sites of many naturally occurring nucleases, for example, many naturally occurring DNA restriction nucleases, are well known to those of skill in the art. A nuclease protein typically comprises a “binding domain” that mediates the interaction of the protein with the nucleic acid substrate, and also, in some cases, specifically binds to a target site, and a “cleavage domain” that catalyzes the cleavage of the phosphodiester bond within the nucleic acid backbone. In some embodiments a nuclease protein can bind and cleave a nucleic acid molecule in a monomeric form, while, in other embodiments, a nuclease protein has to dimerize or multimerize in order to cleave a target nucleic acid molecule. Binding domains and cleavage domains of naturally occurring nucleases, as well as modular binding domains and cleavage domains that can be fused to create nucleases binding specific target sites, are well known to those of skill in the art. For example, the binding domain of a guide nucleotide sequence-programmable DNA binding protein such as an RNA-programmable nucleases (e.g., Cas9), or a Cas9 protein having an inactive DNA cleavage domain, can be used as a binding domain (e.g., that binds a gRNA to direct binding to a target site) to specifically bind a desired target site, and fused or conjugated to a cleavage domain.
The terms “nucleic acid” and “nucleic acid molecule,” as used herein, refer to a compound comprising a nucleobase and an acidic moiety, e.g., a nucleoside, a nucleotide, or a polymer of nucleotides. Typically, polymeric nucleic acids, e.g., nucleic acid molecules comprising three or more nucleotides are linear molecules, in which adjacent nucleotides are linked to each other via a phosphodiester linkage. In some embodiments, “nucleic acid” refers to individual nucleic acid residues (e.g., nucleotides and/or nucleosides). In some embodiments, “nucleic acid” refers to an oligonucleotide chain comprising three or more individual nucleotide residues. As used herein, the terms “oligonucleotide” and “polynucleotide” can be used interchangeably to refer to a polymer of nucleotides (e.g., a string of at least three nucleotides). In some embodiments, “nucleic acid” encompasses RNA as well as single and/or double-stranded DNA. Nucleic acids may be naturally occurring, for example, in the context of a genome, a transcript, an mRNA, tRNA, rRNA, siRNA, snRNA, gRNA, plasmid, cosmid, chromosome, chromatid, or other naturally occurring nucleic acid molecule. On the other hand, a nucleic acid molecule may be a non-naturally occurring molecule, e.g., a recombinant DNA or RNA, an artificial chromosome, an engineered genome, or fragment thereof, or a synthetic DNA, RNA, DNA/RNA hybrid, or including non-naturally occurring nucleotides or nucleosides. Furthermore, the terms “nucleic acid,” “DNA,” “RNA,” and/or similar terms include nucleic acid analogs, i.e., analogs having other than a phosphodiester backbone. Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, and backbone modifications. A nucleic acid sequence is presented in the 5′ to 3′ direction unless otherwise indicated. In some embodiments, a nucleic acid is or comprises natural nucleosides (e.g., adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine); nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, O(6)-methylguanine, and 2-thiocytidine); chemically modified bases; biologically modified bases (e.g., methylated bases); intercalated bases; modified sugars (e.g., 2′-fluororibose, ribose, 2′-deoxyribose, arabinose, and hexose); and/or modified phosphate groups (e.g., phosphorothioates and 5′-N-phosphoramidite linkages).
The term “orthogonal” refers to biological components that interact minimally, if at all. Recombinase target sites containing different gRNA binding sites are orthogonal if the gRNA-directed recCas9 proteins do not interact, or interact minimally, with other potential recombinase sites. The term “orthogonality” refers to the idea that system components can be varied independently without affecting the performance of the other components. The gRNA directed nature of the complex makes the set of gRNA molecules complexed to recCas9 proteins capable of directing recombinase activity at only the gRNA-directed site. Orthogonality of the system is demonstrated by the complete or near complete dependence of the set of gRNA molecules on the enzymatic activity on a targeted recombinase site.
The term “pharmaceutical composition,” as used herein, refers to a composition that can be administrated to a subject in the context of treatment and/or prevention of a disease or disorder. In some embodiments, a pharmaceutical composition comprises an active ingredient, e.g., a recombinase fused to a Cas9 protein, or fragment thereof (or a nucleic acid encoding a such a fusion), and optionally a pharmaceutically acceptable excipient. In some embodiments, a pharmaceutical composition comprises inventive Cas9 variant/fusion (e.g., fCas9) protein(s) and gRNA(s) suitable for targeting the Cas9 variant/fusion protein(s) to a target nucleic acid. In some embodiments, the target nucleic acid is a gene. In some embodiments, the target nucleic acid is an allele associated with a disease, wherein the allele is cleaved by the action of the Cas9 variant/fusion protein(s). In some embodiments, the allele is an allele of the CLTA gene, the VEGF gene, the PCDH15, gene or the FAM19A2 gene. See, e.g., the Examples.
The term “proliferative disease,” as used herein, refers to any disease in which cell or tissue homeostasis is disturbed in that a cell or cell population exhibits an abnormally elevated proliferation rate. Proliferative diseases include hyperproliferative diseases, such as pre-neoplastic hyperplastic conditions and neoplastic diseases. Neoplastic diseases are characterized by an abnormal proliferation of cells and include both benign and malignant neoplasms. Malignant neoplasia is also referred to as cancer. In some embodiments, the compositions and methods provided herein are useful for treating a proliferative disease. For example, in some embodiments, pharmaceutical compositions comprising Cas9 (e.g., fCas9) protein(s) and gRNA(s) suitable for targeting the Cas9 protein(s) to an VEGF allele, wherein the allele is inactivated by the action of the Cas9 protein(s). See, e.g., the Examples.
The terms “protein,” “peptide,” and “polypeptide” are used interchangeably herein, and refer to a polymer of amino acid residues linked together by peptide (amide) bonds. The terms refer to a protein, peptide, or polypeptide of any size, structure, or function. Typically, a protein, peptide, or polypeptide will be at least three amino acids long. A protein, peptide, or polypeptide may refer to an individual protein or a collection of proteins. One or more of the amino acids in a protein, peptide, or polypeptide may be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modification, etc. A protein, peptide, or polypeptide may also be a single molecule or may be a multi-molecular complex. A protein, peptide, or polypeptide may be just a fragment of a naturally occurring protein or peptide. A protein, peptide, or polypeptide may be naturally occurring, recombinant, or synthetic, or any combination thereof. The term “fusion protein” as used herein refers to a hybrid polypeptide that comprises protein domains from at least two different proteins. One protein may be located at the amino-terminal (N-terminal) portion of the fusion protein or at the carboxy-terminal (C-terminal) protein thus forming an “amino-terminal fusion protein” or a “carboxy-terminal fusion protein,” respectively. Any of the proteins provided herein may be produced by any method known in the art. For example, the proteins provided herein may be produced via recombinant protein expression and purification, which is especially suited for fusion proteins comprising a peptide linker. Methods for recombinant protein expression and purification are well known, and include those described by Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)), the entire contents of which are incorporated herein by reference. A specific fusion protein referred to herein is recCas9, an RNA programmed small serine recombinase capable of functioning in mammalian cells created by fusion a catalytically inactive dCas9 to the catalytic domain of recombinase.
A “pseudo-gix” site or a “gix pseudo-site” as discussed herein is a specific pseudo-palindromic core DNA sequence that resembles the Gix recombinases' natural DNA recognition sequence. See, for example, N. D. F. Grindley, K. L. Whiteson, P. A. Rice, Mechanisms of site-specific recombination. Annu Rev Biochem 75, 567-605 (2006), which is incorporated by reference herein in its entirety. Similarly, a “pseudo-hix” or “hix-pseudo-site;” a “pseudo-six” or “six-pseudo site;” a “pseudo-resH” or “resH-pseudo-site;” “pseudo-res”or “res-pseudo-site;” “pseudo-LoxP” or “LoxP-pseudo-site;” “pseudo-att” or “att-pseudo-site;” “pseudo-FTR” or “FTR-pseudo-site” is a specific pseudo-palindromic core DNA sequence that resembles the Hin recombinase's, β recombinase's, Sin recombinase's, Tn3 or γδ recombinase's, Cre recombinase's, λ phage integrase's, or FLP recombinase's natural DNA recognition sequence.
The terms “RNA-programmable nuclease” and “RNA-guided nuclease” are used interchangeably herein and refer to a nuclease that forms a complex with (e.g., binds or associates with) one or more RNA that is not a target for cleavage. In some embodiments, an RNA-programmable nuclease, when in a complex with an RNA, may be referred to as a nuclease:RNA complex. Typically, the bound RNA(s) is referred to as a guide RNA (gRNA). gRNAs can exist as a complex of two or more RNAs, or as a single RNA molecule. gRNAs that exist as a single RNA molecule may be referred to as single-guide RNAs (sgRNAs), though “gRNA” is used interchangeabley to refer to guide RNAs that exist as either single molecules or as a complex of two or more molecules. Typically, gRNAs that exist as single RNA species comprise two domains: (1) a domain that shares homology to a target nucleic acid (e.g., and directs binding of a Cas9 complex to the target); and (2) a domain that binds a Cas9 protein. In some embodiments, domain (2) corresponds to a sequence known as a tracrRNA, and comprises a stem-loop structure. For example, in some embodiments, domain (2) is homologous to a tracrRNA as depicted in
Because RNA-programmable nucleases (e.g., Cas9) use RNA:DNA hybridization to determine target DNA cleavage sites, these proteins are able to cleave, in principle, any sequence specified by the guide RNA. Methods of using RNA-programmable nucleases, such as Cas9, for site-specific cleavage (e.g., to modify a genome) are known in the art (see e.g., Cong, L. et al. Multiplex genome engineering using CRISPR/Cas systems. Science 339, 819-823 (2013); Mali, P. et al. RNA-guided human genome engineering via Cas9. Science 339, 823-826 (2013); Hwang, W. Y. et al. Efficient genome editing in zebrafish using a CRISPR-Cas system. Nature biotechnology 31, 227-229 (2013); Jinek, M. et al. RNA-programmed genome editing in human cells. eLife 2, e00471 (2013); Dicarlo, J. E. et al. Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic acids research (2013); Jiang, W. et al. RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Nature biotechnology 31, 233-239 (2013); the entire contents of each of which are incorporated herein by reference).
The term “recombinase,” as used herein, refers to a site-specific enzyme that mediates the recombination of DNA between recombinase recognition sequences, which results in the excision, integration, inversion, or exchange (e.g., translocation) of DNA fragments between the recombinase recognition sequences. Recombinases can be classified into two distinct families: serine recombinases (e.g., resolvases and invertases) and tyrosine recombinases (e.g., integrases). Examples of serine recombinases include, without limitation, Hin, Gin, Tn3, β-six, CinH, ParA, γδ, Bxb1, ϕC31, TP901, TG1, ϕBT1, R4, ϕRV1, ϕFC1, MR11, A118, U153, and gp29. Examples of tyrosine recombinases include, without limitation, Cre, FLP, R, Lambda, HK101, HK022, and pSAM2. The Gin recombinase referred to herein may be any Gin recombinase known in the art including, but not limited to, the Gin recombinases presented in T. Gaj et al., A comprehensive approach to zinc-finger recombinase customization enables genomic targeting in human cells. Nucleic Acids Research 41, 3937-3946 (2013), incorporated herein by reference in its entirety. In certain embodiments, the Gin recombinase catalytic domain has greater than 85%, 90%, 95%, 98%, or 99% sequence identity with the amino acid sequence shown in SEQ ID NO: 713. In another embodiment, the amino acid sequence of the Gin recombinase catalytic domain comprises a mutation corresponding to H106Y, and/or I127L, and/or I136R and/or G137F. In yet another embodiment, the amino acid sequence of the Gin recombinase catalytic domain comprises a mutation corresponding to H106Y, I127L, I136R, and G137F. In a further embodiment, the amino acid sequence of the Gin recombinase has been further mutated. In a specific embodiment, the amino acid sequence of the Gin recombinase catalytic domain comprises SEQ ID NO: 713. Gin recombinases bind to gix target sites (also referred to herein as “gix core,” “minimal gix core,” or “gix-related core” sequences). The minimal gix core recombinase site is NNNNAAASSWWSSTTTNNNN (SEQ ID NO: 19), wherein N is defined as any amino acid, W is an A or a T, and S is a G or a C. The gix target site may include any other mutations known in the art. In certain embodiments, the gix target site has greater than 90%, 95%, or 99% sequence identity with the amino acid sequence shown in SEQ ID NO: 19. The distance between the gix core or gix-related core sequence and at least one gRNA binding site may be from 1 to 10 base pairs, from 3 to 7 base pairs, from 5 to 7 base pairs, or from 5 to 6 base pairs. The distance between the gix core or gix-related core sequence and at least one gRNA binding site may be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 base pairs.
The serine and tyrosine recombinase names stem from the conserved nucleophilic amino acid residue that the recombinase uses to attack the DNA and which becomes covalently linked to the DNA during strand exchange. Recombinases have numerous applications, including the creation of gene knockouts/knock-ins and gene therapy applications. See, e.g., Brown et al., “Serine recombinases as tools for genome engineering.” Methods. 2011; 53(4):372-9; Hirano et al., “Site-specific recombinases as tools for heterologous gene integration.” Appl. Microbiol. Biotechnol. 2011; 92(2):227-39; Chavez and Calos, “Therapeutic applications of the ΦC31 integrase system.” Curr. Gene Ther. 2011; 11(5):375-81; Turan and Bode, “Site-specific recombinases: from tag-and-target- to tag-and-exchange-based genomic modifications.” FASEB J. 2011; 25(12):4088-107; Venken and Bellen, “Genome-wide manipulations of Drosophila melanogaster with transposons, Flp recombinase, and ΦC31 integrase.” Methods Mol. Biol. 2012; 859:203-28; Murphy, “Phage recombinases and their applications.” Adv. Virus Res. 2012; 83:367-414; Zhang et al., “Conditional gene manipulation: Creating a new biological era.” J. Zhejiang Univ. Sci. B. 2012; 13(7):511-24; Karpenshif and Bernstein, “From yeast to mammals: recent advances in genetic control of homologous recombination.” DNA Repair (Amst). 2012; 1; 11(10):781-8; the entire contents of each are hereby incorporated by reference in their entirety. The recombinases provided herein are not meant to be exclusive examples of recombinases that can be used in embodiments of the invention. The methods and compositions of the invention can be expanded by mining databases for new orthogonal recombinases or designing synthetic recombinases with defined DNA specificities (See, e.g., Groth et al., “Phage integrases: biology and applications.” J. Mol. Biol. 2004; 335, 667-678; Gordley et al., “Synthesis of programmable integrases.” Proc. Natl. Acad. Sci. USA. 2009; 106, 5053-5058; the entire contents of each are hereby incorporated by reference in their entirety).
Other examples of recombinases that are useful in the methods and compositions described herein are known to those of skill in the art, and any new recombinase that is discovered or generated is expected to be able to be used in the different embodiments of the invention. In some embodiments, the catalytic domains of a recombinase are fused to a nuclease-inactivated RNA-programmable nuclease (e.g., dCas9, or a fragment thereof), such that the recombinase domain does not comprise a nucleic acid binding domain or is unable to bind to a target nucleic acid that subsequently results in enzymatic catalysis (e.g., the recombinase domain is engineered such that it does not have specific DNA binding activity). Recombinases lacking part of their DNA binding activity and those that act independently of accessory proteins and methods for engineering such are known, and include those described by Klippel et al., “Isolation and characterisation of unusual gin mutants.” EMBO J. 1988; 7: 3983-3989: Burke et al., “Activating mutations of Tn3 resolvase marking interfaces important in recombination catalysis and its regulation. Mol Microbiol. 2004; 51: 937-948; Olorunniji et al., “Synapsis and catalysis by activated Tn3 resolvase mutants.” Nucleic Acids Res. 2008; 36: 7181-7191; Rowland et al., “Regulatory mutations in Sin recombinase support a structure-based model of the synaptosome.” Mol Microbiol. 2009; 74: 282-298; Akopian et al., “Chimeric recombinases with designed DNA sequence recognition.” Proc Natl Acad Sci USA. 2003; 100: 8688-8691; Gordley et al., “Evolution of programmable zinc finger-recombinases with activity in human cells. J Mol Biol. 2007; 367: 802-813; Gordley et al., “Synthesis of programmable integrases.” Proc Natl Acad Sci USA. 2009; 106: 5053-5058; Arnold et al., “Mutants of Tn3 resolvase which do not require accessory binding sites for recombination activity.” EMBO J. 1999; 18: 1407-1414; Gaj et al., “Structure-guided reprogramming of serine recombinase DNA sequence specificity.” Proc Natl Acad Sci USA. 2011; 108(2):498-503; and Proudfoot et al., “Zinc finger recombinases with adaptable DNA sequence specificity.” PLoS One. 2011; 6(4):e19537; the entire contents of each are hereby incorporated by reference. For example, serine recombinases of the resolvase-invertase group, e.g., Tn3 and γδ resolvases and the Hin and Gin invertases, have modular structures with partly autonomous catalytic and DNA-binding domains (See, e.g., Grindley et al., “Mechanism of site-specific recombination.” Ann Rev Biochem. 2006; 75: 567-605, the entire contents of which are incorporated by reference). The catalytic domains of these recombinases are therefore amenable to being recombined with nuclease-inactivated RNA-programmable nucleases (e.g., dCas9, or a fragment thereof) as described herein, e.g., following the isolation of ‘activated’ recombinase mutants which do not require any accessory factors (e.g., DNA binding activities) (See, e.g., Klippel et al., “Isolation and characterisation of unusual gin mutants.” EMBO J. 1988; 7: 3983-3989: Burke et al., “Activating mutations of Tn3 resolvase marking interfaces important in recombination catalysis and its regulation. Mol Microbiol. 2004; 51: 937-948; Olorunniji et al., “Synapsis and catalysis by activated Tn3 resolvase mutants.” Nucleic Acids Res. 2008; 36: 7181-7191; Rowland et al., “Regulatory mutations in Sin recombinase support a structure-based model of the synaptosome.” Mol Microbiol. 2009; 74: 282-298; Akopian et al., “Chimeric recombinases with designed DNA sequence recognition.” Proc Natl Acad Sci USA. 2003; 100: 8688-8691).
Additionally, many other natural serine recombinases having an N-terminal catalytic domain and a C-terminal DNA binding domain are known (e.g., phiC31 integrase, TnpX transposase, IS607 transposase), and their catalytic domains can be co-opted to engineer programmable site-specific recombinases as described herein (See, e.g., Smith et al., “Diversity in the serine recombinases.” Mol Microbiol. 2002; 44: 299-307, the entire contents of which are incorporated by reference). Similarly, the core catalytic domains of tyrosine recombinases (e.g., Cre, λ integrase) are known, and can be similarly co-opted to engineer programmable site-specific recombinases as described herein (See, e.g., Guo et al., “Structure of Cre recombinase complexed with DNA in a site-specific recombination synapse.” Nature. 1997; 389:40-46; Hartung et al., “Cre mutants with altered DNA binding properties.” J Biol Chem 1998; 273:22884-22891; Shaikh et al., “Chimeras of the Flp and Cre recombinases: Tests of the mode of cleavage by Flp and Cre. J Mol Biol. 2000; 302:27-48; Rongrong et al., “Effect of deletion mutation on the recombination activity of Cre recombinase.” Acta Biochim Pol. 2005; 52:541-544; Kilbride et al., “Determinants of product topology in a hybrid Cre-Tn3 resolvase site-specific recombination system.” J Mol Biol. 2006; 355:185-195; Warren et al., “A chimeric cre recombinase with regulated directionality.” Proc Natl Acad Sci USA. 2008 105:18278-18283; Van Duyne, “Teaching Cre to follow directions.” Proc Natl Acad Sci USA. 2009 Jan. 6; 106(1):4-5; Numrych et al., “A comparison of the effects of single-base and triple-base changes in the integrase arm-type binding sites on the site-specific recombination of bacteriophage λ.” Nucleic Acids Res. 1990; 18:3953-3959; Tirumalai et al., “The recognition of core-type DNA sites by λ integrase.” J Mol Biol. 1998; 279:513-527; Aihara et al., “A conformational switch controls the DNA cleavage activity of k integrase.” Mol Cell. 2003; 12:187-198; Biswas et al., “A structural basis for allosteric control of DNA recombination by k integrase.” Nature. 2005; 435:1059-1066; and Warren et al., “Mutations in the amino-terminal domain of λ-integrase have differential effects on integrative and excisive recombination.” Mol Microbiol. 2005; 55:1104-1112; the entire contents of each are incorporated by reference).
The term “recombine” or “recombination,” in the context of a nucleic acid modification (e.g., a genomic modification), is used to refer to the process by which two or more nucleic acid molecules, or two or more regions of a single nucleic acid molecule, are modified by the action of a recombinase protein (e.g., an inventive recombinase fusion protein provided herein). Recombination can result in, inter alia, the insertion, inversion, excision, or translocation of nucleic acids, e.g., in or between one or more nucleic acid molecules.
The term “recombinant” as used herein in the context of proteins or nucleic acids refers to proteins or nucleic acids that do not occur in nature, but are the product of human engineering. For example, in some embodiments, a recombinant protein or nucleic acid molecule comprises an amino acid or nucleotide sequence that comprises at least one, at least two, at least three, at least four, at least five, at least six, or at least seven mutations as compared to any naturally occurring sequence.
The term “subject,” as used herein, refers to an individual organism, for example, an individual mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal. In some embodiments, the subject is a non-human primate. In some embodiments, the subject is a rodent. In some embodiments, the subject is a sheep, a goat, a cattle, a cat, or a dog. In some embodiments, the subject is a vertebrate, an amphibian, a reptile, a fish, an insect, a fly, or a nematode. In some embodiments, the subject is a research animal. In some embodiments, the subject is genetically engineered, e.g., a genetically engineered non-human subject. The subject may be of either sex and at any stage of development. In some embodiments, the subject is genetically engineered, e.g., a genetically engineered non-human subject. The subject may be of either sex and at any stage of development.
The terms “target nucleic acid,” and “target genome,” as used herein in the context of nucleases, refer to a nucleic acid molecule or a genome, respectively, that comprises at least one target site of a given nuclease. In the context of fusions comprising a (nuclease-inactivated) RNA-programmable nuclease and a recombinase domain, a “target nucleic acid” and a “target genome” refers to one or more nucleic acid molecule(s), or a genome, respectively, that comprises at least one target site. In some embodiments, the target nucleic acid(s) comprises at least two, at least three, at least four, at least five, at least six, at least seven, or at least eight target sites. In some embodiments, the target nucleic acid(s) comprise four target sites.
The term “target site” refers to a sequence within a nucleic acid molecule that is bound and recombined (e.g., at or nearby the target site) by a recombinase (e.g., a dCas9-recombinase fusion protein provided herein). A target site may be single-stranded or double-stranded. For example, in some embodiments, four recombinase monomers are coordinated to recombine a target nucleic acid(s), each monomer being fused to a (nuclease-inactivated) Cas9 protein guided by a gRNA. In such an example, each Cas9 domain is guided by a distinct gRNA to bind a target nucleic acid(s), thus the target nucleic acid comprises four target sites, each site targeted by a separate dCas9-recombinase fusion (thereby coordinating four recombinase monomers which recombine the target nucleic acid(s)). For the RNA-guided nuclease-inactivated Cas9 (or gRNA-binding domain thereof) and inventive fusions of Cas9, the target site may be, in some embodiments, 17-20 base pairs plus a 3 base pair PAM (e.g., NNN, wherein N independently represents any nucleotide). Typically, the first nucleotide of a PAM can be any nucleotide, while the two downstream nucleotides are specified depending on the specific RNA-guided nuclease. Exemplary target sites (e.g., comprising a PAM) for RNA-guided nucleases, such as Cas9, are known to those of skill in the art and include, without limitation, NNG, NGN, NAG, and NGG, wherein each N is independently any nucleotide. In addition, Cas9 nucleases from different species (e.g., S. thermophilus instead of S. pyogenes) recognize a PAM that comprises the sequence NGGNG (SEQ ID NO: 763). Additional PAM sequences are known, including, but not limited to, NNAGAAW (SEQ ID NO: 749) and NAAR (SEQ ID NO: 771) (see, e.g., Esvelt and Wang, Molecular Systems Biology, 9:641 (2013), the entire contents of which are incorporated herein by reference). In some aspects, the target site of an RNA-guided nuclease, such as, e.g., Cas9, may comprise the structure [NZ]-[PAM], where each N is independently any nucleotide, and z is an integer between 1 and 50, inclusive. In some embodiments, z is at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, or at least 50. In some embodiments, z is 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50. In some embodiments, z is 20. In certain embodiments, a “PAMless” RNA-guided nuclease (e.g., a Pamless Cas9) or an RNA-guided nuclease with relaxed PAM requirements as further described herein may be used. In some embodiments, “target site” may also refer to a sequence within a nucleic acid molecule that is bound but not cleaved by a nuclease. For example, certain embodiments described herein provide proteins comprising an inactive (or inactivated) Cas9 DNA cleavage domain. Such proteins (e.g., when also including a Cas9 RNA binding domain) are able to bind the target site specified by the gRNA; however, because the DNA cleavage site is inactivated, the target site is not cleaved by the particular protein. In some embodiments, such proteins are conjugated, fused, or bound to a recombinase (or a catalytic domain of a recombinase), which mediates recombination of the target nucleic acid. In some embodiments, the sequence actually cleaved or recombined will depend on the protein (e.g., recombinase) or molecule that mediates cleavage or recombination of the nucleic acid molecule, and in some cases, for example, will relate to the proximity or distance from which the inactivated Cas9 protein(s) is/are bound.
The term “Transcriptional Activator-Like Effector,” (TALE) as used herein, refers to bacterial proteins comprising a DNA binding domain, which contains a highly conserved 33-34 amino acid sequence comprising a highly variable two-amino acid motif (Repeat Variable Diresidue, RVD). The RVD motif determines binding specificity to a nucleic acid sequence and can be engineered according to methods known to those of skill in the art to specifically bind a desired DNA sequence (see, e.g., Miller, Jeffrey; et. al. (February 2011). “A TALE nuclease architecture for efficient genome editing”. Nature Biotechnology 29 (2): 143-8; Zhang, Feng; et. al. (February 2011). “Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription” Nature Biotechnology 29 (2): 149-53; Geiβler, R.; Scholze, H.; Hahn, S.; Streubel, J.; Bonas, U.; Behrens, S. E.; Boch, J. (2011), Shiu, Shin-Han. ed. “Transcriptional Activators of Human Genes with Programmable DNA-Specificity”. PLoS ONE 6 (5): e19509; Boch, Jens (February 2011). “TALEs of genome targeting”. Nature Biotechnology 29 (2): 135-6; Boch, Jens; et. al. (December 2009). “Breaking the Code of DNA Binding Specificity of TAL-Type III Effectors”. Science 326 (5959): 1509-12; and Moscou, Matthew J.; Adam J. Bogdanove (December 2009). “A Simple Cipher Governs DNA Recognition by TAL Effectors” Science 326 (5959): 1501; the entire contents of each of which are incorporated herein by reference). The simple relationship between amino acid sequence and DNA recognition has allowed for the engineering of specific DNA binding domains by selecting a combination of repeat segments containing the appropriate RVDs.
The term “Transcriptional Activator-Like Element Nuclease,” (TALEN) as used herein, refers to an artificial nuclease comprising a transcriptional activator-like effector DNA binding domain to a DNA cleavage domain, for example, a FokI domain. A number of modular assembly schemes for generating engineered TALE constructs have been reported (see e.g., Zhang, Feng; et. al. (February 2011). “Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription”. Nature Biotechnology 29 (2): 149-53; Geiβler, R.; Scholze, H.; Hahn, S.; Streubel, J.; Bonas, U.; Behrens, S. E.; Boch, J. (2011), Shiu, Shin-Han. ed. “Transcriptional Activators of Human Genes with Programmable DNA-Specificity”. PLoS ONE 6 (5): e19509; Cermak, T.; Doyle, E. L.; Christian, M.; Wang, L.; Zhang, Y.; Schmidt, C.; Baller, J. A.; Somia, N. V. et al. (2011). “Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting”. Nucleic Acids Research; Morbitzer, R.; Elsaesser, J.; Hausner, J.; Lahaye, T. (2011). “Assembly of custom TALE-type DNA binding domains by modular cloning”. Nucleic Acids Research; Li, T.; Huang, S.; Zhao, X.; Wright, D. A.; Carpenter, S.; Spalding, M. H.; Weeks, D. P.; Yang, B. (2011). “Modularly assembled designer TAL effector nucleases for targeted gene knockout and gene replacement in eukaryotes”. Nucleic Acids Research.; Weber, E.; Gruetzner, R.; Werner, S.; Engler, C.; Marillonnet, S. (2011). Bendahmane, Mohammed. ed. “Assembly of Designer TAL Effectors by Golden Gate Cloning”. PLoS ONE 6 (5): e19722; the entire contents of each of which are incorporated herein by reference).
The terms “treatment,” “treat,” and “treating,” refer to a clinical intervention aimed to reverse, alleviate, delay the onset of, or inhibit the progress of a disease or disorder, or one or more symptoms thereof, as described herein. As used herein, the terms “treatment,” “treat,” and “treating” refer to a clinical intervention aimed to reverse, alleviate, delay the onset of, or inhibit the progress of a disease or disorder, or one or more symptoms thereof, as described herein. In some embodiments, treatment may be administered after one or more symptoms have developed and/or after a disease has been diagnosed. In other embodiments, treatment may be administered in the absence of symptoms, e.g., to prevent or delay onset of a symptom or inhibit onset or progression of a disease. For example, treatment may be administered to a susceptible individual prior to the onset of symptoms (e.g., in light of a history of symptoms and/or in light of genetic or other susceptibility factors). Treatment may also be continued after symptoms have resolved, for example, to prevent or delay their recurrence.
The term “vector” refers to a polynucleotide comprising one or more recombinant polynucleotides of the present invention, e.g., those encoding a Cas9 protein (or fusion thereof) and/or gRNA provided herein. Vectors include, but are not limited to, plasmids, viral vectors, cosmids, artificial chromosomes, and phagemids. The vector may be able to replicate in a host cell and may further be characterized by one or more endonuclease restriction sites at which the vector may be cut and into which a desired nucleic acid sequence may be inserted. Vectors may contain one or more marker sequences suitable for use in the identification and/or selection of cells which have or have not been transformed or genomically modified with the vector. Markers include, for example, genes encoding proteins which increase or decrease either resistance or sensitivity to antibiotics (e.g., kanamycin, ampicillin) or other compounds, genes which encode enzymes whose activities are detectable by standard assays known in the art (e.g., β-galactosidase, alkaline phosphatase, or luciferase), and genes which visibly affect the phenotype of transformed or transfected cells, hosts, colonies, or plaques. Any vector suitable for the transformation of a host cell (e.g., E. coli, mammalian cells such as CHO cell, insect cells, etc.) as embraced by the present invention, for example, vectors belonging to the pUC series, pGEM series, pET series, pBAD series, pTET series, or pGEX series. In some embodiments, the vector is suitable for transforming a host cell for recombinant protein production. Methods for selecting and engineering vectors and host cells for expressing proteins (e.g., those provided herein), transforming cells, and expressing/purifying recombinant proteins are well known in the art, and are provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)).
The term “zinc finger,” as used herein, refers to a small nucleic acid-binding protein structural motif characterized by a fold and the coordination of one or more zinc ions that stabilize the fold. Zinc fingers encompass a wide variety of differing protein structures (see, e.g., Klug A, Rhodes D (1987). “Zinc fingers: a novel protein fold for nucleic acid recognition”. Cold Spring Harb. Symp. Quant. Biol. 52: 473-82, the entire contents of which are incorporated herein by reference). Zinc fingers can be designed to bind a specific sequence of nucleotides, and zinc finger arrays comprising fusions of a series of zinc fingers, can be designed to bind virtually any desired target sequence. Such zinc finger arrays can form a binding domain of a protein, for example, of a nuclease, e.g., if conjugated to a nucleic acid cleavage domain. Different types of zinc finger motifs are known to those of skill in the art, including, but not limited to, Cys2His2, Gag knuckle, Treble clef, Zinc ribbon, Zn2/Cys6, and TAZ2 domain-like motifs (see, e.g., Krishna S S, Majumdar I, Grishin N V (January 2003). “Structural classification of zinc fingers: survey and summary”. Nucleic Acids Res. 31 (2): 532-50). Typically, a single zinc finger motif binds 3 or 4 nucleotides of a nucleic acid molecule. Accordingly, a zinc finger domain comprising 2 zinc finger motifs may bind 6-8 nucleotides, a zinc finger domain comprising 3 zinc finger motifs may bind 9-12 nucleotides, a zinc finger domain comprising 4 zinc finger motifs may bind 12-16 nucleotides, and so forth. Any suitable protein engineering technique can be employed to alter the DNA-binding specificity of zinc fingers and/or design novel zinc finger fusions to bind virtually any desired target sequence from 3-30 nucleotides in length (see, e.g., Pabo C O, Peisach E, Grant R A (2001). “Design and selection of novel cys2His2 Zinc finger proteins”. Annual Review of Biochemistry 70: 313-340; Jamieson A C, Miller J C, Pabo C O (2003). “Drug discovery with engineered zinc-finger proteins”. Nature Reviews Drug Discovery 2 (5): 361-368; and Liu Q, Segal D J, Ghiara J B, Barbas C F (May 1997). “Design of polydactyl zinc-finger proteins for unique addressing within complex genomes”. Proc. Natl. Acad. Sci. U.S.A. 94 (11); the entire contents of each of which are incorporated herein by reference). Fusions between engineered zinc finger arrays and protein domains that cleave a nucleic acid can be used to generate a “zinc finger nuclease.” A zinc finger nuclease typically comprises a zinc finger domain that binds a specific target site within a nucleic acid molecule, and a nucleic acid cleavage domain that cuts the nucleic acid molecule within or in proximity to the target site bound by the binding domain. Typical engineered zinc finger nucleases comprise a binding domain having between 3 and 6 individual zinc finger motifs and binding target sites ranging from 9 base pairs to 18 base pairs in length. Longer target sites are particularly attractive in situations where it is desired to bind and cleave a target site that is unique in a given genome.
The term “zinc finger nuclease,” as used herein, refers to a nuclease comprising a nucleic acid cleavage domain conjugated to a binding domain that comprises a zinc finger array. In some embodiments, the cleavage domain is the cleavage domain of the type II restriction endonuclease FokI. Zinc finger nucleases can be designed to target virtually any desired sequence in a given nucleic acid molecule for cleavage, and the possibility to design zinc finger binding domains to bind unique sites in the context of complex genomes allows for targeted cleavage of a single genomic site in living cells, for example, to achieve a targeted genomic alteration of therapeutic value. Targeting a double-strand break to a desired genomic locus can be used to introduce frame-shift mutations into the coding sequence of a gene due to the error-prone nature of the non-homologous DNA repair pathway. Zinc finger nucleases can be generated to target a site of interest by methods well known to those of skill in the art. For example, zinc finger binding domains with a desired specificity can be designed by combining individual zinc finger motifs of known specificity. The structure of the zinc finger protein Zif268 bound to DNA has informed much of the work in this field and the concept of obtaining zinc fingers for each of the 64 possible base pair triplets and then mixing and matching these modular zinc fingers to design proteins with any desired sequence specificity has been described (Pavletich N P, Pabo C O (May 1991). “Zinc finger-DNA recognition: crystal structure of a Zif268-DNA complex at 2.1 A”. Science 252 (5007): 809-17, the entire contents of which are incorporated herein). In some embodiments, separate zinc fingers that each recognizes a 3 base pair DNA sequence are combined to generate 3-, 4-, 5-, or 6-finger arrays that recognize target sites ranging from 9 base pairs to 18 base pairs in length. In some embodiments, longer arrays are contemplated. In other embodiments, 2-finger modules recognizing 6-8 nucleotides are combined to generate 4-, 6-, or 8-zinc finger arrays. In some embodiments, bacterial or phage display is employed to develop a zinc finger domain that recognizes a desired nucleic acid sequence, for example, a desired nuclease target site of 3-30 bp in length. Zinc finger nucleases, in some embodiments, comprise a zinc finger binding domain and a cleavage domain fused or otherwise conjugated to each other via a linker, for example, a polypeptide linker. The length of the linker determines the distance of the cut from the nucleic acid sequence bound by the zinc finger domain. If a shorter linker is used, the cleavage domain will cut the nucleic acid closer to the bound nucleic acid sequence, while a longer linker will result in a greater distance between the cut and the bound nucleic acid sequence. In some embodiments, the cleavage domain of a zinc finger nuclease has to dimerize in order to cut a bound nucleic acid. In some such embodiments, the dimer is a heterodimer of two monomers, each of which comprise a different zinc finger binding domain. For example, in some embodiments, the dimer may comprise one monomer comprising zinc finger domain A conjugated to a FokI cleavage domain, and one monomer comprising zinc finger domain B conjugated to a FokI cleavage domain. In this non-limiting example, zinc finger domain A binds a nucleic acid sequence on one side of the target site, zinc finger domain B binds a nucleic acid sequence on the other side of the target site, and the dimerize FokI domain cuts the nucleic acid in between the zinc finger domain binding sites.
The function and advantage of these and other embodiments of the present invention will be more fully understood from the Examples below. The following Examples are intended to illustrate the benefits of the present invention and to describe particular embodiments, but are not intended to exemplify the full scope of the invention. Accordingly, it will be understood that the Examples are not meant to limit the scope of the invention.
Guide Nucleotide Sequence-Programmable DNA Binding Protein
The fusion proteins and methods described herein may use any programmable DNA binding domain.
In some embodiments, the programmable DNA binding protein domain comprises the DNA binding domain of a zinc finger nuclease (ZFN) or a transcription activator-like effector domain (TALE). In some embodiments, the programmable DNA binding protein domain may be programmed by a guide nucleotide sequence and is thus referred as a “guide nucleotide sequence-programmable DNA binding-protein domain.” In some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a nuclease inactive Cas9, or dCas9. A dCas9, as used herein, encompasses a Cas9 that is completely inactive in its nuclease activity, or partially inactive in its nuclease activity (e.g., a Cas9 nickase). Thus, in some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a Cas9 nickase. In some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a nuclease inactive Cpf1. In some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a nuclease inactive Argonaute.
In some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a dCas9 domain. In some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a Cas9 nickase. In some embodiments, the dCas9 domain comprises an amino acid sequence of SEQ ID NO: 2 or SEQ ID NO: 3. In some embodiments, the dCas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 domains provided herein, and comprises mutations corresponding to D10X (X is any amino acid except for D) and/or H840X (X is any amino acid except for H) in SEQ ID NO: 1. In some embodiments, the dCas9 domain comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 domains provided herein, and comprises mutations corresponding to D10A and/or H840A in SEQ ID NO: 1. In some embodiments, the Cas9 nickase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 domains provided herein, and comprises mutations corresponding to D10X (X is any amino acid except for D) in SEQ ID NO: 1 and a histidine at a position correspond to position 840 in SEQ ID NO: 1. In some embodiments, the Cas9 nickase comprises an amino acid sequence that is at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any one of the Cas9 domains provided herein, and comprises mutations corresponding to D10A in SEQ ID NO: 1 and a histidine at a position correspond to position 840 in SEQ ID NO: 1. In some embodiments, variants or homologues of dCas9 or Cas9 nickase (e.g., variants of SEQ ID NO: 2 or SEQ ID NO: 3, respectively) are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% identical to SEQ ID NO: 2 or SEQ ID NO: 3, respectively, and comprises mutations corresponding to D10A and/or H840A in SEQ ID NO: 1. In some embodiments, variants of Cas9 (e.g., variants of SEQ ID NO: 2) are provided having amino acid sequences which are shorter, or longer than SEQ ID NO: 2, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids, or more, provided that the dCas9 variants comprise mutations corresponding to D10A and/or H840A in SEQ ID NO: 1. In some embodiments, variants of Cas9 nickase (e.g., variants of SEQ ID NO: 3) are provided having amino acid sequences which are shorter, or longer than SEQ ID NO: 3, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids, or more, provided that the dCas9 variants comprise mutations corresponding to D10A and comprises a histidine at a position corresponding to position 840 in SEQ ID NO: 1.
Additional suitable nuclease-inactive dCas9 domains will be apparent to those of skill in the art based on this disclosure and knowledge in the field, and are within the scope of this disclosure. Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A/H840A, D10A/D839A/H840A, D10A/D839A/H840A/N863A mutant domains in SEQ ID NO: 1 (See, e.g., Prashant et al., Nature Biotechnology. 2013; 31(9): 833-838, which is incorporated herein by reference), or K603R (See, e.g., Chavez et al., Nature Methods 12, 326-328, 2015, which is incorporated herein by reference).
In some embodiments, the nucleobase editors described herein comprise a Cas9 domain with decreased electrostatic interactions between the Cas9 domain and a sugar-phosphate backbone of a DNA, as compared to a wild-type Cas9 domain. In some embodiments, a Cas9 domain comprises one or more mutations that decreases the association between the Cas9 domain and a sugar-phosphate backbone of a DNA. In some embodiments, the nucleobase editors described herein comprises a dCas9 (e.g., with D10A and H840A mutations in SEQ ID NO: 1) or a Cas9 nickase (e.g., with D10A mutation in SEQ ID NO: 1), wherein the dCas9 or the Cas9 nickase further comprises one or more of a N497X, a R661X, a Q695X, and/or a Q926X mutation of the amino acid sequence provided in SEQ ID NO: 10, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 11-260, wherein X is any amino acid. In some embodiments, the nucleobase editors described herein comprises a dCas9 (e.g., with D10A and H840A mutations in SEQ ID NO: 1) or a Cas9 nickase (e.g., with D10A mutation in SEQ ID NO: 1), wherein the dCas9 or the Cas9 nickase further comprises one or more of a N497A, a R661A, a Q695A, and/or a Q926A mutation of the amino acid sequence provided in SEQ ID NO: 10, or a corresponding mutation in any of the amino acid sequences provided in SEQ ID NOs: 11-260. In some embodiments, the Cas9 domain (e.g., of any of the nucleobase editors provided herein) comprises the amino acid sequence as set forth in SEQ ID NO: 720. In some embodiments, the nucleobase editor comprises the amino acid sequence as set forth in SEQ ID NO: 721. Cas9 domains with high fidelity are known in the art and would be apparent to the skilled artisan. For example, Cas9 domains with high fidelity have been described in Kleinstiver, B. P., et al. “High-fidelity CRISPR-Cas9 nucleases with no detectable genome-wide off-target effects.” Nature 529, 490-495 (2016); and Slaymaker, I. M., et al. “Rationally engineered Cas9 nucleases with improved specificity.” Science 351, 84-88 (2015); the entire contents of each are incorporated herein by reference.
The Cas9 protein recognizes a short motif (PAM motif) within the target DNA sequence, which is required for the Cas9-DNA interaction but that is not determined by complementarity to the guide RNA nucleotide sequence. A “PAM motif” or “protospacer adjacent motif,” as used herein, refers to a DNA sequence adjacent to the 5′- or 3′-immediately following the DNA sequence that is complementary to the guide RNA oligonucleotide sequence. Cas9 will not successfully bind to, cleave, or nick the target DNA sequence if it is not followed by an appropriate PAM sequence. Without wishing to be bound by any particular theory, specific amino acid residues in the Cas9 enzyme are responsible for interacting with the bases of the PAM and determine the PAM specificity. Therefore, changes in these residues or nearby residues leads to a different or relaxed PAM specificity. Changing or relaxing the PAM specificity may shift the places where Cas9 can bind, as will be apparent to those of skill in the art based on the instant disclosure.
Wild-type Streptococcus pyogenes Cas9 recognizes a canonical PAM sequence (5′-NGG-3′). Other Cas9 nucleases (e.g., Cas9 from Streptococcus thermophiles, Staphylococcus aureus, Neisseria meningitidis, or Treponema denticolaor) and Cas9 variants thereof have been described in the art to have different, or more relaxed PAM requirements. For example, in Kleinstiver et al., Nature 523, 481-485, 2015; Klenstiver et al., Nature 529, 490-495, 2016; Ran et al., Nature, April 9; 520(7546): 186-191, 2015; Kleinstiver et al., Nat Biotechnol, 33(12):1293-1298, 2015; Hou et al., Proc Natl Acad Sci USA, 110(39):15644-9, 2014; Prykhozhij et al., PLoS One, 10(3): e0119372, 2015; Zetsche et al., Cell 163, 759-771, 2015; Gao et al., Nature Biotechnology, doi:10.1038/nbt.3547, 2016; Want et al., Nature 461, 754-761, 2009; Chavez et al., doi: dx.doi dot org/10.1101/058974; Fagerlund et al., Genome Biol. 2015; 16: 25, 2015; Zetsche et al., Cell, 163, 759-771, 2015; and Swarts et al., Nat Struct Mol Biol, 21(9):743-53, 2014, each of which is incorporated herein by reference.
Thus, the guide nucleotide sequence-programmable DNA-binding protein of the present disclosure may recognize a variety of PAM sequences including, without limitation PAM sequences that are on the 3′ or the 5′ end of the DNA sequence determined by the guide RNA. For example, the sequence may be: NGG, NGAN (SEQ ID NO: 741), NGNG (SEQ ID NO: 742), NGAG (SEQ ID NO: 743), NGCG (SEQ ID NO: 744), NNGRRT (SEQ ID NO: 745), NGRRN (SEQ ID NO: 746), NNNRRT (SEQ ID NO: 747), NNNGATT (SEQ ID NO: 748), NNAGAAW (SEQ ID NO: 749), NAAAC (SEQ ID NO: 750), TTN, TTTN (SEQ ID NO: 751), and YTN, wherein Y is a pyrimidine, R is a purine, and N is any nucleobase.
Some aspects of the disclosure provide RNA-programmable DNA binding proteins, which may be used to guide a protein, such as a base editor, to a specific nucleic acid (e.g., DNA or RNA) sequence. Nucleic acid programmable DNA binding proteins include, without limitation, Cas9 (e.g., dCas9 and nCas9), CasX, CasY, Cpf1, C2c1, C2c2, C2C3, and Argonaute. One example of an RNA-programmable DNA-binding protein that has different PAM specificity is Clustered Regularly Interspaced Short Palindromic Repeats from Prevotella and Francisella 1 (Cpf1). Similar to Cas9, Cpf1 is also a class 2 CRISPR effector. It has been shown that Cpf1 mediates robust DNA interference with features distinct from Cas9. Cpf1 is a single RNA-guided endonuclease lacking tracrRNA, and it may utilize a T-rich protospacer-adjacent motif (e.g., TTN, TTTN (SEQ ID NO: 751), or YTN), which is on the 5′-end of the DNA sequence determined by the guide RNA. Moreover, Cpf1 cleaves DNA via a staggered DNA double-stranded break. Out of 16 Cpf1-family proteins, two enzymes from Acidaminococcus and Lachnospiraceae are shown to have efficient genome-editing activity in human cells. Cpf1 proteins are known in the art and have been described previously, for example Yamano et al., “Crystal structure of Cpf1 in complex with guide RNA and target DNA.” Cell (165) 2016, p. 949-962; the entire contents of which is hereby incorporated by reference.
Also useful in the present compositions and methods are nuclease-inactive Cpf1 (dCpf1) variants that may be used as a guide nucleotide sequence-programmable DNA-binding protein domain. The Cpf1 protein has a RuvC-like endonuclease domain that is similar to the RuvC domain of Cas9 but does not have a HNH endonuclease domain, and the N-terminal of Cpf1 does not have the alfa-helical recognition lobe of Cas9. It was shown in Zetsche et al., Cell, 163, 759-771, 2015 (which is incorporated herein by reference) that, the RuvC-like domain of Cpf1 is responsible for cleaving both DNA strands and inactivation of the RuvC-like domain inactivates Cpf1 nuclease activity. For example, mutations corresponding to D917A, E1006A, or D1255A in Francisella novicida Cpf1 (SEQ ID NO: 714) inactivate Cpf1 nuclease activity. In some embodiments, the dCpf1 of the present disclosure may comprise mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or D917A/E1006A/D1255A in SEQ ID NO: 714. In other embodiments, the Cpf1 nickase of the present disclosure may comprise mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or D917A/E1006A/D1255A in SEQ ID NO: 714. A Cpf1 nickase useful for the embodiments of the instant disclosure may comprise other mutations and/or further mutations known in the field. It is to be understood that any mutations, e.g., substitution mutations, deletions, or insertions that fully or partially inactivates the RuvC domain of Cpf1 may be used in accordance with the present disclosure, and that these mutations of Cpf1 may result in, for example, a dCpf1 or Cpf1 nickase.
Thus, in some embodiments, the guide nucleotide sequence-programmable DNA binding protein is a nuclease inactive Cpf1 (dCpf1). In some embodiments, the dCpf1 comprises an amino acid sequence of any one SEQ ID NOs: 714-717. In some embodiments, the dCpf1 comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at ease 99.5% identical to any one of SEQ ID NOs: 714-717, and comprises mutations corresponding to D917A, E1006A, D1255A, D917A/E1006A, D917A/D1255A, E1006A/D1255A, or D917A/E1006A/D1255A in SEQ ID NO: 714. Cpf1 from other bacterial species may also be used in accordance with the present disclosure, as a dCpf1 or Cpf1 nickase.
Francisella novicida Cpf1 D917A
Francisella novicida Cpf1 E1006A
Francisella novicida Cpf1 D1255A
In addition to Cas9 and Cpf1, three distinct Class 2 CRISPR-Cas systems (C2c1, C2c2, and C2c3) have been described by Shmakov et al., “Discovery and Functional Characterization of Diverse Class 2 CRISPR Cas Systems”, Mol. Cell, 2015 Nov. 5; 60(3): 385-397, the entire contents of which is hereby incorporated by reference. Effectors of two of the systems, C2c1 and C2c3, contain RuvC-like endonuclease domains related to Cpf1. A third system, C2c2 contains an effector with two predicated HEPN RNase domains. Production of mature CRISPR RNA is tracrRNA-independent, unlike production of CRISPR RNA by C2c1. C2c1 depends on both CRISPR RNA and tracrRNA for DNA cleavage. Bacterial C2c2 has been shown to possess a unique RNase activity for CRISPR RNA maturation distinct from its RNA-activated single-stranded RNA degradation activity. These RNase functions are different from each other and from the CRISPR RNA-processing behavior of Cpf1. See, e.g., East-Seletsky, et al., “Two distinct RNase activities of CRISPR-C2c2 enable guide-RNA processing and RNA detection”, Nature, 2016 Oct. 13; 538(7624):270-273, the entire contents of which are hereby incorporated by reference. In vitro biochemical analysis of C2c2 in Leptotrichia shahii has shown that C2c2 is guided by a single CRISPR RNA and can be programmed to cleave ssRNA targets carrying complementary protospacers. Catalytic residues in the two conserved HEPN domains mediate cleavage. Mutations in the catalytic residues generate catalytically inactive RNA-binding proteins. See e.g., Abudayyeh et al., “C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector”, Science, 2016 Aug. 5; 353(6299), the entire contents of which are hereby incorporated by reference.
The crystal structure of Alicyclobaccillus acidoterrastris C2c1 (AacC2c1) has been reported in complex with a chimeric single-molecule guide RNA (sgRNA). See, e.g., Liu et al., “C2c1-sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism”, Mol. Cell, 2017 Jan. 19; 65(2):310-322, the entire contents of which are hereby incorporated by reference. The crystal structure has also been reported in Alicyclobacillus acidoterrestris C2c1 bound to target DNAs as ternary complexes. See, e.g., Yang et al., “PAM-dependent Target DNA Recognition and Cleavage by C2C1 CRISPR-Cas endonuclease”, Cell, 2016 Dec. 15; 167(7):1814-1828, the entire contents of which are hereby incorporated by reference. Catalytically competent conformations of AacC2c1, both with target and non-target DNA strands, have been captured independently positioned within a single RuvC catalytic pocket, with C2c1-mediated cleavage resulting in a staggered seven-nucleotide break of target DNA. Structural comparisons between C2c1 ternary complexes and previously identified Cas9 and Cpf1 counterparts demonstrate the diversity of mechanisms used by CRISPR-Cas9 systems.
In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein of any of the fusion proteins provided herein may be a C2c1, a C2c2, or a C2c3 protein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein is a C2c1 protein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein is a C2c2 protein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein is a C2c3 protein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to a naturally-occurring C2c1, C2c2, or C2c3 protein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein is a naturally-occurring C2c1, C2c2, or C2c3 protein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein comprises an amino acid sequence that is at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or at least 99.5% identical to any of the C2c1, C2c2, or C2c3 proteins described herein. In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein comprises an amino acid sequence of any one of the C2c1, C2c2, or C2c3 proteins described herein. It should be appreciated that C2c1, C2c2, or C2c3 from other bacterial species may also be used in accordance with the present disclosure.
acidoterrestris (strain ATCC 49025/DSM 3922/
Leptotrichiashahii (strain DSM 19757/CCUG 47503/
In some embodiments, the guide nucleotide sequence-programmable DNA-binding protein domain of the present disclosure has no requirements for a PAM sequence. One example of such a guide nucleotide sequence-programmable DNA-binding protein may be an Argonaute protein from Natronobacterium gregoryi (NgAgo). NgAgo is a ssDNA-guided endonuclease. NgAgo binds 5′ phosphorylated ssDNA of ˜24 nucleotides (gDNA) to guide it to its target site and will make DNA double-strand breaks at the gDNA site. In contrast to Cas9, the NgAgo-gDNA system does not require a protospacer-adjacent motif (PAM). Using a nuclease inactive NgAgo (dNgAgo) can greatly expand the codons that may be targeted. The characterization and use of NgAgo have been described in Gao et al., Nat Biotechnol., 2016 July; 34(7):768-73. PubMed PMID: 27136078; Swarts et al., Nature. 507(7491) (2014):258-61; and Swarts et al., Nucleic Acids Res. 43(10) (2015):5120-9, each of which is incorporated herein by reference. The sequence of Natronobacterium gregoryi Argonaute is provided in SEQ ID NO: 718.
Also provided herein are Cas9 variants that have relaxed PAM requirements (PAMless Cas9). PAMless Cas9 exhibits an increased activity on a target sequence that does not include a canonical PAM (e.g., NGG) sequence at its 3′-end as compared to Streptococcus pyogenes Cas9 as provided by SEQ ID NO: 1, e.g., increased activity by at least 5-fold, at least 10-fold, at least 50-fold, at least 100-fold, at least 500-fold, at least 1,000-fold, at least 5,000-fold, at least 10,000-fold, at least 50,000-fold, at least 100,000-fold, at least 500,000-fold, or at least 1,000,000-fold. Such Cas9 variants that have relaxed PAM requirements are described in US Provisional Application Ser. No. 62/245,828, filed Oct. 23, 2015; 62/279,346, filed Jan. 15, 2016; 62/311,763, filed Mar. 22, 2016; 62/322,178, filed Apr. 13, 2016; and 62/357,332, filed Jun. 30, 2016, each of which is incorporated herein by reference. In some embodiments, the dCas9 or Cas9 nickase useful in the present disclosure may further comprise mutations that relax the PAM requirements, e.g., mutations that correspond to A262T, K294R, S409I, E480K, E543D, M694I, or E1219V in SEQ ID NO: 1.
The “-” used in the general architecture discussed herein may indicate the presence of an optional linker. The term “linker,” as used herein, refers to a chemical group or a molecule linking two molecules or moieties, e.g., two domains of a fusion protein, such as, for example, a guide nucleotide sequence-programmable DNA binding protein domain and a recombinase catalytic domain. Typically, the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two. In some embodiments, the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein). In some embodiments, the linker is an organic molecule, group, polymer, or chemical moiety. In some embodiments, the linker is 5-100 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 30-35, 35-40, 40-45, 45-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-150, or 150-200 amino acids in length. Longer or shorter linkers are also contemplated. Linkers may be of any form known in the art. The linkers may also be unstructured, structured, helical, or extended.
In some embodiments, the guide nucleotide sequence-programmable DNA binding protein domain and the recombinase catalytic domain are fused to each other via a linker. Various linker lengths and flexibilities between the guide nucleotide sequence-programmable DNA binding protein domain and the recombinase catalytic domain can be employed (e.g., ranging from flexible linkers of the form (GGGS)n (SEQ ID NO: 759), (GGGGS)n (SEQ ID NO: 722), (GGS)n, and (G)n to more rigid linkers of the form (EAAAK)n (SEQ ID NO: 723), SGSETPGTSESATPES (SEQ ID NO: 724) (see, e.g., Guilinger et al., Nat. Biotechnol. 2014; 32(6): 577-82; the entire contents of which is incorporated herein by reference), (XP)n, or a combination of any of these, wherein X is any amino acid, and n is independently an integer between 1 and 30, in order to achieve the optimal length for activity for the specific application. In some embodiments, n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30, or, if more than one linker or more than one linker motif is present, any combination thereof. In some embodiments, the linker comprises a (GGS)n motif, wherein n is 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 or 15. In some embodiments, the linker comprises a (GGS)n motif, wherein n is 1, 3, or 7. In some embodiments, the linker comprises an XTEN linker. The XTEN linker may have the sequence SGSETPGTSESATPES (SEQ ID NO: 7), SGSETPGTSESA (SEQ ID NO: 8), or SGSETPGTSESATPEGGSGGS (SEQ ID NO: 9). In some embodiments, the linker comprises an amino acid sequence chosen from the group including, but not limited to, AGVF (SEQ ID NO: 772), GFLG (SEQ ID NO: 773), FK, AL, ALAL (SEQ ID NO: 774), and ALALA (SEQ ID NO: 775). In some embodiments, suitable linker motifs and configurations include those described in Chen et al., Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. 2013; 65(10):1357-69, which is incorporated herein by reference. In some embodiments, the linker may comprise any of the following amino acid sequences: VPFLLEPDNINGKTC (SEQ ID NO: 10), GSAGSAAGSGEF (SEQ ID NO: 11), SIVAQLSRPDPA (SEQ ID NO: 12), MKIIEQLPSA (SEQ ID NO: 13), VRHKLKRVGS (SEQ ID NO: 14), GHGTGSTGSGSS (SEQ ID NO: 15), MSRPDPA (SEQ ID NO: 16), GSAGSAAGSGEF (SEQ ID NO: 7), SGSETPGTSESA (SEQ ID NO: 8), SGSETPGTSESATPEGGSGGS (SEQ ID NO: 9), and GGSM (SEQ ID NO: 17).
Additional suitable linker sequences will be apparent to those of skill in the art based on the instant disclosure. In certain embodiments, the linker may have a length of about 33 angstroms to about 81 angstroms. In another embodiment, the linker may have a length of about 54 angstroms to about 81 angstroms. In a further embodiment, the linker may have a length of about 63 to about 81 angstroms. In another embodiment, the linker may have a length of about 65 angstroms to about 75 angstroms. In some embodiments, the linker may have a weight of about 1.20 kDa to about 1.85 kDa. In certain embodiments, the linker may have a weight of about 1.40 kDa to about 1.85 kDa. In certain embodiments, the linker may have a weight of about 1.60 kDa to about 1.7 kDa. In some embodiments, the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein). In some embodiments, the linker is an organic molecule, group, polymer, or chemical moiety. In some embodiments, the linker is a peptide linker. In some embodiments, the peptide linker is any stretch of amino acids having at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 15, at least 20, at least 25, at least 30, at least 40, at least 50, or more amino acids. In certain embodiments, the peptide linker is from 18 to 27 amino acids long. In a specific embodiment, the peptide linker is 24 amino acids long. In some embodiments, the peptide linker comprises repeats of the tri-peptide Gly-Gly-Ser, e.g., comprising the sequence (GGS)., wherein n represents at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more repeats. In some embodiments, the linker comprises the sequence (GGS)6 (SEQ ID NO: 6). In some embodiments, the peptide linker is the 16 residue “XTEN” linker, or a variant thereof (See, e.g., the Examples; and Schellenberger et al. A recombinant polypeptide extends the in vivo half-life of peptides and proteins in a tunable manner. Nat. Biotechnol. 27, 1186-1190 (2009)). In some embodiments, the XTEN linker comprises the sequence SGSETPGTSESATPES (SEQ ID NO: 7), SGSETPGTSESA (SEQ ID NO: 8), or SGSETPGTSESATPEGGSGGS (SEQ ID NO: 9). In some embodiments, the peptide linker is selected from VPFLLEPDNINGKTC (SEQ ID NO: 10), GSAGSAAGSGEF (SEQ ID NO: 11), SIVAQLSRPDPA (SEQ ID NO: 12), MKIIEQLPSA (SEQ ID NO: 13), VRHKLKRVGS (SEQ ID NO: 14), GHGTGSTGSGSS (SEQ ID NO: 15), MSRPDPA (SEQ ID NO: 16); or GGSM (SEQ ID NO: 17). In some embodiments, the linker is a non-peptide linker. In certain embodiments, the non-peptide linker comprises one or more of polyethylene glycol (PEG), polypropylene glycol (PPG), co-poly(ethylene/propylene) glycol, polyoxyethylene (POE), polyurethane, polyphosphazene, polysaccharides, dextran, polyvinyl alcohol, polyvinylpyrrolidones, polyvinyl ethyl ether, polyacryl amide, polyacrylate, polycyanoacrylates, lipid polymers, chitins, hyaluronic acid, heparin, or an alkyl linker. In one embodiment, the alkyl linker has the formula —NH—(CH2)s—C(O)—, wherein s may be any integer. In a further embodiment, s may be any integer from 1-20.
Recombinase Catalytic Domain
The recombinase catalytic domain for use in the compositions and methods of the instant disclosure may be from any recombinase. Suitable recombinases catalytic domains for use in the disclosed methods and compositions may be obtained from, for example, and without limitation, tyrosine recombinases and serine recombinases. Some exemplary suitable recombinases provided herein include, for example, and without limitation, Gin recombinase (acting on gix sites), Hin recombinase (acting on hix sites), β recombinase (acting on six sites), Sin recombinase (acting on resH sites), Tn3 recombinase (acting on res sites), γδ recombinase (acting on res sites), Cre recombinase from bacteriophage P1 (acting on LoxP sites); FLP recombinases of fungal origin (acting on FTR sites); and phiC31 integrase (acting on att sites). Non-limiting sequences of exemplary suitable recombinases may be found below.
Recombinases for use with the disclosed compositions and methods may also include further mutations. Some aspects of this disclosure provide recombinases comprising an amino acid sequence that is at least 70%, at least 80%, at least 90%, at least 95%, or at least 97% identical to the sequence of the recombinase sequence discussed herein, wherein the amino acid sequence of the recombinase comprises at least one mutation as compared to the sequence of the recombinase sequence discussed herein. In some embodiments, the amino acid sequence of the recombinase comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, or at least 15 mutations as compared to the sequence of the recombinase sequence discussed herein.
For example, the γδ recombinase may comprise one or more mutations from the list: R2A, E56K, G1015, E102Y, M1031, or E124Q. In one embodiment, the γδ recombinase may comprise an E102Y mutation, an E124Q mutation, or both an E102Y and E124Q mutation. In another embodiment, the β recombinase may comprise one or more mutations including, but not limited to N95D. See, for example, Sirk et al., “Expanding the zinc-finger recombinase repertoire: directed evolution and mutational analysis of serine recombinase specificity determinants” Nucl Acids Res (2014) 42 (7): 4755-4766. In another embodiment, the Sin recombinase may have one or more mutations including, but not limited to: Q87R, Q115R, or Q87R and Q115R. In another embodiment, the Tn3 recombinase may have one or more mutations including, but not limited to: G705, D102Y, E124Q, and any combination thereof. In another embodiment, the Hin recombinase may have one or more mutations including, but not limited to: H107Y. In another embodiment, the Sin recombinase may have one or more mutations including, but not limited to: H107Y. Any of the recombinase catalytic domains for use with the disclosed compositions and methods may have greater than 85%, 90%, 95%, 98%, or 99% sequence identity with the native (or wild type) amino acid sequence. For example, in certain embodiments, the Gin recombinase catalytic domain has greater than 85%, 90%, 95%, 98%, or 99% sequence identity with the amino acid sequence shown in SEQ ID NO: 713. In another embodiment, the amino acid sequence of the Gin recombinase catalytic domain comprises a mutation corresponding to H106Y, and/or I127L, and/or I136R and/or G137F. In yet another embodiment, the amino acid sequence of the Gin recombinase catalytic domain comprises a mutation corresponding to H106Y, I127L, I136R, and G137F. In a further embodiment, the amino acid sequence of the Gin recombinase has been further mutated. In a specific embodiment, the amino acid sequence of the Gin recombinase catalytic domain comprises SEQ ID NO: 713.
The recombinase catalytic domain for use in the compositions and methods of the instant disclosure may be from an evolved recombinase. As used herein, the term “evolved recombinase” refers to a recombinase that has been altered (e.g., through mutation) to recognize non-native DNA target sequences.
Suitable recombinases that can be evolved include, for example, and without limitation, tyrosine recombinases and serine recombinases (e.g., any of the recombinases discussed herein). Some exemplary suitable recombinases that can be evolved by the methods and strategies provided herein include, for example, and without limitation, Gin recombinase (acting on gix sites), Hin recombinase (acting on hix sites), β recombinase (acting on six sites), Sin recombinase (acting on resH sites), Tn3 recombinase (acting on res sites), γδ recombinase (acting on res sites), Cre recombinase from bacteriophage P1 (acting on LoxP sites); λ phage integrase (acting on att sites); FLP recombinases of fungal origin (acting on FTR sites); phiC31 integrase; Dre recombinase, BxB 1; and prokaryotic β-recombinase.
For example, the evolved recombinase for use with the compositions and methods of the instant disclosure may have been altered to interact with (e.g., bind and recombine) a non-canonical recombinase target sequence. As a non-limiting example, the non-canonical recombinase target sequence may be naturally occurring, such as, for example, sequences within a “safe harbor” genomic locus in a mammalian genome, e.g., a genomic locus that is known to be tolerant to genetic modification without any undesired effects. Recombinases targeting such sequences allow, e.g., for the targeted insertion of nucleic acid constructs at a specific genomic location without the need for conventional time- and labor-intensive gene targeting procedures, e.g., via homologous recombination technology. In addition, the directed evolution strategies provided herein can be used to evolve recombinases with an altered activity profile, e.g., recombinases that favor integration of a nucleic acid sequence over excision of that sequence or vice versa.
Evolved recombinases exhibit altered target sequence preferences as compared to their wild type counterparts, can be used to target virtually any target sequence for recombinase activity. Accordingly, the evolved recombinases can be used to modify, for example, any sequence within the genome of a cell or subject. Because recombinases can effect an insertion of a heterologous nucleic acid molecule into a target nucleic acid molecule, an excision of a nucleic acid sequence from a nucleic acid molecule, an inversion, or a replacement of nucleic acid sequences, the technology provided herein enables the efficient modification of genomic targets in a variety of ways (e.g., integration, deletion, inversion, exchange of nucleic acid sequences).
Catalytic domains from evolved recombinases for use with the methods and compositions of the instant disclosure comprise an amino acid sequence that is at least 70%, at least 80%, at least 90%, at least 95%, or at least 97% identical to the sequence of a wild-type recombinase, wherein the amino acid sequence of the evolved recombinase comprises at least one mutation as compared to the sequence of the wild-type recombinase, and wherein the evolved recombinase recognizes a DNA recombinase target sequence that differs from the canonical recombinase target sequence by at least one nucleotide. In some embodiments, the evolved recombinase recognizes a DNA recombinase target sequence that differs from the canonical recombinase target sequence (e.g., a res, gix, hix, six, resH, LoxP, FTR, or att core or related core sequence) by at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20 at least 25, or at least 30 nucleotides. In some embodiments, the evolved recombinase recognizes a DNA recombinase target sequence that differs from the canonical recombinase target sequence by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides.
In some embodiments, only a portion of the recombinase is used in the fusion proteins and methods described herein. As a non-limiting embodiment, only the C-terminal portion of the recombinase may be used in the fusion proteins and methods described herein. In a specific embodiment, the 25 kDa carboxy-terminal domain of Cre recombinase may be used in the compositions and methods. See, for example, Hoess et al, “DNA Specificity of the Cre Recombinase Resides in the 25 kDa Carboxyl Domain of the Protein,” J. Mol. Bio. 1990 Dec. 20, 216(4):873-82, which is incorporated by reference herein for all purposes. The 25 kDa carboxy-terminal domain of Cre recombinase is the portion stretching from R118 to the carboxy terminus of the protein. In some embodiments, the 25 kDa carboxy-terminal domain of Cre recombinase for use in the instant fusion proteins and methods may differ from the canonical 25 kDa carboxy-terminal domain of Cre recombinase by at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, or at least 20 amino acids. In some embodiments, the 25 kDa carboxy-terminal domain of Cre recombinase for use in the instant fusion proteins and methods may differ from the canonical 25 kDa carboxy-terminal domain of Cre recombinase by 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 amino acids. In certain embodiments, only a portion of the 25 kDa carboxy-terminal domain of Cre recombinase may be used in the fusion proteins and methods described herein. For example, the portion of Cre recombinase used may be R130 to the carboxy terminus of the protein, T140 to the carboxy terminus of the protein, E150 to the carboxy terminus of the protein, N160 to the carboxy terminus of the protein, T170 to the carboxy terminus of the protein, 1180 to the carboxy terminus of the protein, G190 to the carboxy terminus of the protein, T200 to the carboxy terminus of the protein, E210 to the carboxy terminus of the protein, L220 to the carboxy terminus of the protein, V230 to the carboxy terminus of the protein, C240 to the carboxy terminus of the protein, P250 to the carboxy terminus of the protein, A260 to the carboxy terminus of the protein, R270 to the carboxy terminus of the protein, G280 to the carboxy terminus of the protein, S290 to the carboxy terminus of the protein, A300 to the carboxy terminus of the protein, or M310 to the carboxy terminus of the protein. As another set of non-limiting examples, the portion of Cre recombinase used may be R118-E340, R118-5330, R1184320, R118-M310, R118-A300, R118-S290, R118-G280, R118-R270, R118-A260, R118-P250, R118-C240, R118-V230, R118-L220, or R118-E210. As a further set of non-limiting examples, the portion of Cre recombinase used may be R118-E210, G190-R270, E210-5290, P250-M310, or R270 to the carboxy terminus of the protein.
In some embodiments, the Cre recombinase used in the fusion proteins and methods described herein may be truncated at any position. In a specific embodiment, the Cre recombinase used in the fusion proteins and methods described herein may be truncated such that it begins with amino acid R118, A127, E138, or R154) (preceded in each case by methionine). In another set of non-limiting embodiments, the Cre recombinase used in the fusion proteins and methods described herein may be truncated within 10 amino acids, 9 amino acids, 8 amino acids, 7 amino acids, 6 amino acids, 5 amino acids, 4 amino acids, 3 amino acids, 2 amino acids, or 1 amino acid of R118, A127, E138, or R154.
In some embodiments, the recombinase target sequence is between 10-50 nucleotides long. In some embodiments, the recombinase is a Cre recombinase, a Hin recombinase, or a FLP recombinase. In some embodiments, the canonical recombinase target sequence is a LoxP site (5′-ATAACTTCGTATA GCATACAT TATACGAAGTTAT-3′ (SEQ ID NO: 739). In some embodiments, the canonical recombinase target sequence is an FRT site (5′-GAAGTTCCTATTCTCTAGAAA GTATAGGAACTTC-3′) (SEQ ID NO: 740). In some embodiments, the amino acid sequence of the evolved recombinase comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, or at least 15 mutations as compared to the sequence of the wild-type recombinase. In some embodiments, the evolved recombinase recognizes a DNA recombinase target sequence that comprises a left half-site, a spacer sequence, and a right half-site, and wherein the left half-site is not a palindrome of the right half-site.
In some embodiments, the evolved recombinase recognizes a DNA recombinase target sequence that comprises a naturally occurring sequence. In some embodiments, the evolved recombinase recognizes a DNA recombinase target sequence that is comprised in the genome of a mammal. In some embodiments, the evolved recombinase recognizes a DNA recombinase target sequence comprised in the genome of a human. In some embodiments, the evolved recombinase recognizes a DNA recombinase target sequence that occurs only once in the genome of a mammal. In some embodiments, the evolved recombinase recognizes a DNA recombinase target sequence in the genome of a mammal that differs from any other site in the genome by at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, or at least 15 nucleotide(s). In some embodiments, the evolved recombinase recognizes a DNA recombinase target sequence located in a safe harbor genomic locus. In some embodiments, the safe harbor genomic locus is a Rosa26 locus. In some embodiments, the evolved recombinase recognizes a DNA recombinase target sequence located in a genomic locus associated with a disease or disorder.
In certain embodiments, the evolved recombinase may target a site in the Rosa locus of the human genome (e.g., 36C6). A non-limiting set of such recombinases may be found, for example, in International PCT Publication, WO 2017/015545A1, published Jan. 26, 2017, entitled “Evolution of Site Specific Recombinases,” which is incorporated by reference herein for this purpose. In some embodiments, the amino acid sequence of the evolved recombinase comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, or at least 15 mutations as compared to the sequence of the wild-type recombinase. The nucleotide sequence encoding 36C6 is shown below in bold; those encoding GGS linkers are shown in italics; those encoding dCas9 linkers are black; those encoding the FLAG tag and NLS are underlined and in lowercase, respectively.
ATGTCCAACCTCCTTACCGTCCACCAGAATCTCCCTGCCCTTCCGGTGGATGCCACCTCTGATGAAGTGCGAAAA
AACCTGATGGATATGTTTCGCGATAGGCAAGCTTTTTCTGAACACACGTGGAAGATGCTCCTGTCAGTGTGTAGA
AGCTGGGCAGCTTGGTGCAAGTTGAACAACCGAAAATGGTTTCCTGCCGAACCCGAAGATGTGAGAGACTACCTC
CTCTACCTGCAGGCTCGAGGGCTCGCCGTGAAAACAATCCAACAACACTTGGGTCAGCTCAACATGCTGCACAGG
AGATCTGGGCTGCCCCGGCCGAGTGACTCTAATGCCGTTAGTCTCGTAATGCGGCGCATTCGCAAAGAGAATGTG
GATGCTGGAGAACGGGCGAAACAGGCACTGGCTTTTGAACGGACCGACTTCGATCAGGTGCGGAGTCTTATGGAG
AATAGTGACAGATGCCAGGACATTCGGAACCTTGCATTCCTGGGTATCGCGTATAATACCCTGCTGAGAATCGCT
GAGATCGCCAGAATCAGGGTAAAGGATATTTCTCGAACGGACGGGGGACGGATGTTGATTCATATCGGTCGCACT
AAAACACTTGTGAGTACCGCCGGGGTAGAGAAAGCCCTGAGCCTTGGAGTTACTAAACTGGTGGAGCGGTGGATT
AGCGTGTCCGGCGTGGCGGATGACCCAAACAATTACTTGTTTTGTAGGGTGCGGAAAAATGGTGTAGCCGCTCCA
TCCGCTACCTCACAGTTGAGTACACGCGCGTTGGAGGGGATTTTCGAAGCCACACATCGCTTGATCTACGGCGCC
AAGGACGATTCAGGCCAGCGATATCTTGCCTGGAGCGGGCATAGTGCCCGGGTGGGTGCCGCCCGAGACATGGCA
AGGGCTGGCGTGTCAATTCCTGAAATCATGCAGGCCGGCGGGTGGACCAACGTGAACATTGTGATGAACTATATC
CGGAACCTGGATAGCGAGACCGGAGCAATGGTCAGACTGCTTGAGGATGGCGAC
GGTGGATCCGGAGGGTCCGGA
GGTAGTGGCGGCAGCGGTGGTTCAGGTGGCAGCGGAGGGTCAGGAGGCTCTGATAAAAAGTATTCTATTGGTTTA
MSNLLTVHQNLPALPVDATSDEVRKNLMDMFRDRQAFSEHTWKMLLSVCRSWAAWCKLNNRKWFPAEPEDVRDYL
LYLQARGLAVKTIQQHLGQLNMLHRRSGLPRPSDSNAVSLVMRRIRKENVDAGERAKQALAFERTDFDQVRSLME
NSDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHIGRTKTLVSTAGVEKALSLGVTKLVERWI
SVSGVADDPNNYLFCRVRKNGVAAPSATSQLSTRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMA
RAGVSIPEIMQAGGWTNVNIVMNYIRNLDSETGAMVRLLEDGD
GGSGGSGGSGGSGGSGGSGGSGGSDKKYSIGL
Some aspects of this disclosure provide evolved recombinases (e.g., a Cre recombinase) comprising an amino acid sequence that is at least 70%, at least 80%, at least 90%, at least 95%, or at least 97% identical to the sequence of the recombinase sequence (e.g., a Cre recombinase) discussed herein, wherein the amino acid sequence of the recombinase (e.g., a Cre recombinase) comprises at least one mutation as compared to the sequence of the recombinase (e.g., a Cre recombinase) sequence discussed herein, and wherein the recombinase (e.g., a Cre recombinase) recognizes a DNA recombinase target sequence that differs from the canonical LoxP site 5′-ATAACTTCGTATA GCATACAT TATACGAAGTTAT-3′ (SEQ ID NO: 739) in at least one nucleotide.
In some embodiments, the amino acid sequence of the evolved recombinase (e.g., a Cre recombinase) comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, or at least 15 mutations as compared to the sequence of the recombinase (e.g., a Cre recombinase) sequence discussed herein and recognizes a DNA recombinase target sequence that differs from the canonical target site (e.g., a LoxP site) in at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, or at least 15 nucleotides.
In some embodiments, the evolved Cre recombinase recognizes a DNA recombinase target sequence that comprises a left half-site, a spacer sequence, and a right half-site, wherein the left half-site is not a palindrome of the right half-site. In some embodiments, the evolved Cre recombinase recognizes a DNA recombinase target sequence that comprises a naturally occurring sequence. In some embodiments, the evolved Cre recombinase recognizes a DNA recombinase target sequence that is comprised in the genome of a mammal.
In some embodiments, the evolved Cre recombinase recognizes a DNA recombinase target sequence that is comprised in the genome of a human. In some embodiments, the evolved Cre recombinase recognizes a DNA recombinase target sequence that is comprised only once in the genome of a mammal. In some embodiments, the evolved Cre recombinase recognizes a DNA recombinase target sequence in the genome of a mammal that differs from any other site in the genome by at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, or at least 15 nucleotide(s). In some embodiments, the evolved Cre recombinase recognizes a DNA recombinase target sequence located in a safe harbor genomic locus. In some embodiments, the safe harbor genomic locus is a Rosa26 locus. In some embodiments, the evolved Cre recombinase recognizes a DNA recombinase target sequence located in a genomic locus associated with a disease or disorder.
Additional evolved recombinases (and methods for making the same) for use with the instant methods and compositions may be found in, for example, U.S. patent application Ser. No. 15/216,844, which is incorporated herein by reference.
Additional suitable recombinases will be apparent to those of skill in the art for both providing recombinase catalytic domains or evolved recombinase catalytic domains, and such suitable recombinases include, without limitation, those disclosed in Hirano et al., Site-specific recombinases as tools for heterologous gene integration. Appl Microbiol Biotechnol. 2011 October; 92(2):227-39; Fogg et al., New applications for phage integrases. J Mol Biol. 2014 Jul. 29; 426(15):2703; Brown et al., Serine recombinases as tools for genome engineering. Methods. 2011 April; 53(4):372-9; Smith et al., Site-specific recombination by phiC31 integrase and other large serine recombinases. Biochem Soc Trans. 2010 April; 38(2):388-94; Grindley et al., Mechanisms of site-specific recombination. Annu Rev Biochem. 2006; 75:567-605; Smith et al., Diversity in the serine recombinases. Mol Microbiol. 2002 April; 44(2):299-307; Grainge et al., The integrase family of recombinase: organization and function of the active site. Mol Microbiol. 1999 August; 33(3):449-56; Gopaul et al., Structure and mechanism in site-specific recombination. Curr Opin Struct Biol. 1999 February; 9(1):14-20; Cox et al., Conditional gene expression in the mouse inner ear using Cre-loxP. J Assoc Res Otolaryngol. 2012 June; 13(3):295-322; Birling et al., Site-specific recombinases for manipulation of the mouse genome. Methods Mol Biol. 2009; 561:245-63; and Mishina M, Sakimura K. Conditional gene targeting on the pure C57BL/6 genetic background. Neurosci Res. 2007 June; 58(2):105-12; the entire contents of each of which are incorporated herein by reference.
Structure of the Fusion Protein
The fusion protein of the instant instant disclosure may be any combination and order of the elements described herein. Exemplary fusion proteins include, but are not limited to, any of the following structures: NH2-[recombinase catalytic domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In another embodiment, the fusion protein has the structure NH2-[recombinase catalytic domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In another embodiment, the fusion protein has the structure NH2-[recombinase catalytic domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[affinity tag]-COOH. In another embodiment, the fusion protein has the structure NH2-[recombinase catalytic domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[NLS domain]-[linker sequence]-[affinity tag]-COOH.
In another embodiment, the fusion protein has the structure NH2-[recombinase catalytic domain]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[affinity tag]-COOH, NH2-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH, NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH, NH2-[affinity tag]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-COOH, NH2-[affinity tag]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[NLS domain]-COOH, or NH2-[affinity tag]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-COOH.
In another embodiment, the fusion protein has the structure: NH2-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In one embodiment, the fusion protein comprises the structure NH2-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In one embodiment, the fusion protein comprises the structure NH2-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[affinity tag]-COOH. In one embodiment, the fusion protein comprises the structure NH2-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[linker sequence]-[NLS domain]-[linker sequence]-[affinity tag]-COOH.
In another embodiment, the fusion protein has the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[NLS domain]-[linker sequence]-[affinity tag]-COOH.
In another embodiment, the fusion protein has the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[NLS domain]-[linker sequence]-[affinity tag]-COOH.
In another embodiment, the fusion protein has the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[NLS domain]-[linker sequence]-[affinity tag]-COOH.
In another embodiment, the fusion protein has the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[optional affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[affinity tag]-COOH. In another embodiment, the fusion protein comprises the structure NH2—[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[NLS domain]-[linker sequence]-[affinity tag]-COOH.
In one embodiment, the fusion protein has the structure NH2-[optional affinity tag]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In one embodiment, the fusion protein comprises the structure NH2-[optional affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In one embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In one embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[linker sequence]-[NLS domain]-[linker sequence]-[recombinase catalytic domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-COOH.
In one embodiment, the fusion protein has the structure NH2-[optional affinity tag]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-COOH. In one embodiment, the fusion protein comprises the structure NH2-[optional affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-COOH. In one embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-COOH. In one embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[linker sequence]-[NLS domain]-[linker sequence]-[guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-COOH.
In another embodiment, the fusion protein has the structure NH2-[optional affinity tag]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[optional affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[linker sequence]-[NLS domain]-[linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH.
In another embodiment, the fusion protein has the structure NH2-[optional affinity tag]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[optional affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[linker sequence]-[NLS domain]-[linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[optional linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH.
In another embodiment, the fusion protein has the structure NH2-[optional affinity tag]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[optional affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[linker sequence]-[NLS domain]-[linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[optional linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH.
In another embodiment, the fusion protein has the structure NH2-[optional affinity tag]-[optional linker sequence]-[optional NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[optional affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[optional linker sequence]-[NLS domain]-[optional linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH. In another embodiment, the fusion protein comprises the structure NH2-[affinity tag]-[linker sequence]-[NLS domain]-[linker sequence]-[N-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-[linker sequence]-[recombinase catalytic domain]-[linker sequence]-[C-terminal portion of a bifurcated or circularly permuted guide nucleotide sequence-programmable DNA binding protein domain]-COOH.
The fusion protein may further comprise one or more affinity tags. Suitable affinity tags provided herein include, but are not limited to, biotin carboxylase carrier protein (BCCP) tags, myc-tags, calmodulin-tags, FLAG-tags, hemagglutinin (HA)-tags, polyhistidine tags, also referred to as histidine tags or His-tags, polyarginine (poly-Arg) tags, maltose binding protein (MBP)-tags, nus-tags, glutathione-S-transferase (GST)-tags, green fluorescent protein (GFP)-tags, thioredoxin-tags, S-tags, Softags (e.g., Softag 1, Softag 3), strep-tags, biotin ligase tags, FlAsH tags, V5 tags, and SBP-tags. Additional suitable sequences will be apparent to those of skill in the art. The FLAG tag may have the sequence PKKKRKV (SEQ ID NO: 702). The one or more affinity tags are bound to the guide nucleotide sequence-programmable DNA binding protein domain, the recombinase catalytic domain, or the NLS domain via one or more third linkers. The third linker may be any peptide linker described herein. For example, the third linker may be a peptide linker.
As a non-limiting set of examples, the third linker may comprise an XTEN linker SGSETPGTSESATPES (SEQ ID NO: 7), SGSETPGTSESA (SEQ ID NO: 8), or SGSETPGTSESATPEGGSGGS (SEQ ID NO: 9), an amino acid sequence comprising one or more repeats of the tri-peptide GGS, or any of the following amino acid sequences: VPFLLEPDNINGKTC (SEQ ID NO: 10), GSAGSAAGSGEF (SEQ ID NO: 11), SIVAQLSRPDPA (SEQ ID NO: 12), MKIIEQLPSA (SEQ ID NO: 13), VRHKLKRVGS (SEQ ID NO: 14), GHGTGSTGSGSS (SEQ ID NO: 15), MSRPDPA (SEQ ID NO; 16), or GGSM (SEQ ID NO: 17). In certain embodiments, the third linker comprises one or more repeats of the tri-peptide GGS. In an embodiment, the third linker comprises from one to five repeats of the tri-peptide GGS. In another embodiment, the third linker comprises one repeat of the tri-peptide GGS. In a specific embodiment, the third linker has the sequence GGS.
The third linker may also be a non-peptide linker. In certain embodiments, the non-peptide linker comprises polyethylene glycol (PEG), polypropylene glycol (PPG), co-poly(ethylene/propylene) glycol, polyoxyethylene (POE), polyurethane, polyphosphazene, polysaccharides, dextran, polyvinyl alcohol, polyvinylpyrrolidones, polyvinyl ethyl ether, polyacryl amide, polyacrylate, polycyanoacrylates, lipid polymers, chitins, hyaluronic acid, heparin, or an alkyl linker. In other embodiments, the alkyl linker has the formula: —NH—(CH2)s—C(O)—, wherein s may be any integer between 1 and 100, inclusive. In a specific embodiment, s is any integer between 1 and 20, inclusive.
The fusion protein of the instant disclosure has greater than 90%, 95%, or 99% sequence identity with the amino acid sequence shown in amino acids 1-1544 of SEQ ID NO: 185, which is identical to the sequence shown in SEQ ID NO: 719.
MLIGYVRVSTNDQNTDLQRNALVCAGCEQIFEDKLSGTRTDRPGLKRALK
RLQKGDTLVVWKLDRLGRSMKHLISLVGELRERGINFRSLTDSIDTSSPM
GRFFFYVMGALAEMERELIIERTMAGLAAARNKGRRFGRPPK
GGSGGSGG
SGGSGGSGGSGGSGGSDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVL
In the context of proteins that dimerize (or multimerize) such as, for example, fusions between a nuclease-inactivated Cas9 (or a Cas9 gRNA binding domain) and a recombinase (or catalytic domain of a recombinase), a target site typically comprises a left-half site (bound by one protein), a right-half site (bound by the second protein), and a spacer sequence between the half sites in which the recombination is made. In some embodiments, either the left-half site or the right half-site (and not the spacer sequence) is recombined. In other embodiments, the spacer sequence is recombined. This structure ([left-half site]-[spacer sequence]-[right-half site]) is referred to herein as an LSR structure. In some embodiments, the left-half site and/or the right-half site correspond to an RNA-guided target site (e.g., a Cas9 target site). In some embodiments, either or both half-sites are shorter or longer than e.g., a typical region targeted by Cas9, for example shorter or longer than 20 nucleotides. In some embodiments, the left and right half sites comprise different nucleic acid sequences. In some embodiments, the spacer sequence is at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18, at least 19, at least 20, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 60, at least 70, at least 80, at least 90, at least 100, at least 125, at least 150, at least 175, at least 200, or at least 250 bp long. In some embodiments, the spacer sequence is between approximately 15 bp and approximately 25 bp long. In some embodiments, the spacer sequence is approximately 15 bp long. In some embodiments, the spacer sequence is approximately 25 bp long.
Materials and Methods
Oligonucleotides and PCR
All oligonucleotides were purchased from Integrated DNA Technologies (IDT, Coralville, Calif.) and are listed in Tables 1-5. Enzymes, unless otherwise noted, were purchased from New England Biolabs (Ipswich, Mass.). Plasmid Safe ATP-dependent DNAse was purchased from Epicentre (Madison, Wis.). All assembled vectors were transformed into One Shot Mach1-T1 phage-resistant chemically competent cells (Fisher Scientific, Waltham, Mass.). Unless otherwise noted, all PCR reactions were performed with Q5 Hot Start High-Fidelity 2× Master Mix. Phusion polymerse was used for circular polymerase extension cloning (CPEC) assemblies.
Reporter Construction
A five-piece Golden Gate assembly was used to construct reporters described below. Fragments 1-5 were flanked by Esp3I sites; Esp3I digestion created complementary 5′ overhangs specifying the order of fragment assembly (
Annealed fragments 1, 2, 4 and 5 were diluted 12,000 fold and 0.625 μl of each fragment were added to a mixture containing the following:
Reactions were incubated in thermal cycler programmed for 20 cycles (37° C. for 5 min, 20° C.).
After completion of the Golden Gate reactions, 7 μL of each reaction was mixed with 1 μL of ATP (10 mM), 1 μL of 10× Plasmid Safe ATP-dependent DNAse buffer (10×), and 1 μL of Plasmid Safe ATP-dependent DNAse (10 U/μL) (Epicentre, Madison, Wis.) to remove linear DNA and reduce background. DNAse digestions were incubated at 37° C. for 30 min and heat killed at 70° C. for 30 min. Half (5 μL) of each reaction was transformed into Mach1-T1 cells. Colonies were analyzed by colony PCR and sequenced.
The protocol was modified for reporters used in
Plasmids
Unless otherwise stated, DNA fragments were isolated from agarose gels using QIAquick Gel Extraction Kit (Qiagen, Valencia, Calif.) and further purified using DNA Clean & Concentrator-5 (Zymo Research, Irvine, Calif.) or Qiaquick PCR purification kit (Qiagen, Valencia, Calif.). PCR fragments not requiring gel purification were isolated using one of the kits listed above.
The pCALNL-GFP subcloning vector, pCALNL-EGFP-Esp3I, was used to clone all recCas9 reporter plasmids and was based on the previously described pCALNL-GFP vector (Matsuda and Cepko, Controlled expression of transgenes introduced by in vivo electroporation. Proceedings of the National Academy of Sciences of the United States of America 104, 1027-1032 (2007), which is incorporated herein by reference). To create pCALNL-EGFP-Esp3I, pCALNL-GFP vectors were digested with XhoI and MluI and gel purified to remove the loxP sites, the kanamycin resistance marker, and the poly-A terminator. Annealed oligonucleotides formed an EspI-Insert, that contained inverted Esp3I sites as well as XhoI and MluI compatible overhangs; this insert was ligated into the XhoI and MluI digested plasmid and transformed.
pCALNL-GFP recCas9 reporter plasmids were created by Golden Gate assembly with annealed oligos and PCR products containing compatible Esp3I overhangs. Golden Gate reactions were set up and performed as described previously with Esp3I (ThermoFisher Scientific, Waltham, Mass.) (Sanjana et al., A transcription activator-like effector toolbox for genome engineering. Nature protocols 7, 171-192 (2012), the entire contents of which is hereby incorporated by reference).
CCTCTGTTTGGGAAAATTG
GGGAGTCGAGTCGGATTTGATCTGATCAAGA
GTTCTCCGGCCGCTTGGGTGGAGAGGCTATTCGGCTATGACTGGGCACAA
CAGACAATCGGCTGCTCTGATGCCGCCGTGTTCCGGCTGTCAGTCGCAGG
GGCGCCCGGTTCTTTTTGTCAAGACCGACCTGTCCGGTGCCCTGAATGAA
CTGCAGGACGAGGCAGCGCGGCTATCGTGGCTGGCCACGACGGGCGTTCC
TTGCGCAGCTGTGCTCGACGTTGTCACTGAAGCGGGAAGGGACTGGCTGC
TATTGGGCGAAGTGCCGGGGCAGGATCTCCTGTCATCTCACCTTGCTCCT
GCCGAGAAAGTATCCATCATGGCTGATGCAATGCGGCGGCTGCATACGCT
TGATCCGGCTACCTGCCCATTCGACCACCAAGCGAAACATCGCATCGAGC
GAGCACGTACTCGGATGGAAGCCGGTCTTGTCGATCAGGATGATCTGGAC
GAAGAGCATCAGGGGCTCGCGCCAGCCGAACTGTTCGCCAGGCTCAAGGC
GCGCATGCCCGACGGCGAGGATCTCGTCGTGACCCATGGCGATGCCTGCT
TGCCGAATATCATGGTGGAAAATGGCCGCTTTTCTGGATTCATCGACTGT
GGCCGGCTGGGTGTGGCGGACCGCTATCAGGACATAGCGTTGGCTACCCG
TGATATTGCTGAAGAGCTTGGCGGCGAATGGGCTGACCGCTTCCTCGTGC
TTTACGGTATCGCCGCTCCCGATTCGCAGCGCATCGCCTTCTATCGCCTT
CTTGACGAGTTCTTCTGA
GCGGGACTCTGGGGTTCGAAATGACCGACCAA
TTGTTTATTGCAGCTTATAATGGTTACAAATAAAGCAATAGCATCACAAA
TTTCACAAATAAAGCATTTTTTTCACTGCATTCTAGTTGTGGTTTGTCCA
AACTCATCAATGTATCTTATC
ATGTCTGGATCAAATCCGAACGCACCCCC
AATTTTCCCAAACAGAGGT
CTGTAAACCGAGGTTTTGGA
ACCTCTGTTTG
GGAAAATTG
GGGCTCGAG
CCC
CAATTTTCCCAAACAGAGGTtCTGTAAACCGAG
GTTTTGG
AACCTCTGTTTGGGAAAATTG
GGG
CCC
CAATTTTCCCAAACAGAGGTtCTGTAAACCGAG
GTTTTGGcAACCTCTGTTTGGGAAAATTGGGG
CCC
CAATTTTCCCAAACAGAGGTatCTGTAAACCGA
GGTTTTGGctAACCTCTGTTTGGGAAAATTGGGG
CCC
CAATTTTCCCAAACAGAGGTaatCTGTAAACCG
AGGTTTTGGcttAACCTCTGTTTGGGAAAATTGGGG
CCC
CAATTTTCCCAAACAGAGGTaaatCTGTAAACCG
AGGTTTTGGcttaAACCTCTGTTTGGGAAAATTGGGG
CCC
CAATTTTCCCAAACAGAGGTgaaatCTGTAAACC
GAGGTTTTGGcttagAACCTCTGTTTGGGAAAATTGG
GG
CCC
CAATTTTCCCAAACAGAGGTcgaaatCTGTAAAC
CGAGGTTTTGGcttagcAACCTCTGTTTGGGAAAATTG
GGG
CCC
CAATTTTCCCAAACAGAGGTtcgaaatCTGTAAAC
CGAGGTTTTGGcttagctAACCTCTGTTTGGGAAAATT
G
GGG
CCC
CAATTTTCCCAAACAGAGGTtcgaaatCTGTAAAC
CGAGGTTTTGG
AACCTCTGTTTGGGAAAATTG
GGG
CCC
CAATTTTCCCAAACAGAGGTtcgaaatCTGTAAAC
CGAGGTTTTGGcAACCTCTGTTTGGGAAAATTGGGG
CCC
CAATTTTCCCAAACAGAGGTcgaaatCTGTAAAC
CGAGGTTTTGGctAACCTCTGTTTGGGAAAATTGGGG
CCC
CAATTTTCCCAAACAGAGGTcgaaatCTGTAAAC
CGAGGTTTTGGcttaAACCTCTGTTTGGGAAAATTGG
GG
CCC
CAATTTTCCCAAACAGAGGTcgaaatCTGTAAAC
CGAGGTTTTGGcttagAACCTCTGTTTGGGAAAATTG
GGG
CCC
CAATTTTCCCAAACAGAGGT
CTGTAAACCGAG
GTTTTGGcttagcAACCTCTGTTTGGGAAAATTGGGG
CCC
CAATTTTCCCAAACAGAGGTtCTGTAAACCGAG
GTTTTGGcttagcAACCTCTGTTTGGGAAAATTGGGG
CCC
CAATTTTCCCAAACAGAGGTatCTGTAAACCGA
GGTTTTGGcttagcAACCTCTGTTTGGGAAAATTGGGG
CCC
CAATTTTCCCAAACAGAGGTaatCTGTAAACCG
AGGTTTTGGcttagcAACCTCTGTTTGGGAAAATTGG
GG
CCC
CAATTTTCCCAAACAGAGGTaaatCTGTAAACCG
AGGTTTTGGcttagcAACCTCTGTTTGGGAAAATTGG
GG
CCC
CAATTTTCCCAAACAGAGGTgaaatCTGTAAACC
GAGGTTTTGGcttagcAACCTCTGTTTGGGAAAATTGG
GG
CCC
CTCCCATCACAGGCCCTGAGgtttaaGAGAAAAC
CATGGTTTTGTGggccagGCCCATGACCCTTCTCCTCT
GGG
CCT
TGTGTTGTGTGTCTTCAACTcacagAGTTAAACGA
TGCTTTACACagagtaGACTTGAAACACTCTTTTTCTGG
CCA
CCGGCTCATGAGAGGTAGAGctaagGTCCAAAC
CTAGGTTTATCTgagaccGGAACTCATGTGATTAACTG
TGG
CCT
TAAGAACATAAATCCCCAGGaattcACAGAAACC
TTGGTTTGAGCtttggaTTTCCCGCAGGATGTGGGATA
GG
CCA
CTCCCTCTCCCCCAAAAAGTaaaggTAGAAAACC
AAGGTTTACAGgcaacAAATAGCACAATGAATGGAA
TGG
CCT
AGGGAAGTGATCATAGCTGAgtttctGGAAAAAC
CTAGGTTTTAAAgttgaGGAGACTTAAGTCCAAAACCT
GG
Plasmids containing the recCas9 gene were constructed by PCR amplification of a gBlock encoding an evolved, hyperactivated Gin variant (Ginβ) (Gaj et al., A comprehensive approach to zinc-finger recombinase customization enables genomic targeting in human cells. Nucleic acids research 41, 3937-3946 (2013), the entire contents of which is hereby incorporated by reference) with the oligonucleotides 1GGS-rev-BamHI or 2GGS-rev-BamHI (using linker SEQ ID NO: 182) and Gin-for-NotI. PCR fragments were digested with BamHI and NotI, purified and ligated into a previously described expression vector (Addgene plasmid 43861) (see, e.g., Fu et al., High-frequency off-target mutagenesis induced by CRISPR-Cas nucleases in human cells. Nature biotechnology 31, 822-826 (2013), the entire contents of which is hereby incorporated by reference) to produce subcloning vectors pGin-1GGS and pGIN-2GGS (using linker SEQ ID NO: 182). Oligonucleotides 1GGS-link-for-BamHI, 5GGS-link-for-BamHI (using linker SEQ ID NO: 701), or 8GGS-link-for-BamHI (using linker SEQ ID NO: 183) were used with Cas9-rev-FLAG-NLS-AgeI to construct PCR fragments encoding Cas9-FLAG-NLS with a 1, 5, or 8 GGS linker (see Table 3). For DNA sequences encoding the GGS amino acid linkers, see Table 7. PCR fragments and subcloning plasmids were digested with BamHI and AgeI and ligated to create plasmids pGinβ-2×GGS-dCas9-FLAG-NLS (using linker SEQ ID NO: 182), pGinβ-5×GGS-dCas9-FLAG-NLS (using linker SEQ ID NO: 701), and pGinβ-8×GGS-dCas9-FLAG-NLS (using linker SEQ ID NO: 183). For the DNA and amino acid sequence of the pGinβ-8×GGS-dCas9-FLAG-NLS (i.e., recCas9), see below. The sequence encoding Ginβ is shown in bold; those encoding GGS linkers are shown in italics; those encoding dCas9 linkers are black; those encoding the FLAG tag and NLS are underlined and in lowercase, respectively.
ATGCTCATTGGCTACGTGCGCGTCTCAACTAACGACCAGAATACCGATCTTC
AGAGGAACGCACTGGTTTGTGCAGGCTGCGAACAGATTTTCGAGGACAAAC
TCAGCGGGACACGGACGGACAGACCTGGCCTCAAGCGAGCACTCAAGAGGC
TGCAGAAAGGAGACACTCTGGTGGTCTGGAAATTGGACCGCCTGGGTCGAA
GCATGAAGCATCTCATTTCTCTGGTTGGCGAACTGCGAGAAAGGGGGATCA
ACTTTCGAAGTCTGACGGATTCCATAGATACAAGCAGCCCCATGGGCCGGT
TCTTCTTCTACGTGATGGGTGCACTGGCTGAAATGGAAAGAGAACTCATTAT
AGAGCGAACCATGGCAGGGCTTGCGGCTGCCAGGAATAAAGGCAGGCGGTT
TGGAAGACCACCAAAG
GGTGGATCCGGAGGGTCCGGAGGTAGTGGCGGCAGCGG
TGGTTCAGGTGGCAGCGGAGGGTCAGGAGGCTCTGATAAAAAGTATTCTATTGGTT
CC
GATTATAAGGATGATGACGACAAG
GGAGGTTCCccaaagaagaaaaggaaggtcTGA
MLIGYVRVSTNDQNTDLQRNALVCAGCEQIFEDKLSGTRTDRPGLKRALKRLQ
KGDTLVVWKLDRLGRSMKHLISLVGELRERGINFRSLTDSIDTSSPMGRFFFYV
MGALAEMERELIIERTMAGLAAARNKGRRFGRPPK
GGSGGSGGSGGSGGSGGSG
GSGGSDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFD
DDDDK
GGSpkkkrkv Stop
The Gin recombinase catalytic domain, which is amino acids 1-142 of SEQ ID NO: 185, is identical to the sequence of SEQ ID NO: 713. The dCas9 domain, in which is amino acids 167-1533 of SEQ ID NO: 185 is identical to the sequence of SEQ ID NO: 712.
For plasmid sequencing experiments, the AmpR gene in pGinβ-8×GGS-dCas9-FLAG-NLS (using linker SEQ ID NO: 183) was replaced with SpecR by golden gate cloning with PCR fragments. Esp3I sites were introduced into the pGinβ-8×GGS-dCas9-FLAG-NLS (using linker SEQ ID NO: 183) plasmid at sites flanking the AmpR gene by PCR with Esp3I-for-plasmid and Esp3I-rev-plasmid. The primers spec-Esp3I-for and spec-Esp3I-rev were used to amplify the SpecR marker as well as introduce Esp3I sites and Esp3I generated overhangs compatible with those generated by the Esp3I-cleaved plasmid PCR product. Golden gate assembly was performed on the two fragments following the protocol used to generate the reporter plasmids as described herein.
The pHU6-NT1 guide RNA expression vector was based on the previously described pFYF1328 (Fu et al., High-frequency off-target mutagenesis induced by CRISPR-Cas nucleases in human cells. Nature biotechnology 31, 822-826 (2013), the entire contents of which is hereby incorporated by reference) altered to target a region within the bacterial luciferase gene LuxAB. Guide RNA expression vectors were created by PCR amplification of the entire vector with a universal primer R.pHU6.TSS(-1).univ and primers encoding unique guide RNA sequences (Table 1). A list of the guide RNA sequences is given in Table 8. These primers were phosphorylated with T4 polynucleotide kinase. The PCR reaction products and linear guide RNA expression vectors were blunt-end ligated and transformed. Guide RNA expression vectors used in initial optimizations, off target control guide RNA sequences and those targeting Chromosome 10 locus contained AmpR. All other plasmids described in this study contained specR to facilitate sequencing experiments. Spectinomycin resistance was initially introduced into guide RNA expression vectors via CPEC essentially as described (Quan et al., Circular polymerase extension cloning of complex gene libraries and pathways. PloS one 4, e6441 (2009); and Hillson (2010), vol. 2015, pp. CPEC protocol; each of which is incorporated herein by reference) and guide RNA plasmids were then constructed by PCR amplification of the vector, as described above. Reactions were incubated overnight at 37° C. with 40 U of DpnI, purified and transformed. Fragments for CPEC were generated by PCR amplification of a guide RNA expression vector with oligonucleotides cpec-assembly-for-spec2 and cpec assembly-rev. The specR fragment was generated by PCR amplification of the SpecR gene via the oligonucleotides cpec-assembly-for-spec and cpec-assembly-rev-spec. pUC19 (ThermoFisher Scientific, Waltham, Mass.) was similarly modified.
Cell Culture and Transfection
HEK293T cells were purchased from the American Type Culture Collection (ATCC, Manassas, Va.). Cells were cultured in Dulbecco's modified Eagle's medium (DMEM)+GlutaMAX-I (4.5 g/L D glucose+110 mg/mL sodium pyruvate) supplemented with 10% fetal bovine serum (FBS, Life Technologies, Carlsbad, Calif.). Cells were cultured at 37° C. at 5% CO2 in a humidified incubator.
Plasmid used for transfections were isolated from PureYield Plasmid Miniprep System (Promega, Madison, Wis.). The night before transfections, HEK293T cells were seeded at a density of 3×105 cells per well in 48 well collagen-treated plates (Corning, Corning, N.Y.). Transfections reactions were prepared in 25 μL of Opti-MEM (ThermoFisher Scientific, Waltham, Mass.). For each transfection, 45 ng of each guide RNA expression vector, 9 ng of reporter plasmid, 9 ng of piRFP670-N1 (Addgene Plasmid 45457), and 160 ng of recCas9 expression vector were mixed, combined with 0.8 μL lipofectamine 2000 in Opti-MEM (ThermoFisher Scientific, Waltham, Mass.) and added to individual wells.
Flow Cytometry
After 60-72 hours post-transfection, cells were washed with phosphate buffered saline and harvested with 50 μL of 0.05% trypsin-EDTA (Life Technologies, Carlsbad, Calif.) at 37° C. for 5-10 minutes. Cells were diluted in 250 μL culture media and run on a BD Fortessa analyzer. iRFP fluorescence was excited using a 635 nm laser and emission was collected using a 670/30 band pass filter. EGFP was excited using a 488 nM laser and emission fluorescence acquired with a 505 long pass and 530/30 band pass filters. Data was analyzed on FlowJo Software, gated for live and transfected events (expressing iRFP). Positive GFP-expressing cells were measured as a percentage of transfected cells gated from at least 6,000 live events. For optimization experiments, assay background was determined by measuring the percentage of transfected cells producing eGFP upon cotransfection with reporter plasmid and pUC, without recCas9 or guide RNA expression vectors. This background was then subtracted from percentage of eGFP-positive cells observed when the reporter plasmid was cotransfected with recCas9 and the on-target or non-target guide RNA expression vectors.
Identification of Genomic Target Sites
Searching for appropriate target sites was done using Bioconductor, an open-source bioinformatics package using the R statistical programming (Fu et al., High-frequency off-target mutagenesis induced by CRISPR-Cas nucleases in human cells. Nature biotechnology 31, 822-826 (2013), the entire contents of which is hereby incorporated by reference). The latest release (GRCh38) of the human reference genome published by the Genome Reference Consortium was used to search for sites that matched both the PAM requirement of Cas9 and the evolved gix sequence as described in the text. With the genome loaded into R, each search pattern was represented as a Biostring, a container in R that allowed for string matching and manipulation Scanning both strands of DNA for the entire genome, using the stated parameters, reveals approximately 450 potential targets in the human genome when searching using the GRCh38 reference assembly (Table 9).
DNA Sequencing
Transfections of 293T cells were performed as above in sextuplet and incubated for 72 hours. Cells were harvested and replicates were combined. Episomal DNA was extracted using a modified HIRT extraction involving alkaline lysis and spin column purification essentially as described (Quan et al., Circular polymerase extension cloning of complex gene libraries and pathways. PloS one 4, e6441 (2009); and Hillson (2010), vol. 2015, pp. CPEC protocol; the entire contents of each of which are hereby incorporated by reference). Briefly, after harvesting, HEK293T cells were washed in 500 μL of ice cold PBS, resuspended in 250 μL GTE Buffer (50 mM glucose, 25 mM Tris-HCl, 10 mM EDTA and pH 8.0), incubated at room temperature for 5 minutes, and lysed on ice for 5 minutes with 200 μL lysis buffer (200 mM NaOH, 1% sodium dodecyl sulfate). Lysis was neutralized with 150 μL of a potassium acetate solution (5 M acetate, 3 M potassium, pH 6.7). Cell debris were pelleted by centrifugation at 21,130 g for 15 minutes and lysate was applied to Econospin Spin columns (Epoch Life Science, Missouri City, Tex.). Columns were washed twice with 750 μL wash buffer (Omega Bio-tek, Norcross, Ga.) and eluted in 45 μL TE buffer, pH 8.0.
Isolated episomal DNA was digested for 2 hours at 37° C. with RecBCD (10 U) following the manufacturer's instructions and purified into 10 μL EB with a MinElute Reaction Cleanup Kit (Qiagen, Valencia, Calif.). Mach1-T1 chemically competent cells were transformed with 5 μL of episomal extractions and plated on agarose plates selecting for carbenicillin resistance (containing 50 μg/mL carbenicillin). Individual colonies were sequenced with primer pCALNL-for-1 to determine the rate of recombination. Sequencing reads revealed either the ‘left’ intact non-recombined recCas9 site, the expected recombined product, rare instances of ‘left’ non-recombined site with small indels, or one instance of a large deletion product.
Analysis of recCas9 Catalyzed Genomic Deletions
HEK293T cells were seeded at a density of 6×105 cells per well in 24 well collagen-treated plates and grown overnight (Corning, Corning, N.Y.). Transfections reactions were brought to a final volume of 100 μL in Opti-MEM (ThermoFisher Scientific, Waltham, Mass.). For each transfection, 90 ng of each guide RNA expression vector, 20 ng of pmaxGFP (Lonza, Allendale, N.J.) and 320 ng of recCas9 expression vector were combined with 2 μL Lipofectamine 2000 in Opti-MEM (ThermoFisher Scientific, Waltham, Mass.) and added to individual wells. After 48 hours, cells were harvested and sorted for the GFP transfection control on a BD FACS AriaIIIu cell sorter. Cells were sorted on purity mode using a 100 μm nozzle and background fluorescence was determined by comparison with untransfected cells. Sorted cells were collected on ice in PBS, pelleted and washed twice with cold PBS. Genomic DNA was harvested using the E. Z. N. A. Tissue DNA Kit (Omega Bio-Tek, Norcross, Ga.) and eluted in 100 μL EB. Genomic DNA was quantified using the Quant-iT PicoGreen dsDNA kit (ThermoFisher Scientific, Waltham, Mass.) measured on a Tecan Infinite M1000 Pro fluorescence plate reader.
Nested PCR was carried out using Q5 Hot-Start Polymerase 2× Master Mix supplemented with 3% DMSO and diluted with HyClone water, molecular biology grade (GE Life Sciences, Logan, Utah). Primary PCRs were carried out at 25 uL scale with 20 ng of genomic DNA as template using the primer pair FAM19A2-F1 and FAM19A2-R1 (Table 5). The primary PCR conditions were as follows: 98° C. for 1 minute, 35 cycles of (98° C. for 10 seconds, 59° C. for 30 seconds, 72° C. for 30 seconds), 72° C. for 1 minute. A 1:50 dilution of the primary PCR served as template for the secondary PCR, using primers FAM19A2-F2 and FAM19A2-R2. The secondary PCR conditions were as follows: 98° C. for 1 minute, 30 cycles of (98° C. for 10 seconds, 59° C. for 20 seconds, 72° C. for 20 seconds), 72° C. for 1 minute. DNA was analyzed by electrophoresis on a 1% agarose gel in TAE alongside a 1 Kb Plus DNA ladder (ThermoFisher Scientific, Waltham, Mass.). Material to be Sanger sequenced was purified on a Qiagen Minelute column (Valencia, Calif.) using the manufacturer's protocol. Template DNA from 3 biological replicates was used for three independent genomic nested PCRs.
The limit of detection was calculated given that one complete set of human chromosomes weighs approximately
Therefore, a PCR reaction seeded with 20 ng of genomic DNA template contains approximately 5500 sets of chromosomes.
For quantification of genomic deletion, nested PCR was carried out using the above conditions in triplicate for each of the 3 biological replicates. A two-fold dilution series of genomic DNA was used as template, beginning with the undiluted stock (for sample 1, 47.17 ng/uL; for sample 2, 75.96 ng/uL; and for sample 3, 22.83 ng/uL) to reduce potential sources of pipetting error. The lowest DNA concentration for which a deletion PCR product could be observed was assumed to contain a single deletion product per total genomic DNA.
The number of genomes present in a given amount of template DNA can be inferred, and thus an estimate a minimum deletion efficiency for recCas9 at the FAM19A2 locus can be determined. For example, take the case of a two-fold dilution series, beginning with 20 ng genomic DNA template. After nested PCR, only the well seeded with 20 ng yielded the correct PCR product. At 3.6 pg per genome, that PCR contained approximately 5500 genomes, and since at least one recombined genome must have been present, the minimum deletion efficiency is 1 in 5500 or 0.018%.
The levels of genomic DNA were quantified using a limiting dilution of genomic template because using quantitative PCR (qPCR) to determine the absolute level of genome editing would require a set of PCR conditions that unambiguously and specifically amplify only from post-recombined genomic DNA. As shown in
Results
Fusing Gin Recombinase to dCas9
It has been recently demonstrated that the N-terminus of dCas9 may be fused to the FokI nuclease catalytic domain, resulting in a dimeric dCas9-FokI fusion that cleaved DNA sites flanked by two guide RNA-specified sequences (see, e.g., Guilinger et al., Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nature biotechnology, (2014); Tsai et al., Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editing. Nature biotechnology, (2014); the entire contents of each of which are hereby incorporated by reference). The same fusion orientation was used to connect dCas9 to Ginβ, a highly active catalytic domain of dimeric Gin invertase previously evolved by Barbas and co-workers (Gaj et al., A comprehensive approach to zinc-finger recombinase customization enables genomic targeting in human cells. Nucleic acids research 41, 3937-3946 (2013), the entire contents of which is hereby incorporated by reference). Ginβ promiscuously recombines several 20-bp core “gix” sequences related to the native core sequence CTGTAAACCGAGGTTTTGGA (SEQ ID NO: 700) (Gaj et al., A comprehensive approach to zinc-finger recombinase customization enables genomic targeting in human cells. Nucleic acids research 41, 3937-3946 (2013); Klippel et al., The DNA Invertase Gin of Phage Mu—Formation of a Covalent Complex with DNA Via a Phosphoserine at Amino-Acid Position-9. Embo Journal 7, 1229-1237 (1988); Mertens et al., Site-specific recombination in bacteriophage Mu: characterization of binding sites for the DNA invertase Gin. The EMBO journal 7, 1219-1227 (1988); Plasterk et al., DNA inversions in the chromosome of Escherichia coli and in bacteriophage Mu: relationship to other site-specific recombination systems. Proceedings of the National Academy of Sciences of the United States of America 80, 5355-5358 (1983); the entire contents of each of which are hereby incorporated by reference). The guide RNAs localize a recCas9 dimer to a gix site flanked by two guide-RNA specified sequences, enabling the Ginβ domain to catalyze DNA recombination in a guide RNA-programmed manner (
To assay the resulting dCas9-Ginβ (recCas9) fusions, a reporter plasmid containing two recCas9 target sites flanking a poly-A terminator that blocks EGFP transcription was constructed (
Parameters influencing the architecture of the recCas9 components, including the spacing between the core gix site and the guide RNA-binding site (from 0 to 7 bp), as well as linker length between the dCas9 and Ginβ moieties ((GGS)2 (SEQ ID NO: 182), (GGS)5 (SEQ ID NO: 701), or (GGS)8 (SEQ ID NO: 183)) were varied (
Targeting DNA Sequences Found in the Human Genome with recCas9
Low levels of observed activity may be caused by a suboptimal guide RNA sequence or core gix sequence, consistent with previous reports showing that the efficiency of guide RNA:Cas9 binding is sequence-dependent (see, e.g., Xu et al., Sequence determinants of improved CRISPR sgRNA design. Genome research 25, 1147-1157 (2015), the entire contents of which is hereby incorporated by reference). Moreover, although the present optimization was conducted with the native gix core sequence (see, e.g., Klippel et al., The DNA Invertase Gin of Phage Mu—Formation of a Covalent Complex with DNA Via a Phosphoserine at Amino-Acid Position-9. Embo Journal 7, 1229-1237 (1988); Mertens et al., Site-specific recombination in bacteriophage Mu: characterization of binding sites for the DNA invertase Gin. The EMBO journal 7, 1219-1227 (1988); Plasterk et al., DNA inversions in the chromosome of Escherichia coli and in bacteriophage Mu: relationship to other site-specific recombination systems. Proceedings of the National Academy of Sciences of the United States of America 80, 5355-5358 (1983); the entire contents of each of which are hereby incorporated by reference), several studies have shown that zinc finger-Gin or TALE-Gin fusions are active, and in some cases more active, on slightly altered core sites. See, e.g., Gordley et al., 3rd, Synthesis of programmable integrases. Proceedings of the National Academy of Sciences of the United States of America 106, 5053-5058 (2009); Gersbach et al., Targeted plasmid integration into the human genome by an engineered zinc-finger recombinase. Nucleic acids research 39, 7868-7878 (2011); Mercer et al., Chimeric TALE recombinases with programmable DNA sequence specificity. Nucleic acids research 40, 11163-11172 (2012); Gaj et al., A comprehensive approach to zinc-finger recombinase customization enables genomic targeting in human cells. Nucleic acids research 41, 3937-3946 (2013); Gordley et al., 3rd, Evolution of programmable zinc finger-recombinases with activity in human cells. J Mol Biol 367, 802-813 (2007); Gersbach et al., 3rd, Directed evolution of recombinase specificity by split gene reassembly. Nucleic acids research 38, 4198-4206 (2010); and Gaj et al., Structure-guided reprogramming of serine recombinase DNA sequence specificity. Proceedings of the National Academy of Sciences of the United States of America 108, 498-503 (2011); the entire contents of each of which are hereby incorporated by reference). Thus, sequences found within the human genome were targeted in order to test if unmodified human genomic sequences were capable of being targeted by recCas9 and to test if varying the guide RNA and core sequences would increase recCas9 activity.
To identify potential target sites, previous findings that characterized evolved Gin variants (see, e.g., Gaj et al., A comprehensive approach to zinc-finger recombinase customization enables genomic targeting in human cells. Nucleic acids research 41, 3937-3946 (2013), the entire contents of which is hereby incorporated by reference) as well as the observations above were used. Using this information, the human genome was searched for sites that contained CCN(30-31)-AAASSWWSSTTT-N(30-31)-GG (SEQ ID NO: 699), where W is A or T, S is G or C, and N is any nucleotide. The N(30-31) includes the N of the NGG protospacer adjacent motif (PAM), the 20-base pair Cas9 binding site, a 5- to 6-base pair spacing between the Cas9 and gix sites, and the four outermost base pairs of the gix core site. The internal 12 base pairs of the gix core site (AAASSWWSSTTT, SEQ ID NO: 699) were previously determined to be important for Ginβ activity (see, e.g., Gaj et al., Nucleic acids research 41, 3937-3946 (2013).
The search revealed approximately 450 such loci in the human genome (Table 9). A reporter construct was created, containing the sequence identical to one of these genomic loci, found in PCDH15, and then guide RNA expression vectors were constructed to direct recCas9 to this sequence (
Next, whether both guide RNA sequences were required to cause recCas9-mediated deletion was determined. HEK293T cells were co-transfected with just one of the guide RNA vectors targeting the 5′ or 3′ flanking sequences of the PCDH15 psuedo-gix core site, the PCDH15 reporter plasmid, and a recCas9 expression vector. These co-transfections resulted in 2.5-3% EGFP expression (
These findings demonstrate that recCas9 activity can be increased substantially over the modest activity observed in the initial experiments by choosing different target sites and matching guide RNA sequences. A greater than 10-fold increase in activity on the PCDH15 site compared to the original target sequences was observed (compare
Orthogonality of recCas9
Next, whether recCas9 could target multiple, separate loci matching sequences found in the human genome in an orthogonal manner was tested. A subset of the recCas9 target sites in the human genome based on their potential use as a safe-harbor loci for genomic integration, or in one case, based on their location within a gene implicated in genetic disease, were selected.
To identify these sites, ENSEMBL (release 81) was searched to identify which predicted recCas9 target sites fall within annotated genes (see, e.g., Cunningham et al., Ensembl 2015. Nucleic acids research 43, D662-669 (2015), the entire contents of which is hereby incorporated by reference). One such site fell within an intronic region of FGF14. Mutations within FGF14 are believed to cause spinocerebellar ataxia 27 (SCA 27) (see, e.g., van Swieten et al., A mutation in the fibroblast growth factor 14 gene is associated with autosomal dominant cerebellar ataxia [corrected]. Am J Hum Genet 72, 191-199 (2003); Brusse et al., Spinocerebellar ataxia associated with a mutation in the fibroblast growth factor 14 gene (SCA27): A new phenotype. Mov Disord 21, 396-401 (2006); Choquet et al., A novel frameshift mutation in FGF14 causes an autosomal dominant episodic ataxia. Neurogenetics 16, 233-236 (2015); Coebergh et al., A new variable phenotype in spinocerebellar ataxia 27 (SCA 27) caused by a deletion in the FGF14 gene. Eur J Paediatr Neurol 18, 413-415 (2014); Shimojima et al., Spinocerebellar ataxias type 27 derived from a disruption of the fibroblast growth factor 14 gene with mimicking phenotype of paroxysmal non-kinesigenic dyskinesia. Brain Dev 34, 230-233 (2012); the entire contents of each of which are incorporated herein by reference). Finally, a fraction of the predicted recCas9 target sites that did not fall within genes were manually interrogated to determine if some sequences fell within safe harbor loci. Using annotations in ENSEMBL genomic targets that matched most of the five criteria for safe harbor loci described by Bushman and coworkers were identified (Cunningham et al., Ensembl 2015. Nucleic acids research 43, D662-669 (2015); and Sadelain et al., Safe harbours for the integration of new DNA in the human genome. Nat Rev Cancer 12, 51-58 (2012); the entire contents of each of which are incorporated herein by reference). Five reporters and corresponding guide RNA vector pairs containing sequences identical to those in the genome were constructed. To evaluate the orthogonality of recCas9 when programmed with different guide RNAs, all combinations of five guide RNA pairs with five reporters were tested.
Cotransfection of reporter, guide RNA plasmids, and recCas9 expression vectors revealed that three of the five reporters tested resulted in substantial levels of EGFP-positive cells consistent with recCas9-mediated recombination. This EGFP expression was strictly dependent upon cotransfection with a recCas9 expression vector and guide RNA plasmids matching the target site sequences on the reporter construct (
Characterization of recCas9 Products
The products of recCas9-mediated recombination of the reporter plasmids were characterized to confirm that EGFP expression was a result of recCas9-mediated removal of the poly-A terminator sequence. Reporter plasmids were sequenced for chromosome 5-site 1, chromosome 12, and chromosome 13 (FGF14 locus) after cotransfection with recCas9 expression vectors and with plasmids producing cognate or non-cognate guide RNA pairs. After incubation for 72 hours, episomal DNA was extracted (as described above) and transformed into E. coli to isolate reporter plasmids. Single colonies containing reporter plasmids were sequenced (
Individual colonies were expected to contain either an unmodified or a recombined reporter plasmid (
Since zinc finger-recombinases have been reported to cause mutations at recombinase core-site junctions (see, e.g., Gaj et al., A comprehensive approach to zinc-finger recombinase customization enables genomic targeting in human cells. Nucleic acids research 41, 3937-3946 (2013), the entire contents of which is hereby incorporated by reference), whether such mutagenesis occurs from recCas9 treatment was tested. In the reporter construct, recCas9 should delete kanR and the poly-A terminator by first cleaving the central dinucleotide of both gix core sites and then religating the two cores to each other (
One of these deletion-containing reads was observed in a chromosome 12 reporter plasmid that was transfected with the pUC control and lacked both recCas9 target sites as well as the polyA terminator. This product was attributed to DNA damage that occurred during the transfection, isolation, or subsequent manipulation. Because recCas9 may only localize to sequences when cotransfected with reporter and cognate guide RNA expression vectors, a more relevant metric may be to measure the total number of deletion products observed when reporter plasmids are cotransfected with cognate guide RNA vectors and recCas9 expression vectors. A single indel was observed out of a total of 185 plasmids sequenced from cotransfections with the chromosome 5-site 1 reporter and cognate guide RNA. Similarly, one indel was observed out of 204 plasmids from the chromosome 12 reporter following transfection with cognate guide RNA and recCas9 expression vectors. Notably, out of 202 sequencing reads, no indels were observed from the chromosome 13 reporter following cognate guide RNA and recCas9 cotransfection, despite resulting in the highest observed levels of recombination. These observations collectively suggest that recCas9 mediates predominantly error-free recombination.
Taken together, these results establish that recCas9 can target multiple sites found within the human genome with minimal cross-reactivity or byproduct formation. Substrates undergo efficient recombination only in the presence of cognate guide RNA sequences and recCas9, give clean recombination products in human cells, and generally do not result in mutations at the core-site junctions or products such as indels that arise from cellular DNA repair.
RecCas9-Mediated Genomic Deletion
Finally, whether recCas9 is capable of operating directly on the genomic DNA of cultured human cells was investigated. Using the list of potential recCas9 recognition sites in the human genome (Table 9), pairs of sites that, if targeted by recCas9, would yield chromosomal deletion events detectable by PCR, were sought. Guide RNA expression vectors were designed to direct recCas9 to those recCas9 sites closest to the chromosome 5-site 1 or chromosome 13 (FGF14 locus), sites which were both shown to be recombined in transient transfection assays (
It was thought that genomic deletion might be more efficient if the recCas9 target sites were closer to each other on the genome. Two recCas9 sites separated by 14.2 kb within an intronic region of FAM19A2 were identified; these sites also contained identical dinucleotide cores which should facilitate deletion. FAM19A2 is one of five closely related TAFA-family genes encoding small, secreted proteins that are thought to have a regulatory role in immune and nerve cells (see, e.g., Parker et al., Admixture mapping identifies a quantitative trait locus associated with FEV1/FVC in the COPDGene Study. Genet Epidemiol 38, 652-659 (2014), the entire contents of which is hereby incorporated by reference). Small nucleotide polymorphisms located in intronic sequences of FAM19A2 have been associated with elevated risk for systemic lupus erythematosus (SLE) and chronic obstructive pulmonary disease (COPD) in genome-wide association studies (see, e.g., Parker et al., Admixture mapping identifies a quantitative trait locus associated with FEV1/FVC in the COPDGene Study. Genet Epidemiol 38, 652-659 (2014), the entire contents of which is hereby incorporated by reference); deletion of the intronic regions of this gene might therefore provide insights into the causes of these diseases. Four guide RNA sequences were cloned in expression vectors designed to mediate recCas9 deletion between these two FAM19A2 sites. Vectors expressing these guide RNAs were cotransfected with the recCas9 expression vector (
A lower limit on the minimum genomic deletion efficiency was estimated using nested PCR on the serial dilutions of genomic template (see above or, e.g., Sykes et al., Quantitation of targets for PCR by use of limiting dilution. Biotechniques 13, 444-449 (1992), the entire contents of which is hereby incorporated by reference, for greater detail). A given amount of genomic DNA that yields the recCas9-specific nested PCR product must contain at least one edited chromosome. To establish a lower limit on this recCas9-mediated genomic deletion event, nested PCR was performed on serial dilutions of genomic DNA (isolated from cells transfected with recCas9 and the four FAM19A2 guide RNA expression vectors) to determine the lowest concentration of genomic template DNA that results in a detectable deletion product. These experiments revealed a lower limit of deletion efficiency of 0.023±0.017% (average of three biological replicates) (
Use of Other Alternative Recombinases
A Cre recombinase evolved to target a site in the Rosa locus of the human genome called “36C6” was fused to to dCas9. This fusion was then used to recombine a plasmid-based reporter containing the Rosa target site in a guide-RNA dependent fashion.
The target sequence used for 36C6 and all variant transfections is shown below: (guides—italics; Rosa site—bold):
CTATATGTTGACATGTTGAGGAGACTTAAGTCCAAAACCTGG
In
PAMs were identified flanking the Rosa26 site in the human genome that could support dCas9 binding (
GCTAAACTATATGTTGACATAAGAGTGGTGATAAGGCAACAGTAGG
The on target guide plasmids for hRosa are identical to the other gRNA expression plasmids, except the protospacers are replaced with those shown above (
Several tested Cre truncations of dCas9-Cre recombinase fusions are shown in
CTATATGTTGACATGTTGAGGAGACTTAAGTCCAAAACCTGG
The on-target guides used were the chr13-102010574 guides (plasmids BC165 and 166) and the off-target guides were the chr12-62418577 guide (BC163 and BC164).
Mol Cell Bio 9, 297-308 (2008).
Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. The scope of the present invention is not intended to be limited to the above description, but rather is as set forth in the appended claims.
In the claims articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The invention includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The invention also includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.
Furthermore, it is to be understood that the invention encompasses all variations, combinations, and permutations in which one or more limitations, elements, clauses, descriptive terms, etc., from one or more of the claims or from relevant portions of the description is introduced into another claim. For example, any claim that is dependent on another claim can be modified to include one or more limitations found in any other claim that is dependent on the same base claim. Furthermore, where the claims recite a composition, it is to be understood that methods of using the composition for any of the purposes disclosed herein are included, and methods of making the composition according to any of the methods of making disclosed herein or other methods known in the art are included, unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise.
Where elements are presented as lists, e.g., in Markush group format, it is to be understood that each subgroup of the elements is also disclosed, and any element(s) can be removed from the group. It is also noted that the term “comprising” is intended to be open and permits the inclusion of additional elements or steps. It should be understood that, in general, where the invention, or aspects of the invention, is/are referred to as comprising particular elements, features, steps, etc., certain embodiments of the invention or aspects of the invention consist, or consist essentially of, such elements, features, steps, etc. For purposes of simplicity those embodiments have not been specifically set forth in haec verba herein. Thus for each embodiment of the invention that comprises one or more elements, features, steps, etc., the invention also provides embodiments that consist or consist essentially of those elements, features, steps, etc.
Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and/or the understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value within the stated ranges in different embodiments of the invention, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise. It is also to be understood that unless otherwise indicated or otherwise evident from the context and/or the understanding of one of ordinary skill in the art, values expressed as ranges can assume any subrange within the given range, wherein the endpoints of the subrange are expressed to the same degree of accuracy as the tenth of the unit of the lower limit of the range.
In addition, it is to be understood that any particular embodiment of the present invention may be explicitly excluded from any one or more of the claims. Where ranges are given, any value within the range may explicitly be excluded from any one or more of the claims. Any embodiment, element, feature, application, or aspect of the compositions and/or methods of the invention, can be excluded from any one or more claims. For purposes of brevity, all of the embodiments in which one or more elements, features, purposes, or aspects is excluded are not set forth explicitly herein.
All publications, patents and sequence database entries mentioned herein, including those items listed above, are hereby incorporated by reference in their entirety as if each individual publication or patent was specifically and individually indicated to be incorporated by reference. In case of conflict, the present application, including any definitions herein, will control.
This application is a national stage filing under 35 U.S.C. § 371 of international PCT application, PCT/US2017/046144, filed Aug. 9, 2017, which claims priority under 35 U.S.C. § 119(e) to U.S. provisional patent application Ser. No. 62/372,755, filed Aug. 9, 2016, and U.S. provisional patent application Ser. No. 62/456,048, filed Feb. 7, 2017, each of which is incorporated herein by reference.
This invention was made with government support under EB022376 and GM118062 awarded by National Institutes of Health (NIH). The government has certain rights in this invention.
Filing Document | Filing Date | Country | Kind |
---|---|---|---|
PCT/US2017/046144 | 8/9/2017 | WO |
Publishing Document | Publishing Date | Country | Kind |
---|---|---|---|
WO2018/031683 | 2/15/2018 | WO | A |
Number | Name | Date | Kind |
---|---|---|---|
4182449 | Kozlow | Jan 1980 | A |
4186183 | Steck et al. | Jan 1980 | A |
4217344 | Vanlerberghe et al. | Aug 1980 | A |
4235871 | Papahadjopoulos et al. | Nov 1980 | A |
4261975 | Fullerton et al. | Apr 1981 | A |
4485054 | Mezei et al. | Nov 1984 | A |
4501728 | Geho et al. | Feb 1985 | A |
4663290 | Weis et al. | May 1987 | A |
4737323 | Martin et al. | Apr 1988 | A |
4774085 | Fidler | Sep 1988 | A |
4797368 | Carter et al. | Jan 1989 | A |
4837028 | Allen | Jun 1989 | A |
4873316 | Meade et al. | Oct 1989 | A |
4880635 | Janoff et al. | Nov 1989 | A |
4889818 | Gelfand et al. | Dec 1989 | A |
4897355 | Eppstein et al. | Jan 1990 | A |
4906477 | Kurono et al. | Mar 1990 | A |
4911928 | Wallach | Mar 1990 | A |
4917951 | Wallach | Apr 1990 | A |
4920016 | Allen et al. | Apr 1990 | A |
4921757 | Wheatley et al. | May 1990 | A |
4946787 | Eppstein et al. | Aug 1990 | A |
4965185 | Grischenko et al. | Oct 1990 | A |
5017492 | Kotewicz et al. | May 1991 | A |
5047342 | Chatterjee | Sep 1991 | A |
5049386 | Eppstein et al. | Sep 1991 | A |
5079352 | Gelfand et al. | Jan 1992 | A |
5139941 | Muzyczka et al. | Aug 1992 | A |
5173414 | Lebkowski et al. | Dec 1992 | A |
5223409 | Ladner et al. | Jun 1993 | A |
5244797 | Kotewicz et al. | Sep 1993 | A |
5270179 | Chatterjee | Dec 1993 | A |
5374553 | Gelfand et al. | Dec 1994 | A |
5405776 | Kotewicz et al. | Apr 1995 | A |
5436149 | Barnes | Jul 1995 | A |
5449639 | Wei et al. | Sep 1995 | A |
5496714 | Comb et al. | Mar 1996 | A |
5512462 | Cheng | Apr 1996 | A |
5580737 | Polisky et al. | Dec 1996 | A |
5614365 | Tabor et al. | Mar 1997 | A |
5652094 | Usman et al. | Jul 1997 | A |
5658727 | Barbas et al. | Aug 1997 | A |
5668005 | Kotewicz et al. | Sep 1997 | A |
5677152 | Birch et al. | Oct 1997 | A |
5767099 | Harris et al. | Jun 1998 | A |
5780053 | Ashley et al. | Jul 1998 | A |
5830430 | Unger et al. | Nov 1998 | A |
5834247 | Comb et al. | Nov 1998 | A |
5835699 | Kimura | Nov 1998 | A |
5849548 | Haseloff et al. | Dec 1998 | A |
5851548 | Dattagupta et al. | Dec 1998 | A |
5855910 | Ashley et al. | Jan 1999 | A |
5856463 | Blankenborg et al. | Jan 1999 | A |
5962313 | Podsakoff et al. | Oct 1999 | A |
5981182 | Jacobs, Jr. et al. | Nov 1999 | A |
6015794 | Haseloff et al. | Jan 2000 | A |
6057153 | George et al. | May 2000 | A |
6063608 | Kotewicz et al. | May 2000 | A |
6077705 | Duan et al. | Jun 2000 | A |
6156509 | Schellenberger | Dec 2000 | A |
6183998 | Ivanov et al. | Feb 2001 | B1 |
6355415 | Wagner | Mar 2002 | B1 |
6429298 | Ellington et al. | Aug 2002 | B1 |
6453242 | Eisenberg et al. | Sep 2002 | B1 |
6479264 | Louwrier | Nov 2002 | B1 |
6503717 | Case et al. | Jan 2003 | B2 |
6534261 | Cox, III et al. | Mar 2003 | B1 |
6589768 | Kotewicz et al. | Jul 2003 | B1 |
6599692 | Case et al. | Jul 2003 | B1 |
6607882 | Cox, III et al. | Aug 2003 | B1 |
6610522 | Kotewicz et al. | Aug 2003 | B1 |
6689558 | Case | Feb 2004 | B2 |
6716973 | Baskerville et al. | Apr 2004 | B2 |
6824978 | Cox, III et al. | Nov 2004 | B1 |
6933113 | Case et al. | Aug 2005 | B2 |
6979539 | Cox, III et al. | Dec 2005 | B2 |
7013219 | Case et al. | Mar 2006 | B2 |
7045337 | Schultz et al. | May 2006 | B2 |
7067650 | Tanaka | Jun 2006 | B1 |
7070928 | Liu et al. | Jul 2006 | B2 |
7078208 | Smith et al. | Jul 2006 | B2 |
7083970 | Schultz et al. | Aug 2006 | B2 |
7163824 | Cox, III et al. | Jan 2007 | B2 |
7192739 | Liu et al. | Mar 2007 | B2 |
7223545 | Liu et al. | May 2007 | B2 |
7354761 | Schultz et al. | Apr 2008 | B2 |
7368275 | Schultz et al. | May 2008 | B2 |
7442160 | Liu et al. | Oct 2008 | B2 |
7476500 | Liu et al. | Jan 2009 | B1 |
7476734 | Liu | Jan 2009 | B2 |
7479573 | Chu et al. | Jan 2009 | B2 |
7491494 | Liu et al. | Feb 2009 | B2 |
7541450 | Liu et al. | Jun 2009 | B2 |
7557068 | Liu et al. | Jul 2009 | B2 |
7595179 | Chen et al. | Sep 2009 | B2 |
7638300 | Schultz et al. | Dec 2009 | B2 |
7670807 | Lampson et al. | Mar 2010 | B2 |
7678554 | Liu et al. | Mar 2010 | B2 |
7713721 | Schultz et al. | May 2010 | B2 |
7771935 | Liu et al. | Aug 2010 | B2 |
7794931 | Breaker et al. | Sep 2010 | B2 |
7807408 | Liu et al. | Oct 2010 | B2 |
7851658 | Liu et al. | Dec 2010 | B2 |
7915025 | Schultz et al. | Mar 2011 | B2 |
7919277 | Russell et al. | Apr 2011 | B2 |
7993672 | Huang et al. | Aug 2011 | B2 |
7998904 | Liu et al. | Aug 2011 | B2 |
8012739 | Schultz et al. | Sep 2011 | B2 |
8017323 | Liu et al. | Sep 2011 | B2 |
8017755 | Liu et al. | Sep 2011 | B2 |
8030074 | Schultz et al. | Oct 2011 | B2 |
8067556 | Hogrefe et al. | Nov 2011 | B2 |
8114648 | Schultz et al. | Feb 2012 | B2 |
8173364 | Schultz et al. | May 2012 | B2 |
8173392 | Schultz et al. | May 2012 | B2 |
8183012 | Schultz et al. | May 2012 | B2 |
8183178 | Liu et al. | May 2012 | B2 |
8206914 | Liu et al. | Jun 2012 | B2 |
8361725 | Russell et al. | Jan 2013 | B2 |
8394604 | Liu et al. | Mar 2013 | B2 |
8440431 | Voytas et al. | May 2013 | B2 |
8440432 | Voytas et al. | May 2013 | B2 |
8450471 | Voytas et al. | May 2013 | B2 |
8492082 | De Franciscis et al. | Jul 2013 | B2 |
8546553 | Terns et al. | Oct 2013 | B2 |
8569256 | Heyes et al. | Oct 2013 | B2 |
8586363 | Voytas et al. | Nov 2013 | B2 |
8680069 | de Fougerolles et al. | Mar 2014 | B2 |
8691729 | Liu et al. | Apr 2014 | B2 |
8691750 | Constien et al. | Apr 2014 | B2 |
8697359 | Zhang | Apr 2014 | B1 |
8697853 | Voytas et al. | Apr 2014 | B2 |
8709466 | Coady et al. | Apr 2014 | B2 |
8728526 | Heller | May 2014 | B2 |
8748667 | Budzik et al. | Jun 2014 | B2 |
8758810 | Okada et al. | Jun 2014 | B2 |
8759103 | Kim et al. | Jun 2014 | B2 |
8759104 | Unciti-Broceta et al. | Jun 2014 | B2 |
8771728 | Huang et al. | Jul 2014 | B2 |
8790664 | Pitard et al. | Jul 2014 | B2 |
8795965 | Zhang | Aug 2014 | B2 |
8822663 | Schrum et al. | Sep 2014 | B2 |
8846578 | McCray et al. | Sep 2014 | B2 |
8889418 | Zhang et al. | Nov 2014 | B2 |
8900814 | Yasukawa et al. | Dec 2014 | B2 |
8945839 | Zhang | Feb 2015 | B2 |
8975232 | Liu et al. | Mar 2015 | B2 |
8993233 | Zhang et al. | Mar 2015 | B2 |
8999641 | Zhang et al. | Apr 2015 | B2 |
9023594 | Liu et al. | May 2015 | B2 |
9023649 | Mali et al. | May 2015 | B2 |
9068179 | Liu et al. | Jun 2015 | B1 |
9150626 | Liu et al. | Oct 2015 | B2 |
9163271 | Schultz et al. | Oct 2015 | B2 |
9163284 | Liu et al. | Oct 2015 | B2 |
9181535 | Liu et al. | Nov 2015 | B2 |
9200045 | Liu et al. | Dec 2015 | B2 |
9221886 | Liu et al. | Dec 2015 | B2 |
9228207 | Liu et al. | Jan 2016 | B2 |
9234213 | Wu | Jan 2016 | B2 |
9243038 | Liu et al. | Jan 2016 | B2 |
9267127 | Liu et al. | Feb 2016 | B2 |
9322006 | Liu et al. | Apr 2016 | B2 |
9322037 | Liu et al. | Apr 2016 | B2 |
9340799 | Liu et al. | May 2016 | B2 |
9340800 | Liu et al. | May 2016 | B2 |
9359599 | Liu et al. | Jun 2016 | B2 |
9388430 | Liu | Jul 2016 | B2 |
9394537 | Liu et al. | Jul 2016 | B2 |
9434774 | Liu et al. | Sep 2016 | B2 |
9458484 | Ma et al. | Oct 2016 | B2 |
9512446 | Joung et al. | Dec 2016 | B1 |
9526724 | Oshiack et al. | Dec 2016 | B2 |
9526784 | Liu et al. | Dec 2016 | B2 |
9534210 | Park et al. | Jan 2017 | B2 |
9580698 | Xu et al. | Feb 2017 | B1 |
9610322 | Liu et al. | Apr 2017 | B2 |
9637739 | Siksnys et al. | May 2017 | B2 |
9737604 | Liu et al. | Aug 2017 | B2 |
9738693 | Telford et al. | Aug 2017 | B2 |
9753340 | Saitou | Sep 2017 | B2 |
9771574 | Liu et al. | Sep 2017 | B2 |
9783791 | Hogrefe et al. | Oct 2017 | B2 |
9816093 | Donohoue et al. | Nov 2017 | B1 |
9840538 | Telford et al. | Dec 2017 | B2 |
9840690 | Karli et al. | Dec 2017 | B2 |
9840699 | Liu et al. | Dec 2017 | B2 |
9840702 | Collingwood et al. | Dec 2017 | B2 |
9850521 | Braman et al. | Dec 2017 | B2 |
9873907 | Zeiner et al. | Jan 2018 | B2 |
9879270 | Hittinger et al. | Jan 2018 | B2 |
9914939 | Church et al. | Mar 2018 | B2 |
9932567 | Xu et al. | Apr 2018 | B1 |
9938288 | Kishi et al. | Apr 2018 | B1 |
9944933 | Storici et al. | Apr 2018 | B2 |
9982279 | Gill et al. | May 2018 | B1 |
9999671 | Liu et al. | Jun 2018 | B2 |
10011868 | Liu et al. | Jul 2018 | B2 |
10053725 | Liu et al. | Aug 2018 | B2 |
10059940 | Zhong | Aug 2018 | B2 |
10077453 | Liu et al. | Sep 2018 | B2 |
10113163 | Liu et al. | Oct 2018 | B2 |
10150955 | Lambowitz et al. | Dec 2018 | B2 |
10167457 | Liu et al. | Jan 2019 | B2 |
10179911 | Liu et al. | Jan 2019 | B2 |
10189831 | Arrington et al. | Jan 2019 | B2 |
10202593 | Liu et al. | Feb 2019 | B2 |
10202658 | Parkin et al. | Feb 2019 | B2 |
10227581 | Liu et al. | Mar 2019 | B2 |
10323236 | Liu et al. | Jun 2019 | B2 |
10336997 | Liu et al. | Jul 2019 | B2 |
10358670 | Janulaitis et al. | Jul 2019 | B2 |
10392674 | Liu et al. | Aug 2019 | B2 |
10407697 | Doudna et al. | Sep 2019 | B2 |
10465176 | Liu et al. | Nov 2019 | B2 |
10508298 | Liu et al. | Dec 2019 | B2 |
10597679 | Liu et al. | Mar 2020 | B2 |
10612011 | Liu et al. | Apr 2020 | B2 |
10682410 | Liu et al. | Jun 2020 | B2 |
10704062 | Liu et al. | Jul 2020 | B2 |
10745677 | Maianti et al. | Aug 2020 | B2 |
10858639 | Liu et al. | Dec 2020 | B2 |
10912833 | Liu et al. | Feb 2021 | B2 |
10930367 | Zhang et al. | Feb 2021 | B2 |
10947530 | Liu et al. | Mar 2021 | B2 |
10954548 | Liu et al. | Mar 2021 | B2 |
11046948 | Liu et al. | Jun 2021 | B2 |
11053481 | Liu et al. | Jul 2021 | B2 |
11078429 | Liu et al. | Aug 2021 | B2 |
11124782 | Liu et al. | Sep 2021 | B2 |
11268082 | Liu et al. | Mar 2022 | B2 |
11299755 | Liu et al. | Apr 2022 | B2 |
11306324 | Liu et al. | Apr 2022 | B2 |
11447770 | Liu et al. | Sep 2022 | B1 |
20030082575 | Schultz et al. | May 2003 | A1 |
20030087817 | Cox et al. | May 2003 | A1 |
20030096337 | Hillman et al. | May 2003 | A1 |
20030108885 | Schultz et al. | Jun 2003 | A1 |
20030119764 | Loeb et al. | Jun 2003 | A1 |
20030167533 | Yadav et al. | Sep 2003 | A1 |
20030203480 | Kovesdi et al. | Oct 2003 | A1 |
20040003420 | Kuhn et al. | Jan 2004 | A1 |
20040115184 | Smith et al. | Jun 2004 | A1 |
20040203109 | Lal et al. | Oct 2004 | A1 |
20050136429 | Guarente et al. | Jun 2005 | A1 |
20050222030 | Allison | Oct 2005 | A1 |
20050260626 | Lorens et al. | Nov 2005 | A1 |
20060088864 | Smolke et al. | Apr 2006 | A1 |
20060104984 | Littlefield et al. | May 2006 | A1 |
20060246568 | Honjo et al. | Nov 2006 | A1 |
20070015238 | Snyder et al. | Jan 2007 | A1 |
20070264692 | Liu et al. | Nov 2007 | A1 |
20070269817 | Shapero | Nov 2007 | A1 |
20080051317 | Church et al. | Feb 2008 | A1 |
20080124725 | Barrangou et al. | May 2008 | A1 |
20080182254 | Hall et al. | Jul 2008 | A1 |
20080220502 | Schellenberger et al. | Sep 2008 | A1 |
20090130718 | Short | May 2009 | A1 |
20090215878 | Tan et al. | Aug 2009 | A1 |
20090234109 | Han et al. | Sep 2009 | A1 |
20100076057 | Sontheimer et al. | Mar 2010 | A1 |
20100093617 | Barrangou et al. | Apr 2010 | A1 |
20100104690 | Barrangou et al. | Apr 2010 | A1 |
20100273857 | Thakker et al. | Oct 2010 | A1 |
20100305197 | Che | Dec 2010 | A1 |
20100316643 | Eckert et al. | Dec 2010 | A1 |
20110016540 | Weinstein et al. | Jan 2011 | A1 |
20110059160 | Essner et al. | Mar 2011 | A1 |
20110059502 | Chalasani | Mar 2011 | A1 |
20110104787 | Church et al. | May 2011 | A1 |
20110177495 | Liu et al. | Jul 2011 | A1 |
20110189775 | Ainley et al. | Aug 2011 | A1 |
20110189776 | Terns et al. | Aug 2011 | A1 |
20110217739 | Terns et al. | Sep 2011 | A1 |
20110301073 | Gregory et al. | Dec 2011 | A1 |
20120129759 | Liu et al. | May 2012 | A1 |
20120141523 | Castado et al. | Jun 2012 | A1 |
20120244601 | Bertozzi et al. | Sep 2012 | A1 |
20120270273 | Zhang et al. | Oct 2012 | A1 |
20120322861 | Byrne et al. | Dec 2012 | A1 |
20130059931 | Petersen-Mahrt et al. | Mar 2013 | A1 |
20130117869 | Duchateau et al. | May 2013 | A1 |
20130130248 | Haurwitz et al. | May 2013 | A1 |
20130158245 | Russell et al. | Jun 2013 | A1 |
20130165389 | Schellenberger et al. | Jun 2013 | A1 |
20130309720 | Schultz et al. | Nov 2013 | A1 |
20130344117 | Mirosevich et al. | Dec 2013 | A1 |
20130345064 | Liu et al. | Dec 2013 | A1 |
20140004280 | Loomis | Jan 2014 | A1 |
20140005269 | Ngwuluka et al. | Jan 2014 | A1 |
20140017214 | Cost | Jan 2014 | A1 |
20140018404 | Chen et al. | Jan 2014 | A1 |
20140044793 | Goll et al. | Feb 2014 | A1 |
20140065711 | Liu et al. | Mar 2014 | A1 |
20140068797 | Doudna et al. | Mar 2014 | A1 |
20140127752 | Zhou et al. | May 2014 | A1 |
20140141094 | Smyth et al. | May 2014 | A1 |
20140141487 | Feldman et al. | May 2014 | A1 |
20140179770 | Zhang et al. | Jun 2014 | A1 |
20140186843 | Zhang et al. | Jul 2014 | A1 |
20140186958 | Zhang et al. | Jul 2014 | A1 |
20140201858 | Ostertag et al. | Jul 2014 | A1 |
20140234289 | Liu et al. | Aug 2014 | A1 |
20140248702 | Zhang et al. | Sep 2014 | A1 |
20140273037 | Wu | Sep 2014 | A1 |
20140273226 | Wu | Sep 2014 | A1 |
20140273230 | Chen et al. | Sep 2014 | A1 |
20140273234 | Zhang et al. | Sep 2014 | A1 |
20140283156 | Zador et al. | Sep 2014 | A1 |
20140295556 | Joung et al. | Oct 2014 | A1 |
20140295557 | Joung et al. | Oct 2014 | A1 |
20140342456 | Mali et al. | Nov 2014 | A1 |
20140342457 | Mali et al. | Nov 2014 | A1 |
20140342458 | Mali et al. | Nov 2014 | A1 |
20140349400 | Jakimo et al. | Nov 2014 | A1 |
20140356867 | Peter et al. | Dec 2014 | A1 |
20140356956 | Church et al. | Dec 2014 | A1 |
20140356958 | Mali et al. | Dec 2014 | A1 |
20140356959 | Church et al. | Dec 2014 | A1 |
20140357523 | Zeiner et al. | Dec 2014 | A1 |
20140377868 | Joung et al. | Dec 2014 | A1 |
20150010526 | Liu et al. | Jan 2015 | A1 |
20150031089 | Lindstrom | Jan 2015 | A1 |
20150031132 | Church et al. | Jan 2015 | A1 |
20150031133 | Church et al. | Jan 2015 | A1 |
20150044191 | Liu et al. | Feb 2015 | A1 |
20150044192 | Liu et al. | Feb 2015 | A1 |
20150044772 | Zhao | Feb 2015 | A1 |
20150050699 | Siksnys et al. | Feb 2015 | A1 |
20150056177 | Liu et al. | Feb 2015 | A1 |
20150056629 | Guthrie-Honea | Feb 2015 | A1 |
20150064138 | Lu et al. | Mar 2015 | A1 |
20150064789 | Paschon et al. | Mar 2015 | A1 |
20150071898 | Liu et al. | Mar 2015 | A1 |
20150071899 | Liu et al. | Mar 2015 | A1 |
20150071900 | Liu et al. | Mar 2015 | A1 |
20150071901 | Liu et al. | Mar 2015 | A1 |
20150071902 | Liu et al. | Mar 2015 | A1 |
20150071903 | Liu et al. | Mar 2015 | A1 |
20150071906 | Liu | Mar 2015 | A1 |
20150079680 | Bradley et al. | Mar 2015 | A1 |
20150079681 | Zhang | Mar 2015 | A1 |
20150098954 | Hyde et al. | Apr 2015 | A1 |
20150118216 | Liu et al. | Apr 2015 | A1 |
20150132269 | Orkin et al. | May 2015 | A1 |
20150140664 | Byrne et al. | May 2015 | A1 |
20150159172 | Miller et al. | Jun 2015 | A1 |
20150165054 | Liu et al. | Jun 2015 | A1 |
20150166980 | Liu et al. | Jun 2015 | A1 |
20150166981 | Liu et al. | Jun 2015 | A1 |
20150166982 | Liu et al. | Jun 2015 | A1 |
20150166983 | Liu et al. | Jun 2015 | A1 |
20150166984 | Liu et al. | Jun 2015 | A1 |
20150166985 | Liu et al. | Jun 2015 | A1 |
20150191744 | Wolfe et al. | Jul 2015 | A1 |
20150197759 | Xu et al. | Jul 2015 | A1 |
20150211058 | Carstens | Jul 2015 | A1 |
20150218573 | Loque et al. | Aug 2015 | A1 |
20150225773 | Farmer et al. | Aug 2015 | A1 |
20150252358 | Maeder et al. | Sep 2015 | A1 |
20150275202 | Liu et al. | Oct 2015 | A1 |
20150291965 | Zhang et al. | Oct 2015 | A1 |
20150307889 | Petolino et al. | Oct 2015 | A1 |
20150315252 | Haugwitz et al. | Nov 2015 | A1 |
20150344549 | Muir et al. | Dec 2015 | A1 |
20160015682 | Cawthorne et al. | Jan 2016 | A2 |
20160017393 | Jacobson et al. | Jan 2016 | A1 |
20160017396 | Cann et al. | Jan 2016 | A1 |
20160032292 | Storici et al. | Feb 2016 | A1 |
20160032353 | Braman et al. | Feb 2016 | A1 |
20160040155 | Maizels et al. | Feb 2016 | A1 |
20160046952 | Hittinger et al. | Feb 2016 | A1 |
20160046961 | Jinek et al. | Feb 2016 | A1 |
20160046962 | May et al. | Feb 2016 | A1 |
20160053272 | Wurtzel et al. | Feb 2016 | A1 |
20160053304 | Wurtzel et al. | Feb 2016 | A1 |
20160074535 | Ranganathan et al. | Mar 2016 | A1 |
20160076093 | Shendure et al. | Mar 2016 | A1 |
20160090603 | Carnes et al. | Mar 2016 | A1 |
20160090622 | Liu et al. | Mar 2016 | A1 |
20160115488 | Zhang et al. | Apr 2016 | A1 |
20160138046 | Wu | May 2016 | A1 |
20160153003 | Joung et al. | Jun 2016 | A1 |
20160186214 | Brouns et al. | Jun 2016 | A1 |
20160200779 | Liu et al. | Jul 2016 | A1 |
20160201040 | Liu et al. | Jul 2016 | A1 |
20160201089 | Gersbach et al. | Jul 2016 | A1 |
20160206566 | Lu et al. | Jul 2016 | A1 |
20160208243 | Zhang et al. | Jul 2016 | A1 |
20160208288 | Liu et al. | Jul 2016 | A1 |
20160215275 | Zhong | Jul 2016 | A1 |
20160215276 | Liu et al. | Jul 2016 | A1 |
20160215300 | May et al. | Jul 2016 | A1 |
20160244784 | Jacobson et al. | Aug 2016 | A1 |
20160244829 | Bang et al. | Aug 2016 | A1 |
20160264934 | Giallourakis et al. | Sep 2016 | A1 |
20160272593 | Ritter et al. | Sep 2016 | A1 |
20160272965 | Zhang et al. | Sep 2016 | A1 |
20160281072 | Zhang | Sep 2016 | A1 |
20160298136 | Chen et al. | Oct 2016 | A1 |
20160304846 | Liu et al. | Oct 2016 | A1 |
20160304855 | Stark et al. | Oct 2016 | A1 |
20160312304 | Sorrentino et al. | Oct 2016 | A1 |
20160319262 | Doudna et al. | Nov 2016 | A1 |
20160333389 | Liu et al. | Nov 2016 | A1 |
20160340622 | Abdou | Nov 2016 | A1 |
20160340662 | Zhang et al. | Nov 2016 | A1 |
20160345578 | Barrangou et al. | Dec 2016 | A1 |
20160346360 | Quake et al. | Dec 2016 | A1 |
20160346361 | Quake et al. | Dec 2016 | A1 |
20160346362 | Quake et al. | Dec 2016 | A1 |
20160348074 | Quake et al. | Dec 2016 | A1 |
20160348096 | Liu et al. | Dec 2016 | A1 |
20160350476 | Quake et al. | Dec 2016 | A1 |
20160355796 | Davidson et al. | Dec 2016 | A1 |
20160369262 | Reik et al. | Dec 2016 | A1 |
20170009224 | Liu et al. | Jan 2017 | A1 |
20170009242 | McKinley et al. | Jan 2017 | A1 |
20170014449 | Bangera et al. | Jan 2017 | A1 |
20170020922 | Wagner et al. | Jan 2017 | A1 |
20170037432 | Donohoue et al. | Feb 2017 | A1 |
20170044520 | Liu et al. | Feb 2017 | A1 |
20170044592 | Peter et al. | Feb 2017 | A1 |
20170053729 | Kotani et al. | Feb 2017 | A1 |
20170058271 | Joung et al. | Mar 2017 | A1 |
20170058272 | Carter et al. | Mar 2017 | A1 |
20170058298 | Kennedy et al. | Mar 2017 | A1 |
20170073663 | Wang et al. | Mar 2017 | A1 |
20170073670 | Nishida et al. | Mar 2017 | A1 |
20170087224 | Quake | Mar 2017 | A1 |
20170087225 | Quake | Mar 2017 | A1 |
20170088587 | Quake | Mar 2017 | A1 |
20170088828 | Quake | Mar 2017 | A1 |
20170107536 | Zhang et al. | Apr 2017 | A1 |
20170107560 | Peter et al. | Apr 2017 | A1 |
20170114367 | Hu et al. | Apr 2017 | A1 |
20170121693 | Liu et al. | May 2017 | A1 |
20170145394 | Yeo et al. | May 2017 | A1 |
20170145405 | Tang et al. | May 2017 | A1 |
20170145438 | Kantor | May 2017 | A1 |
20170152528 | Zhang | Jun 2017 | A1 |
20170152787 | Kubo et al. | Jun 2017 | A1 |
20170159033 | Kamtekar et al. | Jun 2017 | A1 |
20170166928 | Vyas et al. | Jun 2017 | A1 |
20170175104 | Doudna et al. | Jun 2017 | A1 |
20170175142 | Zhang et al. | Jun 2017 | A1 |
20170191047 | Terns et al. | Jul 2017 | A1 |
20170191078 | Zhang et al. | Jul 2017 | A1 |
20170198269 | Zhang et al. | Jul 2017 | A1 |
20170198277 | Kmiec et al. | Jul 2017 | A1 |
20170198302 | Feng et al. | Jul 2017 | A1 |
20170226522 | Hu et al. | Aug 2017 | A1 |
20170233703 | Xie et al. | Aug 2017 | A1 |
20170233708 | Liu et al. | Aug 2017 | A1 |
20170233756 | Begemann et al. | Aug 2017 | A1 |
20170247671 | Yung et al. | Aug 2017 | A1 |
20170247703 | Sloan et al. | Aug 2017 | A1 |
20170268022 | Liu et al. | Sep 2017 | A1 |
20170275648 | Barrangou et al. | Sep 2017 | A1 |
20170275665 | Silas et al. | Sep 2017 | A1 |
20170283797 | Robb et al. | Oct 2017 | A1 |
20170283831 | Zhang et al. | Oct 2017 | A1 |
20170306306 | Potter et al. | Oct 2017 | A1 |
20170314016 | Kim et al. | Nov 2017 | A1 |
20170362635 | Chamberlain et al. | Dec 2017 | A1 |
20180023062 | Lamb | Jan 2018 | A1 |
20180064077 | Dunham et al. | Mar 2018 | A1 |
20180066258 | Powell | Mar 2018 | A1 |
20180068062 | Zhang et al. | Mar 2018 | A1 |
20180073012 | Liu et al. | Mar 2018 | A1 |
20180080051 | Sheikh et al. | Mar 2018 | A1 |
20180087046 | Badran et al. | Mar 2018 | A1 |
20180100147 | Yates et al. | Apr 2018 | A1 |
20180105867 | Xiao et al. | Apr 2018 | A1 |
20180119118 | Lu et al. | May 2018 | A1 |
20180127759 | Lu et al. | May 2018 | A1 |
20180127780 | Liu et al. | May 2018 | A1 |
20180155708 | Church et al. | Jun 2018 | A1 |
20180155720 | Donohoue et al. | Jun 2018 | A1 |
20180163213 | Aneja et al. | Jun 2018 | A1 |
20180170984 | Harris et al. | Jun 2018 | A1 |
20180179503 | Maianti et al. | Jun 2018 | A1 |
20180179547 | Zhang et al. | Jun 2018 | A1 |
20180201921 | Malcolm | Jul 2018 | A1 |
20180230464 | Zhong | Aug 2018 | A1 |
20180230471 | Storici et al. | Aug 2018 | A1 |
20180236081 | Liu et al. | Aug 2018 | A1 |
20180237758 | Liu et al. | Aug 2018 | A1 |
20180237787 | Maianti et al. | Aug 2018 | A1 |
20180245066 | Yao et al. | Aug 2018 | A1 |
20180245075 | Khalil et al. | Aug 2018 | A1 |
20180258418 | Kim | Sep 2018 | A1 |
20180265864 | Li et al. | Sep 2018 | A1 |
20180273939 | Yu et al. | Sep 2018 | A1 |
20180282722 | Jakimo et al. | Oct 2018 | A1 |
20180298391 | Jakimo et al. | Oct 2018 | A1 |
20180305688 | Zhong | Oct 2018 | A1 |
20180305704 | Zhang | Oct 2018 | A1 |
20180312822 | Lee et al. | Nov 2018 | A1 |
20180312825 | Liu et al. | Nov 2018 | A1 |
20180312828 | Liu et al. | Nov 2018 | A1 |
20180312835 | Yao et al. | Nov 2018 | A1 |
20180327756 | Zhang et al. | Nov 2018 | A1 |
20180346927 | Doudna et al. | Dec 2018 | A1 |
20180371497 | Gill et al. | Dec 2018 | A1 |
20190010481 | Joung et al. | Jan 2019 | A1 |
20190055543 | Tran et al. | Feb 2019 | A1 |
20190062734 | Cotta-Ramusino et al. | Feb 2019 | A1 |
20190093099 | Liu et al. | Mar 2019 | A1 |
20190185883 | Liu et al. | Jun 2019 | A1 |
20190218547 | Lee et al. | Jul 2019 | A1 |
20190225955 | Liu et al. | Jul 2019 | A1 |
20190233847 | Savage et al. | Aug 2019 | A1 |
20190241633 | Fotin-Mleczek et al. | Aug 2019 | A1 |
20190256842 | Liu et al. | Aug 2019 | A1 |
20190264202 | Church et al. | Aug 2019 | A1 |
20190276816 | Liu et al. | Sep 2019 | A1 |
20190322992 | Liu et al. | Oct 2019 | A1 |
20190352632 | Liu et al. | Nov 2019 | A1 |
20190367891 | Liu et al. | Dec 2019 | A1 |
20200010818 | Liu et al. | Jan 2020 | A1 |
20200010835 | Maianti et al. | Jan 2020 | A1 |
20200063127 | Lu et al. | Feb 2020 | A1 |
20200071722 | Liu et al. | Mar 2020 | A1 |
20200109398 | Rubens et al. | Apr 2020 | A1 |
20200172931 | Liu et al. | Jun 2020 | A1 |
20200181619 | Tang et al. | Jun 2020 | A1 |
20200190493 | Liu et al. | Jun 2020 | A1 |
20200216833 | Liu et al. | Jul 2020 | A1 |
20200255868 | Liu et al. | Aug 2020 | A1 |
20200277587 | Liu et al. | Sep 2020 | A1 |
20200323984 | Liu et al. | Oct 2020 | A1 |
20200399619 | Maianti et al. | Dec 2020 | A1 |
20200399626 | Liu et al. | Dec 2020 | A1 |
20210054416 | Liu et al. | Feb 2021 | A1 |
20210115428 | Maianti et al. | Apr 2021 | A1 |
20210196809 | Maianti et al. | Jul 2021 | A1 |
20210198330 | Liu et al. | Jul 2021 | A1 |
20210214698 | Liu et al. | Jul 2021 | A1 |
20210230577 | Liu et al. | Jul 2021 | A1 |
20210254127 | Liu et al. | Aug 2021 | A1 |
20210315994 | Liu et al. | Oct 2021 | A1 |
20210317440 | Liu et al. | Oct 2021 | A1 |
20220033785 | Liu et al. | Feb 2022 | A1 |
20220119785 | Liu et al. | Apr 2022 | A1 |
20220170013 | Liu et al. | Jun 2022 | A1 |
20220177877 | Church et al. | Jun 2022 | A1 |
20220204975 | Liu et al. | Jun 2022 | A1 |
20220213507 | Liu et al. | Jul 2022 | A1 |
20220220462 | Liu et al. | Jul 2022 | A1 |
20220238182 | Shen et al. | Jul 2022 | A1 |
20220249697 | Liu et al. | Aug 2022 | A1 |
20220282275 | Liu et al. | Sep 2022 | A1 |
20220290115 | Liu et al. | Sep 2022 | A1 |
20220307001 | Liu et al. | Sep 2022 | A1 |
20220307003 | Liu et al. | Sep 2022 | A1 |
20220315906 | Liu et al. | Oct 2022 | A1 |
20220356469 | Liu et al. | Nov 2022 | A1 |
Number | Date | Country |
---|---|---|
2012244264 | Nov 2012 | AU |
2012354062 | Jul 2014 | AU |
2015252023 | Nov 2015 | AU |
2015101792 | Jan 2016 | AU |
112015013786 | Jul 2017 | BR |
2894668 | Jun 2014 | CA |
2894681 | Jun 2014 | CA |
2894684 | Jun 2014 | CA |
2 852 593 | Nov 2015 | CA |
1069962 | Mar 1993 | CN |
101460619 | Jun 2009 | CN |
103224947 | Jul 2013 | CN |
103233028 | Aug 2013 | CN |
103388006 | Nov 2013 | CN |
103614415 | Mar 2014 | CN |
103642836 | Mar 2014 | CN |
103668472 | Mar 2014 | CN |
103820441 | May 2014 | CN |
103820454 | May 2014 | CN |
103911376 | Jul 2014 | CN |
103923911 | Jul 2014 | CN |
103981211 | Aug 2014 | CN |
103981212 | Aug 2014 | CN |
104004778 | Aug 2014 | CN |
104004782 | Aug 2014 | CN |
104017821 | Sep 2014 | CN |
104109687 | Oct 2014 | CN |
104178461 | Dec 2014 | CN |
104342457 | Feb 2015 | CN |
104404036 | Mar 2015 | CN |
104450774 | Mar 2015 | CN |
104480144 | Apr 2015 | CN |
104498493 | Apr 2015 | CN |
104504304 | Apr 2015 | CN |
104531704 | Apr 2015 | CN |
104531705 | Apr 2015 | CN |
104560864 | Apr 2015 | CN |
104561095 | Apr 2015 | CN |
104593418 | May 2015 | CN |
104593422 | May 2015 | CN |
104611370 | May 2015 | CN |
104651392 | May 2015 | CN |
104651398 | May 2015 | CN |
104651399 | May 2015 | CN |
104651401 | May 2015 | CN |
104673816 | Jun 2015 | CN |
104725626 | Jun 2015 | CN |
104726449 | Jun 2015 | CN |
104726494 | Jun 2015 | CN |
104745626 | Jul 2015 | CN |
104762321 | Jul 2015 | CN |
104805078 | Jul 2015 | CN |
104805099 | Jul 2015 | CN |
104805118 | Jul 2015 | CN |
104846010 | Aug 2015 | CN |
104894068 | Sep 2015 | CN |
104894075 | Sep 2015 | CN |
104928321 | Sep 2015 | CN |
105039339 | Nov 2015 | CN |
105039399 | Nov 2015 | CN |
105063061 | Nov 2015 | CN |
105087620 | Nov 2015 | CN |
105112422 | Dec 2015 | CN |
105112445 | Dec 2015 | CN |
105112519 | Dec 2015 | CN |
105121648 | Dec 2015 | CN |
105132427 | Dec 2015 | CN |
105132451 | Dec 2015 | CN |
105177038 | Dec 2015 | CN |
105177126 | Dec 2015 | CN |
105210981 | Jan 2016 | CN |
105219799 | Jan 2016 | CN |
105238806 | Jan 2016 | CN |
105255937 | Jan 2016 | CN |
105274144 | Jan 2016 | CN |
105296518 | Feb 2016 | CN |
105296537 | Feb 2016 | CN |
105316324 | Feb 2016 | CN |
105316327 | Feb 2016 | CN |
105316337 | Feb 2016 | CN |
105331607 | Feb 2016 | CN |
105331608 | Feb 2016 | CN |
105331609 | Feb 2016 | CN |
105331627 | Feb 2016 | CN |
105400773 | Mar 2016 | CN |
105400779 | Mar 2016 | CN |
105400810 | Mar 2016 | CN |
105441451 | Mar 2016 | CN |
105462968 | Apr 2016 | CN |
105463003 | Apr 2016 | CN |
105463027 | Apr 2016 | CN |
105492608 | Apr 2016 | CN |
105492609 | Apr 2016 | CN |
105505976 | Apr 2016 | CN |
105505979 | Apr 2016 | CN |
105518134 | Apr 2016 | CN |
105518135 | Apr 2016 | CN |
105518137 | Apr 2016 | CN |
105518138 | Apr 2016 | CN |
105518139 | Apr 2016 | CN |
105518140 | Apr 2016 | CN |
105543228 | May 2016 | CN |
105543266 | May 2016 | CN |
105543270 | May 2016 | CN |
105567688 | May 2016 | CN |
105567689 | May 2016 | CN |
105567734 | May 2016 | CN |
105567735 | May 2016 | CN |
105567738 | May 2016 | CN |
105593367 | May 2016 | CN |
105594664 | May 2016 | CN |
105602987 | May 2016 | CN |
105624146 | Jun 2016 | CN |
105624187 | Jun 2016 | CN |
105646719 | Jun 2016 | CN |
105647922 | Jun 2016 | CN |
105647962 | Jun 2016 | CN |
105647968 | Jun 2016 | CN |
105647969 | Jun 2016 | CN |
105671070 | Jun 2016 | CN |
105671083 | Jun 2016 | CN |
105695485 | Jun 2016 | CN |
105779448 | Jul 2016 | CN |
105779449 | Jul 2016 | CN |
105802980 | Jul 2016 | CN |
105821039 | Aug 2016 | CN |
105821040 | Aug 2016 | CN |
105821049 | Aug 2016 | CN |
105821072 | Aug 2016 | CN |
105821075 | Aug 2016 | CN |
105821116 | Aug 2016 | CN |
105838733 | Aug 2016 | CN |
105861547 | Aug 2016 | CN |
105861552 | Aug 2016 | CN |
105861554 | Aug 2016 | CN |
105886498 | Aug 2016 | CN |
105886534 | Aug 2016 | CN |
105886616 | Aug 2016 | CN |
105907758 | Aug 2016 | CN |
105907785 | Aug 2016 | CN |
105925608 | Sep 2016 | CN |
105934516 | Sep 2016 | CN |
105950560 | Sep 2016 | CN |
105950626 | Sep 2016 | CN |
105950633 | Sep 2016 | CN |
105950639 | Sep 2016 | CN |
105985985 | Oct 2016 | CN |
106011104 | Oct 2016 | CN |
106011150 | Oct 2016 | CN |
106011167 | Oct 2016 | CN |
106011171 | Oct 2016 | CN |
106032540 | Oct 2016 | CN |
106047803 | Oct 2016 | CN |
106047877 | Oct 2016 | CN |
106047930 | Oct 2016 | CN |
106086008 | Nov 2016 | CN |
106086028 | Nov 2016 | CN |
106086061 | Nov 2016 | CN |
106086062 | Nov 2016 | CN |
106109417 | Nov 2016 | CN |
106119275 | Nov 2016 | CN |
106119283 | Nov 2016 | CN |
106148286 | Nov 2016 | CN |
106148370 | Nov 2016 | CN |
106148416 | Nov 2016 | CN |
106167525 | Nov 2016 | CN |
106167808 | Nov 2016 | CN |
106167810 | Nov 2016 | CN |
106167821 | Nov 2016 | CN |
106172238 | Dec 2016 | CN |
106190903 | Dec 2016 | CN |
106191057 | Dec 2016 | CN |
106191061 | Dec 2016 | CN |
106191062 | Dec 2016 | CN |
106191064 | Dec 2016 | CN |
106191071 | Dec 2016 | CN |
106191099 | Dec 2016 | CN |
106191107 | Dec 2016 | CN |
106191113 | Dec 2016 | CN |
106191114 | Dec 2016 | CN |
106191116 | Dec 2016 | CN |
106191124 | Dec 2016 | CN |
106222177 | Dec 2016 | CN |
106222193 | Dec 2016 | CN |
106222203 | Dec 2016 | CN |
106244555 | Dec 2016 | CN |
106244557 | Dec 2016 | CN |
106244591 | Dec 2016 | CN |
106244609 | Dec 2016 | CN |
106282241 | Jan 2017 | CN |
106318934 | Jan 2017 | CN |
106318973 | Jan 2017 | CN |
106350540 | Jan 2017 | CN |
106367435 | Feb 2017 | CN |
106399306 | Feb 2017 | CN |
106399311 | Feb 2017 | CN |
106399360 | Feb 2017 | CN |
106399367 | Feb 2017 | CN |
106399375 | Feb 2017 | CN |
106399377 | Feb 2017 | CN |
106434651 | Feb 2017 | CN |
106434663 | Feb 2017 | CN |
106434688 | Feb 2017 | CN |
106434737 | Feb 2017 | CN |
106434748 | Feb 2017 | CN |
106434752 | Feb 2017 | CN |
106434782 | Feb 2017 | CN |
106446600 | Feb 2017 | CN |
106479985 | Mar 2017 | CN |
106480027 | Mar 2017 | CN |
106480036 | Mar 2017 | CN |
106480067 | Mar 2017 | CN |
106480080 | Mar 2017 | CN |
106480083 | Mar 2017 | CN |
106480097 | Mar 2017 | CN |
106544351 | Mar 2017 | CN |
106544353 | Mar 2017 | CN |
106544357 | Mar 2017 | CN |
106554969 | Apr 2017 | CN |
106566838 | Apr 2017 | CN |
106701763 | May 2017 | CN |
106701808 | May 2017 | CN |
106701818 | May 2017 | CN |
106701823 | May 2017 | CN |
106701830 | May 2017 | CN |
106754912 | May 2017 | CN |
106755026 | May 2017 | CN |
106755077 | May 2017 | CN |
106755088 | May 2017 | CN |
106755091 | May 2017 | CN |
106755097 | May 2017 | CN |
106755424 | May 2017 | CN |
106801056 | Jun 2017 | CN |
106834323 | Jun 2017 | CN |
106834341 | Jun 2017 | CN |
106834347 | Jun 2017 | CN |
106845151 | Jun 2017 | CN |
106868008 | Jun 2017 | CN |
106868031 | Jun 2017 | CN |
106906240 | Jun 2017 | CN |
106906242 | Jun 2017 | CN |
106916820 | Jul 2017 | CN |
106916852 | Jul 2017 | CN |
106939303 | Jul 2017 | CN |
106947750 | Jul 2017 | CN |
106947780 | Jul 2017 | CN |
106957830 | Jul 2017 | CN |
106957831 | Jul 2017 | CN |
106957844 | Jul 2017 | CN |
106957855 | Jul 2017 | CN |
106957858 | Jul 2017 | CN |
106967697 | Jul 2017 | CN |
106967726 | Jul 2017 | CN |
106978428 | Jul 2017 | CN |
106987570 | Jul 2017 | CN |
106987757 | Jul 2017 | CN |
107012164 | Aug 2017 | CN |
107012174 | Aug 2017 | CN |
107012213 | Aug 2017 | CN |
107012250 | Aug 2017 | CN |
107022562 | Aug 2017 | CN |
107034188 | Aug 2017 | CN |
107034218 | Aug 2017 | CN |
107034229 | Aug 2017 | CN |
107043775 | Aug 2017 | CN |
107043779 | Aug 2017 | CN |
107043787 | Aug 2017 | CN |
107058320 | Aug 2017 | CN |
107058328 | Aug 2017 | CN |
107058358 | Aug 2017 | CN |
107058372 | Aug 2017 | CN |
107083392 | Aug 2017 | CN |
107099533 | Aug 2017 | CN |
107099850 | Aug 2017 | CN |
107119053 | Sep 2017 | CN |
107119071 | Sep 2017 | CN |
107129999 | Sep 2017 | CN |
107130000 | Sep 2017 | CN |
107142272 | Sep 2017 | CN |
107142282 | Sep 2017 | CN |
107177591 | Sep 2017 | CN |
107177595 | Sep 2017 | CN |
107177625 | Sep 2017 | CN |
107177631 | Sep 2017 | CN |
107190006 | Sep 2017 | CN |
107190008 | Sep 2017 | CN |
107217042 | Sep 2017 | CN |
107217075 | Sep 2017 | CN |
107227307 | Oct 2017 | CN |
107227352 | Oct 2017 | CN |
107236737 | Oct 2017 | CN |
107236739 | Oct 2017 | CN |
107236741 | Oct 2017 | CN |
107245502 | Oct 2017 | CN |
107254485 | Oct 2017 | CN |
107266541 | Oct 2017 | CN |
107267515 | Oct 2017 | CN |
107287245 | Oct 2017 | CN |
107298701 | Oct 2017 | CN |
107299114 | Oct 2017 | CN |
107304435 | Oct 2017 | CN |
107312785 | Nov 2017 | CN |
107312793 | Nov 2017 | CN |
107312795 | Nov 2017 | CN |
107312798 | Nov 2017 | CN |
107326042 | Nov 2017 | CN |
107326046 | Nov 2017 | CN |
107354156 | Nov 2017 | CN |
107354173 | Nov 2017 | CN |
107356793 | Nov 2017 | CN |
107362372 | Nov 2017 | CN |
107365786 | Nov 2017 | CN |
107365804 | Nov 2017 | CN |
107384894 | Nov 2017 | CN |
107384922 | Nov 2017 | CN |
107384926 | Nov 2017 | CN |
107400677 | Nov 2017 | CN |
107418974 | Dec 2017 | CN |
107435051 | Dec 2017 | CN |
107435069 | Dec 2017 | CN |
107446922 | Dec 2017 | CN |
107446923 | Dec 2017 | CN |
107446924 | Dec 2017 | CN |
107446932 | Dec 2017 | CN |
107446951 | Dec 2017 | CN |
107446954 | Dec 2017 | CN |
107460196 | Dec 2017 | CN |
107474129 | Dec 2017 | CN |
107475300 | Dec 2017 | CN |
107488649 | Dec 2017 | CN |
107502608 | Dec 2017 | CN |
107502618 | Dec 2017 | CN |
107513531 | Dec 2017 | CN |
107519492 | Dec 2017 | CN |
107523567 | Dec 2017 | CN |
107523583 | Dec 2017 | CN |
107541525 | Jan 2018 | CN |
107557373 | Jan 2018 | CN |
107557378 | Jan 2018 | CN |
107557381 | Jan 2018 | CN |
107557390 | Jan 2018 | CN |
107557393 | Jan 2018 | CN |
107557394 | Jan 2018 | CN |
107557455 | Jan 2018 | CN |
107574179 | Jan 2018 | CN |
107586777 | Jan 2018 | CN |
107586779 | Jan 2018 | CN |
107604003 | Jan 2018 | CN |
107619829 | Jan 2018 | CN |
107619837 | Jan 2018 | CN |
107630006 | Jan 2018 | CN |
107630041 | Jan 2018 | CN |
107630042 | Jan 2018 | CN |
107630043 | Jan 2018 | CN |
107641631 | Jan 2018 | CN |
107653256 | Feb 2018 | CN |
107686848 | Feb 2018 | CN |
206970581 | Feb 2018 | CN |
107760652 | Mar 2018 | CN |
107760663 | Mar 2018 | CN |
107760684 | Mar 2018 | CN |
107760715 | Mar 2018 | CN |
107784200 | Mar 2018 | CN |
107794272 | Mar 2018 | CN |
107794276 | Mar 2018 | CN |
107815463 | Mar 2018 | CN |
107828738 | Mar 2018 | CN |
107828794 | Mar 2018 | CN |
107828826 | Mar 2018 | CN |
107828874 | Mar 2018 | CN |
107858346 | Mar 2018 | CN |
107858373 | Mar 2018 | CN |
107880132 | Apr 2018 | CN |
107881184 | Apr 2018 | CN |
107893074 | Apr 2018 | CN |
107893075 | Apr 2018 | CN |
107893076 | Apr 2018 | CN |
107893080 | Apr 2018 | CN |
107893086 | Apr 2018 | CN |
107904261 | Apr 2018 | CN |
107937427 | Apr 2018 | CN |
107937432 | Apr 2018 | CN |
107937501 | Apr 2018 | CN |
107974466 | May 2018 | CN |
107988229 | May 2018 | CN |
107988246 | May 2018 | CN |
107988256 | May 2018 | CN |
107988268 | May 2018 | CN |
108018316 | May 2018 | CN |
108034656 | May 2018 | CN |
108048466 | May 2018 | CN |
108102940 | Jun 2018 | CN |
108103090 | Jun 2018 | CN |
108103092 | Jun 2018 | CN |
108103098 | Jun 2018 | CN |
108103586 | Jun 2018 | CN |
108148835 | Jun 2018 | CN |
108148837 | Jun 2018 | CN |
108148873 | Jun 2018 | CN |
108192956 | Jun 2018 | CN |
108251423 | Jul 2018 | CN |
108251451 | Jul 2018 | CN |
108251452 | Jul 2018 | CN |
108342480 | Jul 2018 | CN |
108359691 | Aug 2018 | CN |
108359712 | Aug 2018 | CN |
108384784 | Aug 2018 | CN |
108396027 | Aug 2018 | CN |
108410877 | Aug 2018 | CN |
108410906 | Aug 2018 | CN |
108410907 | Aug 2018 | CN |
108410911 | Aug 2018 | CN |
108424931 | Aug 2018 | CN |
108441519 | Aug 2018 | CN |
108441520 | Aug 2018 | CN |
108486108 | Sep 2018 | CN |
108486111 | Sep 2018 | CN |
108486145 | Sep 2018 | CN |
108486146 | Sep 2018 | CN |
108486154 | Sep 2018 | CN |
108486159 | Sep 2018 | CN |
108486234 | Sep 2018 | CN |
108504657 | Sep 2018 | CN |
108504685 | Sep 2018 | CN |
108504693 | Sep 2018 | CN |
108546712 | Sep 2018 | CN |
108546717 | Sep 2018 | CN |
108546718 | Sep 2018 | CN |
108559730 | Sep 2018 | CN |
108559732 | Sep 2018 | CN |
108559745 | Sep 2018 | CN |
108559760 | Sep 2018 | CN |
108570479 | Sep 2018 | CN |
108588071 | Sep 2018 | CN |
108588123 | Sep 2018 | CN |
108588128 | Sep 2018 | CN |
108588182 | Sep 2018 | CN |
108610399 | Oct 2018 | CN |
108611364 | Oct 2018 | CN |
108624622 | Oct 2018 | CN |
108642053 | Oct 2018 | CN |
108642055 | Oct 2018 | CN |
108642077 | Oct 2018 | CN |
108642078 | Oct 2018 | CN |
108642090 | Oct 2018 | CN |
108690844 | Oct 2018 | CN |
108707604 | Oct 2018 | CN |
108707620 | Oct 2018 | CN |
108707621 | Oct 2018 | CN |
108707628 | Oct 2018 | CN |
108707629 | Oct 2018 | CN |
108715850 | Oct 2018 | CN |
108728476 | Nov 2018 | CN |
108728486 | Nov 2018 | CN |
108753772 | Nov 2018 | CN |
108753783 | Nov 2018 | CN |
108753813 | Nov 2018 | CN |
108753817 | Nov 2018 | CN |
108753832 | Nov 2018 | CN |
108753835 | Nov 2018 | CN |
108753836 | Nov 2018 | CN |
108795902 | Nov 2018 | CN |
108822217 | Nov 2018 | CN |
108823248 | Nov 2018 | CN |
108823249 | Nov 2018 | CN |
108823291 | Nov 2018 | CN |
108841845 | Nov 2018 | CN |
108853133 | Nov 2018 | CN |
108866093 | Nov 2018 | CN |
108893529 | Nov 2018 | CN |
108913664 | Nov 2018 | CN |
108913691 | Nov 2018 | CN |
108913714 | Nov 2018 | CN |
108913717 | Nov 2018 | CN |
109 517 841 | Mar 2019 | CN |
0264166 | Apr 1988 | EP |
0321201 | Jun 1989 | EP |
0519463 | Dec 1992 | EP |
2604255 | Jun 2013 | EP |
2840140 | Feb 2015 | EP |
2877490 | Jun 2015 | EP |
2966170 | Jan 2016 | EP |
3009511 | Apr 2016 | EP |
3031921 | Jun 2016 | EP |
3045537 | Jul 2016 | EP |
3 115 457 | Jan 2017 | EP |
3144390 | Mar 2017 | EP |
3199632 | Aug 2017 | EP |
3216867 | Sep 2017 | EP |
3252160 | Dec 2017 | EP |
3450553 | Dec 2019 | EP |
2740248 | Feb 2020 | ES |
2528177 | Jan 2016 | GB |
2 531 454 | Apr 2016 | GB |
2542653 | Mar 2017 | GB |
1208045 | Feb 2016 | HK |
2007-501626 | Feb 2007 | JP |
2008-515405 | May 2008 | JP |
2010-033344 | Feb 2010 | JP |
2010-535744 | Nov 2010 | JP |
2010-539929 | Dec 2010 | JP |
2011-081011 | Apr 2011 | JP |
2011-523353 | Aug 2011 | JP |
2012-525146 | Oct 2012 | JP |
2012-210172 | Nov 2012 | JP |
2012-531909 | Dec 2012 | JP |
2015-523856 | Aug 2015 | JP |
2015-532654 | Nov 2015 | JP |
2016-525888 | Sep 2016 | JP |
2016-534132 | Nov 2016 | JP |
2017-500035 | Jan 2017 | JP |
101584933 | Jan 2016 | KR |
2016-0050069 | May 2016 | KR |
20160133380 | Nov 2016 | KR |
20170037025 | Apr 2017 | KR |
20170037028 | Apr 2017 | KR |
101748575 | Jun 2017 | KR |
20170128137 | Nov 2017 | KR |
2018-0022465 | Mar 2018 | KR |
2016104674 | Aug 2017 | RU |
2634395 | Oct 2017 | RU |
2652899 | May 2018 | RU |
2015128057 | Mar 2019 | RU |
2015128098 | Mar 2019 | RU |
2687451 | May 2019 | RU |
2019112514 | Jun 2019 | RU |
2019127300 | Sep 2019 | RU |
2701850 | Oct 2019 | RU |
10201707569 | Oct 2017 | SG |
10201710486X | Jan 2018 | SG |
10201710487V | Jan 2018 | SG |
10201710488 | Jan 2018 | SG |
1608100 | Dec 2017 | TW |
2018-29773 | Aug 2018 | TW |
WO 9002809 | Mar 1990 | WO |
WO 1991003162 | Mar 1991 | WO |
WO 9116024 | Oct 1991 | WO |
WO 9117271 | Nov 1991 | WO |
WO 9117424 | Nov 1991 | WO |
WO 9206188 | Apr 1992 | WO |
WO 9206200 | Apr 1992 | WO |
WO 1992007065 | Apr 1992 | WO |
WO 1993015187 | Aug 1993 | WO |
WO 9324641 | Dec 1993 | WO |
WO 9418316 | Aug 1994 | WO |
WO 94026877 | Nov 1994 | WO |
WO 9604403 | Feb 1996 | WO |
WO 9610640 | Apr 1996 | WO |
WO 9832845 | Jul 1998 | WO |
WO 2001036452 | May 2001 | WO |
WO 2001038547 | May 2001 | WO |
WO 2002059296 | Aug 2002 | WO |
WO 2002068676 | Sep 2002 | WO |
WO 2002103028 | Dec 2002 | WO |
WO 2004007684 | Jan 2004 | WO |
WO 2005014791 | Feb 2005 | WO |
WO 2005019415 | Mar 2005 | WO |
WO 2006002547 | Jan 2006 | WO |
WO 2006042112 | Apr 2006 | WO |
WO 2007025097 | Mar 2007 | WO |
WO 07066923 | Jun 2007 | WO |
WO 2007136815 | Nov 2007 | WO |
WO 2007143574 | Dec 2007 | WO |
WO 08005529 | Jan 2008 | WO |
WO 2008108989 | Sep 2008 | WO |
WO 2009098290 | Aug 2009 | WO |
WO 2009134808 | Nov 2009 | WO |
WO 2010011961 | Jan 2010 | WO |
WO 2010028347 | Mar 2010 | WO |
WO 2010054108 | May 2010 | WO |
WO 2010054154 | May 2010 | WO |
WO 2010068289 | Jun 2010 | WO |
WO 2010075424 | Jul 2010 | WO |
WO 2010102257 | Sep 2010 | WO |
WO 2010129019 | Nov 2010 | WO |
WO 2010129023 | Nov 2010 | WO |
WO 2010132092 | Nov 2010 | WO |
WO 2010144150 | Dec 2010 | WO |
WO 2011002503 | Jan 2011 | WO |
WO 2011017293 | Feb 2011 | WO |
WO 2011053868 | May 2011 | WO |
WO 2011053982 | May 2011 | WO |
WO 2011068810 | Jun 2011 | WO |
WO 2011075627 | Jun 2011 | WO |
WO 2011091311 | Jul 2011 | WO |
WO 2011091396 | Jul 2011 | WO |
WO 2011109031 | Sep 2011 | WO |
WO 2011143124 | Nov 2011 | WO |
WO 2011147590 | Dec 2011 | WO |
WO 2011159369 | Dec 2011 | WO |
WO 2012054726 | Apr 2012 | WO |
WO 2012065043 | May 2012 | WO |
WO 2012088381 | Jun 2012 | WO |
WO 2012125445 | Sep 2012 | WO |
WO 2012138927 | Oct 2012 | WO |
WO 2012149470 | Nov 2012 | WO |
WO 2012158985 | Nov 2012 | WO |
WO 2012158986 | Nov 2012 | WO |
WO 2012164565 | Dec 2012 | WO |
WO 2012170930 | Dec 2012 | WO |
WO 2013012674 | Jan 2013 | WO |
WO 2013013105 | Jan 2013 | WO |
WO 2013039857 | Mar 2013 | WO |
WO 2013039861 | Mar 2013 | WO |
WO 2013045632 | Apr 2013 | WO |
WO 2013047844 | Apr 2013 | WO |
WO 2013066438 | May 2013 | WO |
WO 2013086441 | Jun 2013 | WO |
WO 2013086444 | Jun 2013 | WO |
WO 2013098244 | Jul 2013 | WO |
WO 2013119602 | Aug 2013 | WO |
WO 2013126794 | Aug 2013 | WO |
WO 2013130824 | Sep 2013 | WO |
WO 2013141680 | Sep 2013 | WO |
WO 2013142578 | Sep 2013 | WO |
WO 2013152359 | Oct 2013 | WO |
WO 2013160230 | Oct 2013 | WO |
WO 2013166315 | Nov 2013 | WO |
WO 2013169398 | Nov 2013 | WO |
WO 2013169802 | Nov 2013 | WO |
WO 2013176772 | Nov 2013 | WO |
WO 2013176915 | Nov 2013 | WO |
WO 2013176916 | Nov 2013 | WO |
WO 2013181440 | Dec 2013 | WO |
WO 2013186754 | Dec 2013 | WO |
WO 2013188037 | Dec 2013 | WO |
WO 2013188522 | Dec 2013 | WO |
WO 2013188638 | Dec 2013 | WO |
WO 2013192278 | Dec 2013 | WO |
WO 2013142378 | Jan 2014 | WO |
WO 2014004336 | Jan 2014 | WO |
WO 2014005042 | Jan 2014 | WO |
WO 2014011237 | Jan 2014 | WO |
WO 2014011901 | Jan 2014 | WO |
WO 2014018423 | Jan 2014 | WO |
WO 2014020608 | Feb 2014 | WO |
WO 2014022120 | Feb 2014 | WO |
WO 2014022702 | Feb 2014 | WO |
WO 2014036219 | Mar 2014 | WO |
WO 2014039513 | Mar 2014 | WO |
WO 2014039523 | Mar 2014 | WO |
WO 2014039585 | Mar 2014 | WO |
WO 2014039684 | Mar 2014 | WO |
WO 2014039692 | Mar 2014 | WO |
WO 2014039702 | Mar 2014 | WO |
WO 2014039872 | Mar 2014 | WO |
WO 2014039970 | Mar 2014 | WO |
WO 2014041327 | Mar 2014 | WO |
WO 2014043143 | Mar 2014 | WO |
WO 2014047103 | Mar 2014 | WO |
WO 2014055782 | Apr 2014 | WO |
WO 2014059173 | Apr 2014 | WO |
WO 2014059255 | Apr 2014 | WO |
WO 2014065596 | May 2014 | WO |
WO 2014066505 | May 2014 | WO |
WO 2014068346 | May 2014 | WO |
WO 2014070887 | May 2014 | WO |
WO 2014071006 | May 2014 | WO |
WO 2014071219 | May 2014 | WO |
WO 2014071235 | May 2014 | WO |
WO 2014072941 | May 2014 | WO |
WO 2014081729 | May 2014 | WO |
WO 2014081730 | May 2014 | WO |
WO 2014081855 | May 2014 | WO |
WO 2014082644 | Jun 2014 | WO |
WO 2014085261 | Jun 2014 | WO |
WO 2014085593 | Jun 2014 | WO |
WO 2014085830 | Jun 2014 | WO |
WO 2014089212 | Jun 2014 | WO |
WO 2014089290 | Jun 2014 | WO |
WO 2014089348 | Jun 2014 | WO |
WO 2014089513 | Jun 2014 | WO |
WO 2014089533 | Jun 2014 | WO |
WO 2014089541 | Jun 2014 | WO |
WO 2014093479 | Jun 2014 | WO |
WO 2014093595 | Jun 2014 | WO |
WO 2014093622 | Jun 2014 | WO |
WO 2014093635 | Jun 2014 | WO |
WO 2014093655 | Jun 2014 | WO |
WO 2014093661 | Jun 2014 | WO |
WO 2014093694 | Jun 2014 | WO |
WO 2014093701 | Jun 2014 | WO |
WO 2014093709 | Jun 2014 | WO |
WO 2014093712 | Jun 2014 | WO |
WO 2014093718 | Jun 2014 | WO |
WO 2014093736 | Jun 2014 | WO |
WO 2014093768 | Jun 2014 | WO |
WO 2014093852 | Jun 2014 | WO |
WO 2014096972 | Jun 2014 | WO |
WO 2014099744 | Jun 2014 | WO |
WO 2014099750 | Jun 2014 | WO |
WO 2014104878 | Jul 2014 | WO |
WO 2014110006 | Jul 2014 | WO |
WO 2014110552 | Jul 2014 | WO |
WO 2014113493 | Jul 2014 | WO |
WO 2014123967 | Aug 2014 | WO |
WO 2014124226 | Aug 2014 | WO |
WO 2014125668 | Aug 2014 | WO |
WO 2014127287 | Aug 2014 | WO |
WO 2014128324 | Aug 2014 | WO |
WO 2014128659 | Aug 2014 | WO |
WO 2014130706 | Aug 2014 | WO |
WO 2014130955 | Aug 2014 | WO |
WO 2014131833 | Sep 2014 | WO |
WO 2014138379 | Sep 2014 | WO |
WO 2014143381 | Sep 2014 | WO |
WO 2014144094 | Sep 2014 | WO |
WO 2014144155 | Sep 2014 | WO |
WO 2014144288 | Sep 2014 | WO |
WO 2014144592 | Sep 2014 | WO |
WO 2014144761 | Sep 2014 | WO |
WO 2014144951 | Sep 2014 | WO |
WO 2014145599 | Sep 2014 | WO |
WO 2014145736 | Sep 2014 | WO |
WO 2014150624 | Sep 2014 | WO |
WO 2014152432 | Sep 2014 | WO |
WO 2014152940 | Sep 2014 | WO |
WO 2014153118 | Sep 2014 | WO |
WO 2014153470 | Sep 2014 | WO |
WO 2014158593 | Oct 2014 | WO |
WO 2014161821 | Oct 2014 | WO |
WO 2014164466 | Oct 2014 | WO |
WO 2014165177 | Oct 2014 | WO |
WO 2014165349 | Oct 2014 | WO |
WO 2014165612 | Oct 2014 | WO |
WO 2014165707 | Oct 2014 | WO |
WO 2014165825 | Oct 2014 | WO |
WO 2014172458 | Oct 2014 | WO |
WO 2014172470 | Oct 2014 | WO |
WO 2014172489 | Oct 2014 | WO |
WO 2014173955 | Oct 2014 | WO |
WO 2014182700 | Nov 2014 | WO |
WO 2014183071 | Nov 2014 | WO |
WO 2014184143 | Nov 2014 | WO |
WO 2014184741 | Nov 2014 | WO |
WO 2014184744 | Nov 2014 | WO |
WO 2014186585 | Nov 2014 | WO |
WO 2014186686 | Nov 2014 | WO |
WO 2014190181 | Nov 2014 | WO |
WO 2014191128 | Dec 2014 | WO |
WO 2014191518 | Dec 2014 | WO |
WO 2014191521 | Dec 2014 | WO |
WO 2014191525 | Dec 2014 | WO |
WO 2014191527 | Dec 2014 | WO |
WO 2014193583 | Dec 2014 | WO |
WO 2014194190 | Dec 2014 | WO |
WO 2014197568 | Dec 2014 | WO |
WO 2014197748 | Dec 2014 | WO |
WO 2014199358 | Dec 2014 | WO |
WO 2014200659 | Dec 2014 | WO |
WO 2014201015 | Dec 2014 | WO |
WO 2014204578 | Dec 2014 | WO |
WO 2014204723 | Dec 2014 | WO |
WO 2014204724 | Dec 2014 | WO |
WO 2014204725 | Dec 2014 | WO |
WO 2014204726 | Dec 2014 | WO |
WO 2014204727 | Dec 2014 | WO |
WO 2014204728 | Dec 2014 | WO |
WO 2014204729 | Dec 2014 | WO |
WO 2014205192 | Dec 2014 | WO |
WO 2014207043 | Dec 2014 | WO |
WO 2015002780 | Jan 2015 | WO |
WO 2015004241 | Jan 2015 | WO |
WO 2015006290 | Jan 2015 | WO |
WO 2015006294 | Jan 2015 | WO |
WO 2015006437 | Jan 2015 | WO |
WO 2015006498 | Jan 2015 | WO |
WO 2015006747 | Jan 2015 | WO |
WO 2015007194 | Jan 2015 | WO |
WO 2015010114 | Jan 2015 | WO |
WO 2015011483 | Jan 2015 | WO |
WO 2015013583 | Jan 2015 | WO |
WO 2015017866 | Feb 2015 | WO |
WO 2015018503 | Feb 2015 | WO |
WO 2015021353 | Feb 2015 | WO |
WO 2015021426 | Feb 2015 | WO |
WO 2015021990 | Feb 2015 | WO |
WO 2015024017 | Feb 2015 | WO |
WO 2015024986 | Feb 2015 | WO |
WO 2015026883 | Feb 2015 | WO |
WO 2015026885 | Feb 2015 | WO |
WO 2015026886 | Feb 2015 | WO |
WO 2015026887 | Feb 2015 | WO |
WO 2015027134 | Feb 2015 | WO |
WO 2015028969 | Mar 2015 | WO |
WO 2015030881 | Mar 2015 | WO |
WO 2015031619 | Mar 2015 | WO |
WO 2015031775 | Mar 2015 | WO |
WO 2015032494 | Mar 2015 | WO |
WO 2015033293 | Mar 2015 | WO |
WO 2015034872 | Mar 2015 | WO |
WO 2015034885 | Mar 2015 | WO |
WO 2015035136 | Mar 2015 | WO |
WO 2015035139 | Mar 2015 | WO |
WO 2015035162 | Mar 2015 | WO |
WO 2015040075 | Mar 2015 | WO |
WO 2015040402 | Mar 2015 | WO |
WO 2015042585 | Mar 2015 | WO |
WO 2015048577 | Apr 2015 | WO |
WO 2015048690 | Apr 2015 | WO |
WO 2015048707 | Apr 2015 | WO |
WO 2015048801 | Apr 2015 | WO |
WO 2015049897 | Apr 2015 | WO |
WO 2015051191 | Apr 2015 | WO |
WO 2015052133 | Apr 2015 | WO |
WO 2015052231 | Apr 2015 | WO |
WO 2015052335 | Apr 2015 | WO |
WO 2015053995 | Apr 2015 | WO |
WO 2015054253 | Apr 2015 | WO |
WO 2015054315 | Apr 2015 | WO |
WO 2015057671 | Apr 2015 | WO |
WO 2015057834 | Apr 2015 | WO |
WO 2015057852 | Apr 2015 | WO |
WO 2015057976 | Apr 2015 | WO |
WO 2015057980 | Apr 2015 | WO |
WO 2015059265 | Apr 2015 | WO |
WO 2015065964 | May 2015 | WO |
WO 2015066119 | May 2015 | WO |
WO 2015066634 | May 2015 | WO |
WO 2015066636 | May 2015 | WO |
WO 2015066637 | May 2015 | WO |
WO 2015066638 | May 2015 | WO |
WO 2015066643 | May 2015 | WO |
WO 2015069682 | May 2015 | WO |
WO 2015070083 | May 2015 | WO |
WO 2015070193 | May 2015 | WO |
WO 2015070212 | May 2015 | WO |
WO 2015071474 | May 2015 | WO |
WO 2015073683 | May 2015 | WO |
WO 2015073867 | May 2015 | WO |
WO 2015073990 | May 2015 | WO |
WO 2015075056 | May 2015 | WO |
WO 2015075154 | May 2015 | WO |
WO 2015075175 | May 2015 | WO |
WO 2015075195 | May 2015 | WO |
WO 2015075557 | May 2015 | WO |
WO 2015077058 | May 2015 | WO |
WO 2015077290 | May 2015 | WO |
WO 2015077318 | May 2015 | WO |
WO 2015079056 | Jun 2015 | WO |
WO 2015079057 | Jun 2015 | WO |
WO 2015086795 | Jun 2015 | WO |
WO 2015086798 | Jun 2015 | WO |
WO 2015088643 | Jun 2015 | WO |
WO 2015089046 | Jun 2015 | WO |
WO 2015089077 | Jun 2015 | WO |
WO 2015089277 | Jun 2015 | WO |
WO 2015089351 | Jun 2015 | WO |
WO 2015089354 | Jun 2015 | WO |
WO 2015089364 | Jun 2015 | WO |
WO 2015089406 | Jun 2015 | WO |
WO 2015089419 | Jun 2015 | WO |
WO 2015089427 | Jun 2015 | WO |
WO 2015089462 | Jun 2015 | WO |
WO 2015089465 | Jun 2015 | WO |
WO 2015089473 | Jun 2015 | WO |
WO 2015089486 | Jun 2015 | WO |
WO 2015095804 | Jun 2015 | WO |
WO 2015099850 | Jul 2015 | WO |
WO 2015100929 | Jul 2015 | WO |
WO 2015103057 | Jul 2015 | WO |
WO 2015103153 | Jul 2015 | WO |
WO 2015105928 | Jul 2015 | WO |
WO 2015108993 | Jul 2015 | WO |
WO 2015109752 | Jul 2015 | WO |
WO 2015110474 | Jul 2015 | WO |
WO 2015112790 | Jul 2015 | WO |
WO 2015112896 | Jul 2015 | WO |
WO 2015113063 | Jul 2015 | WO |
WO 2015114365 | Aug 2015 | WO |
WO 2015115903 | Aug 2015 | WO |
WO 2015116686 | Aug 2015 | WO |
WO 2015116969 | Aug 2015 | WO |
WO 2015117021 | Aug 2015 | WO |
WO 2015117041 | Aug 2015 | WO |
WO 2015117081 | Aug 2015 | WO |
WO 2015118156 | Aug 2015 | WO |
WO 2015119941 | Aug 2015 | WO |
WO 2015121454 | Aug 2015 | WO |
WO 2015122967 | Aug 2015 | WO |
WO 2015123339 | Aug 2015 | WO |
WO 2015124715 | Aug 2015 | WO |
WO 2015124718 | Aug 2015 | WO |
WO 2015126927 | Aug 2015 | WO |
WO 2015127428 | Aug 2015 | WO |
WO 2015127439 | Aug 2015 | WO |
WO 2015129686 | Sep 2015 | WO |
WO 2015131101 | Sep 2015 | WO |
WO 2015133554 | Sep 2015 | WO |
WO 2015134121 | Sep 2015 | WO |
WO 2015134812 | Sep 2015 | WO |
WO 2015136001 | Sep 2015 | WO |
WO 2015138510 | Sep 2015 | WO |
WO 2015138739 | Sep 2015 | WO |
WO 2015138855 | Sep 2015 | WO |
WO 2015138870 | Sep 2015 | WO |
WO 2015139008 | Sep 2015 | WO |
WO 2015139139 | Sep 2015 | WO |
WO 2015143046 | Sep 2015 | WO |
WO 2015143177 | Sep 2015 | WO |
WO 2015145417 | Oct 2015 | WO |
WO 2015148431 | Oct 2015 | WO |
WO 2015148670 | Oct 2015 | WO |
WO 2015148680 | Oct 2015 | WO |
WO 2015148761 | Oct 2015 | WO |
WO 2015148860 | Oct 2015 | WO |
WO 2015148863 | Oct 2015 | WO |
WO 2015153760 | Oct 2015 | WO |
WO 2015153780 | Oct 2015 | WO |
WO 2015153789 | Oct 2015 | WO |
WO 2015153791 | Oct 2015 | WO |
WO 2015153889 | Oct 2015 | WO |
WO 2015153940 | Oct 2015 | WO |
WO 2015155341 | Oct 2015 | WO |
WO 2015155686 | Oct 2015 | WO |
WO 2015157070 | Oct 2015 | WO |
WO 2015157534 | Oct 2015 | WO |
WO 2015159068 | Oct 2015 | WO |
WO 2015159086 | Oct 2015 | WO |
WO 2015159087 | Oct 2015 | WO |
WO 2015160683 | Oct 2015 | WO |
WO 2015161276 | Oct 2015 | WO |
WO 2015163733 | Oct 2015 | WO |
WO 2015164740 | Oct 2015 | WO |
WO 2015164748 | Oct 2015 | WO |
WO 2015165274 | Nov 2015 | WO |
WO 2015165275 | Nov 2015 | WO |
WO 2015165276 | Nov 2015 | WO |
WO 2015166272 | Nov 2015 | WO |
WO 2015167766 | Nov 2015 | WO |
WO 2015167956 | Nov 2015 | WO |
WO 2015168125 | Nov 2015 | WO |
WO 2015168158 | Nov 2015 | WO |
WO 2015168404 | Nov 2015 | WO |
WO 2015168547 | Nov 2015 | WO |
WO 2015168800 | Nov 2015 | WO |
WO 2015171603 | Nov 2015 | WO |
WO 2015171894 | Nov 2015 | WO |
WO 2015171932 | Nov 2015 | WO |
WO 2015172128 | Nov 2015 | WO |
WO 2015173436 | Nov 2015 | WO |
WO 2015175642 | Nov 2015 | WO |
WO 2015179540 | Nov 2015 | WO |
WO 2015183025 | Dec 2015 | WO |
WO 2015183026 | Dec 2015 | WO |
WO 2015183885 | Dec 2015 | WO |
WO 2015184259 | Dec 2015 | WO |
WO 2015184262 | Dec 2015 | WO |
WO 2015184268 | Dec 2015 | WO |
WO 2015188056 | Dec 2015 | WO |
WO 2015188065 | Dec 2015 | WO |
WO 2015188094 | Dec 2015 | WO |
WO 2015188109 | Dec 2015 | WO |
WO 2015188132 | Dec 2015 | WO |
WO 2015188135 | Dec 2015 | WO |
WO 2015188191 | Dec 2015 | WO |
WO 2015189693 | Dec 2015 | WO |
WO 2015191693 | Dec 2015 | WO |
WO 2015191899 | Dec 2015 | WO |
WO 2015191911 | Dec 2015 | WO |
WO 2015193858 | Dec 2015 | WO |
WO 2015195547 | Dec 2015 | WO |
WO 2015195621 | Dec 2015 | WO |
WO 2015195798 | Dec 2015 | WO |
WO 2015198020 | Dec 2015 | WO |
WO 2015200334 | Dec 2015 | WO |
WO 2015200378 | Dec 2015 | WO |
WO 2015200555 | Dec 2015 | WO |
WO 2015200805 | Dec 2015 | WO |
WO 2016001978 | Jan 2016 | WO |
WO 2016004010 | Jan 2016 | WO |
WO 2016004318 | Jan 2016 | WO |
WO 2016007347 | Jan 2016 | WO |
WO 2016007604 | Jan 2016 | WO |
WO 2016007948 | Jan 2016 | WO |
WO 2016011080 | Jan 2016 | WO |
WO 2016011210 | Jan 2016 | WO |
WO 2016011428 | Jan 2016 | WO |
WO 2016012544 | Jan 2016 | WO |
WO 2016012552 | Jan 2016 | WO |
WO 2016014409 | Jan 2016 | WO |
WO 2016014565 | Jan 2016 | WO |
WO 2016014794 | Jan 2016 | WO |
WO 2016014837 | Jan 2016 | WO |
WO 2016016119 | Feb 2016 | WO |
WO 2016016358 | Feb 2016 | WO |
WO 2016019144 | Feb 2016 | WO |
WO 2016020399 | Feb 2016 | WO |
WO 2016021972 | Feb 2016 | WO |
WO 2016021973 | Feb 2016 | WO |
WO 2016022363 | Feb 2016 | WO |
WO 2016022866 | Feb 2016 | WO |
WO 2016022931 | Feb 2016 | WO |
WO 2016025131 | Feb 2016 | WO |
WO 2016025469 | Feb 2016 | WO |
WO 2016025759 | Feb 2016 | WO |
WO 2016026444 | Feb 2016 | WO |
WO 2016028682 | Feb 2016 | WO |
WO 2016028843 | Feb 2016 | WO |
WO 2016028887 | Feb 2016 | WO |
WO 2016033088 | Mar 2016 | WO |
WO 2016033230 | Mar 2016 | WO |
WO 2016033246 | Mar 2016 | WO |
WO 2016033298 | Mar 2016 | WO |
WO 2016035044 | Mar 2016 | WO |
WO 2016036754 | Mar 2016 | WO |
WO 2016037157 | Mar 2016 | WO |
WO 2016040030 | Mar 2016 | WO |
WO 2016040594 | Mar 2016 | WO |
WO 2016044182 | Mar 2016 | WO |
WO 2016044416 | Mar 2016 | WO |
WO 2016046635 | Mar 2016 | WO |
WO 2016049024 | Mar 2016 | WO |
WO 2016049163 | Mar 2016 | WO |
WO 2016049230 | Mar 2016 | WO |
WO 2016049251 | Mar 2016 | WO |
WO 2016049258 | Mar 2016 | WO |
WO 2016053397 | Apr 2016 | WO |
WO 2016054326 | Apr 2016 | WO |
WO 2016057061 | Apr 2016 | WO |
WO 2016057821 | Apr 2016 | WO |
WO 2016057835 | Apr 2016 | WO |
WO 2016057850 | Apr 2016 | WO |
WO 2016057951 | Apr 2016 | WO |
WO 2016057961 | Apr 2016 | WO |
WO 2016061073 | Apr 2016 | WO |
WO 2016061374 | Apr 2016 | WO |
WO 2016061481 | Apr 2016 | WO |
WO 2016061523 | Apr 2016 | WO |
WO 2016064894 | Apr 2016 | WO |
WO 2016065364 | Apr 2016 | WO |
WO 2016069282 | May 2016 | WO |
WO 2016069283 | May 2016 | WO |
WO 2016069591 | May 2016 | WO |
WO 2016069774 | May 2016 | WO |
WO 2016069910 | May 2016 | WO |
WO 2016069912 | May 2016 | WO |
WO 2016070037 | May 2016 | WO |
WO 2016070070 | May 2016 | WO |
WO 2016070129 | May 2016 | WO |
WO 2016072399 | May 2016 | WO |
WO 2016072936 | May 2016 | WO |
WO 2016073433 | May 2016 | WO |
WO 2016073559 | May 2016 | WO |
WO 2016073990 | May 2016 | WO |
WO 2016075662 | May 2016 | WO |
WO 2016076672 | May 2016 | WO |
WO 2016077273 | May 2016 | WO |
WO 2016077350 | May 2016 | WO |
WO 2016080097 | May 2016 | WO |
WO 2016080795 | May 2016 | WO |
WO 2016081923 | May 2016 | WO |
WO 2016081924 | May 2016 | WO |
WO 2016082135 | Jun 2016 | WO |
WO 2016083811 | Jun 2016 | WO |
WO 2016084084 | Jun 2016 | WO |
WO 2016084088 | Jun 2016 | WO |
WO 2016086177 | Jun 2016 | WO |
WO 2016089433 | Jun 2016 | WO |
WO 2016089866 | Jun 2016 | WO |
WO 2016089883 | Jun 2016 | WO |
WO 2016090385 | Jun 2016 | WO |
WO 2016094679 | Jun 2016 | WO |
WO 2016094845 | Jun 2016 | WO |
WO 2016094867 | Jun 2016 | WO |
WO 2016094872 | Jun 2016 | WO |
WO 2016094874 | Jun 2016 | WO |
WO 2016094880 | Jun 2016 | WO |
WO 2016094888 | Jun 2016 | WO |
WO 2016097212 | Jun 2016 | WO |
WO 2016097231 | Jun 2016 | WO |
WO 2016097751 | Jun 2016 | WO |
WO 2016099887 | Jun 2016 | WO |
WO 2016100272 | Jun 2016 | WO |
WO 2016100389 | Jun 2016 | WO |
WO 2016100568 | Jun 2016 | WO |
WO 2016100571 | Jun 2016 | WO |
WO 2016100951 | Jun 2016 | WO |
WO 2016100955 | Jun 2016 | WO |
WO 2016100974 | Jun 2016 | WO |
WO 2016103233 | Jun 2016 | WO |
WO 2016104716 | Jun 2016 | WO |
WO 2016106236 | Jun 2016 | WO |
WO 2016106239 | Jun 2016 | WO |
WO 2016106244 | Jun 2016 | WO |
WO 2016106338 | Jun 2016 | WO |
WO 2016108926 | Jul 2016 | WO |
WO 2016109255 | Jul 2016 | WO |
WO 2016109840 | Jul 2016 | WO |
WO 2016110214 | Jul 2016 | WO |
WO 2016110453 | Jul 2016 | WO |
WO 2016110511 | Jul 2016 | WO |
WO 2016110512 | Jul 2016 | WO |
WO 2016111546 | Jul 2016 | WO |
WO 2016112242 | Jul 2016 | WO |
WO 2016112351 | Jul 2016 | WO |
WO 2016112963 | Jul 2016 | WO |
WO 2016113357 | Jul 2016 | WO |
WO 2016114972 | Jul 2016 | WO |
WO 2016115179 | Jul 2016 | WO |
WO 2016115326 | Jul 2016 | WO |
WO 2016115355 | Jul 2016 | WO |
WO 2016116032 | Jul 2016 | WO |
WO 2016120480 | Aug 2016 | WO |
WO 2016123071 | Aug 2016 | WO |
WO 2016123230 | Aug 2016 | WO |
WO 2016123243 | Aug 2016 | WO |
WO 2016123578 | Aug 2016 | WO |
WO 2016126747 | Aug 2016 | WO |
WO 2016130600 | Aug 2016 | WO |
WO 2016130697 | Aug 2016 | WO |
WO 2016131009 | Aug 2016 | WO |
WO 2016132122 | Aug 2016 | WO |
WO 2016133165 | Aug 2016 | WO |
WO 2016135507 | Sep 2016 | WO |
WO 2016135557 | Sep 2016 | WO |
WO 2016135558 | Sep 2016 | WO |
WO 2016135559 | Sep 2016 | WO |
WO 2016137774 | Sep 2016 | WO |
WO 2016137949 | Sep 2016 | WO |
WO 2016141224 | Sep 2016 | WO |
WO 2016141893 | Sep 2016 | WO |
WO 2016142719 | Sep 2016 | WO |
WO 2016145150 | Sep 2016 | WO |
WO 2016148994 | Sep 2016 | WO |
WO 2016149484 | Sep 2016 | WO |
WO 2016149547 | Sep 2016 | WO |
WO 2016150336 | Sep 2016 | WO |
WO 2016150855 | Sep 2016 | WO |
WO 2016154016 | Sep 2016 | WO |
WO 2016154579 | Sep 2016 | WO |
WO 2016154596 | Sep 2016 | WO |
WO 2016155482 | Oct 2016 | WO |
WO 2016161004 | Oct 2016 | WO |
WO 2016161207 | Oct 2016 | WO |
WO 2016161260 | Oct 2016 | WO |
WO 2016161380 | Oct 2016 | WO |
WO 2016161446 | Oct 2016 | WO |
WO 2016164356 | Oct 2016 | WO |
WO 2016164797 | Oct 2016 | WO |
WO 2016166340 | Oct 2016 | WO |
WO 2016167300 | Oct 2016 | WO |
WO 2016168631 | Oct 2016 | WO |
WO 2016170484 | Oct 2016 | WO |
WO 2016172359 | Oct 2016 | WO |
WO 2016172727 | Oct 2016 | WO |
WO 2016174056 | Nov 2016 | WO |
WO 2016174151 | Nov 2016 | WO |
WO 2016174250 | Nov 2016 | WO |
WO 2016176191 | Nov 2016 | WO |
WO 2016176404 | Nov 2016 | WO |
WO 2016176690 | Nov 2016 | WO |
WO 2016177682 | Nov 2016 | WO |
WO 2016178207 | Nov 2016 | WO |
WO 2016179038 | Nov 2016 | WO |
WO 2016179112 | Nov 2016 | WO |
WO 2016181357 | Nov 2016 | WO |
WO 2016182893 | Nov 2016 | WO |
WO 2016182917 | Nov 2016 | WO |
WO 2016182959 | Nov 2016 | WO |
WO 2016183236 | Nov 2016 | WO |
WO 2016183298 | Nov 2016 | WO |
WO 2016183345 | Nov 2016 | WO |
WO 2016183402 | Nov 2016 | WO |
WO 2016183438 | Nov 2016 | WO |
WO 2016183448 | Nov 2016 | WO |
WO 2016184955 | Nov 2016 | WO |
WO 2016184989 | Nov 2016 | WO |
WO 2016185411 | Nov 2016 | WO |
WO 2016186745 | Nov 2016 | WO |
WO 2016186772 | Nov 2016 | WO |
WO 2016186946 | Nov 2016 | WO |
WO 2016186953 | Nov 2016 | WO |
WO 2016187717 | Dec 2016 | WO |
WO 2016187904 | Dec 2016 | WO |
WO 2016191684 | Dec 2016 | WO |
WO 2016191869 | Dec 2016 | WO |
WO 2016196273 | Dec 2016 | WO |
WO 2016196282 | Dec 2016 | WO |
WO 2016196308 | Dec 2016 | WO |
WO 2016196361 | Dec 2016 | WO |
WO 2016196499 | Dec 2016 | WO |
WO 2016196539 | Dec 2016 | WO |
WO 2016196655 | Dec 2016 | WO |
WO 2016196805 | Dec 2016 | WO |
WO 2016196887 | Dec 2016 | WO |
WO 2016197132 | Dec 2016 | WO |
WO 2016197133 | Dec 2016 | WO |
WO 2016197354 | Dec 2016 | WO |
WO 2016197355 | Dec 2016 | WO |
WO 2016197356 | Dec 2016 | WO |
WO 2016197357 | Dec 2016 | WO |
WO 2016197358 | Dec 2016 | WO |
WO 2016197359 | Dec 2016 | WO |
WO 2016197360 | Dec 2016 | WO |
WO 2016197361 | Dec 2016 | WO |
WO 2016197362 | Dec 2016 | WO |
WO 2016198361 | Dec 2016 | WO |
WO 2016198500 | Dec 2016 | WO |
WO 2016200263 | Dec 2016 | WO |
WO 2016201047 | Dec 2016 | WO |
WO 2016201138 | Dec 2016 | WO |
WO 2016201152 | Dec 2016 | WO |
WO 2016201153 | Dec 2016 | WO |
WO 2016201155 | Dec 2016 | WO |
WO 2016205276 | Dec 2016 | WO |
WO 2016205613 | Dec 2016 | WO |
WO 2016205623 | Dec 2016 | WO |
WO 2016205680 | Dec 2016 | WO |
WO 2016205688 | Dec 2016 | WO |
WO 2016205703 | Dec 2016 | WO |
WO 2016205711 | Dec 2016 | WO |
WO 2016205728 | Dec 2016 | WO |
WO 2016205745 | Dec 2016 | WO |
WO 2016205749 | Dec 2016 | WO |
WO 2016205759 | Dec 2016 | WO |
WO 2016205764 | Dec 2016 | WO |
WO 2017001572 | Jan 2017 | WO |
WO 2017001988 | Jan 2017 | WO |
WO 2017004261 | Jan 2017 | WO |
WO 2017004279 | Jan 2017 | WO |
WO 2017004616 | Jan 2017 | WO |
WO 2017005807 | Jan 2017 | WO |
WO 2017009399 | Jan 2017 | WO |
WO 2017010556 | Jan 2017 | WO |
WO 2017011519 | Jan 2017 | WO |
WO 2017011721 | Jan 2017 | WO |
WO 2017011804 | Jan 2017 | WO |
WO 2017015015 | Jan 2017 | WO |
WO 2017015101 | Jan 2017 | WO |
WO 2017015545 | Jan 2017 | WO |
WO 2017015567 | Jan 2017 | WO |
WO 2017015637 | Jan 2017 | WO |
WO 2017017016 | Feb 2017 | WO |
WO 2017019867 | Feb 2017 | WO |
WO 2017019895 | Feb 2017 | WO |
WO 2017023803 | Feb 2017 | WO |
WO 2017023974 | Feb 2017 | WO |
WO 2017024047 | Feb 2017 | WO |
WO 2017024319 | Feb 2017 | WO |
WO 2017024343 | Feb 2017 | WO |
WO 2017024602 | Feb 2017 | WO |
WO 2017025323 | Feb 2017 | WO |
WO 2017027423 | Feb 2017 | WO |
WO 2017028768 | Feb 2017 | WO |
WO 2017029664 | Feb 2017 | WO |
WO 2017031360 | Feb 2017 | WO |
WO 2017031483 | Feb 2017 | WO |
WO 2017035416 | Mar 2017 | WO |
WO 2017040348 | Mar 2017 | WO |
WO 2017040511 | Mar 2017 | WO |
WO 2017040709 | Mar 2017 | WO |
WO 2017040786 | Mar 2017 | WO |
WO 2017040793 | Mar 2017 | WO |
WO 2017040813 | Mar 2017 | WO |
WO 2017043573 | Mar 2017 | WO |
WO 2017043656 | Mar 2017 | WO |
WO 2017044419 | Mar 2017 | WO |
WO 2017044776 | Mar 2017 | WO |
WO 2017044857 | Mar 2017 | WO |
WO 2017048390 | Mar 2017 | WO |
WO 2017049129 | Mar 2017 | WO |
WO 2017050963 | Mar 2017 | WO |
WO 2017053312 | Mar 2017 | WO |
WO 2017053431 | Mar 2017 | WO |
WO 2017053713 | Mar 2017 | WO |
WO 2017053729 | Mar 2017 | WO |
WO 2017053753 | Mar 2017 | WO |
WO 2017053762 | Mar 2017 | WO |
WO 2017053879 | Mar 2017 | WO |
WO 2017054721 | Apr 2017 | WO |
WO 2017058658 | Apr 2017 | WO |
WO 2017059241 | Apr 2017 | WO |
WO 2017062605 | Apr 2017 | WO |
WO 2017062723 | Apr 2017 | WO |
WO 2017062754 | Apr 2017 | WO |
WO 2017062855 | Apr 2017 | WO |
WO 2017062886 | Apr 2017 | WO |
WO 2017062983 | Apr 2017 | WO |
WO 2017064439 | Apr 2017 | WO |
WO 2017064546 | Apr 2017 | WO |
WO 2017064566 | Apr 2017 | WO |
WO 2017066175 | Apr 2017 | WO |
WO 2017066497 | Apr 2017 | WO |
WO 2017066588 | Apr 2017 | WO |
WO 2017066707 | Apr 2017 | WO |
WO 2017066781 | Apr 2017 | WO |
WO 2017068077 | Apr 2017 | WO |
WO 2017068377 | Apr 2017 | WO |
WO 2017069829 | Apr 2017 | WO |
WO 2017070029 | Apr 2017 | WO |
WO 2017070032 | Apr 2017 | WO |
WO 2017070169 | Apr 2017 | WO |
WO 2017070284 | Apr 2017 | WO |
WO 2017070598 | Apr 2017 | WO |
WO 2017070605 | Apr 2017 | WO |
WO 2017070632 | Apr 2017 | WO |
WO 2017070633 | Apr 2017 | WO |
WO 2017072590 | May 2017 | WO |
WO 2017074526 | May 2017 | WO |
WO 2017074962 | May 2017 | WO |
WO 2017075261 | May 2017 | WO |
WO 2017075335 | May 2017 | WO |
WO 2017075475 | May 2017 | WO |
WO 2017077135 | May 2017 | WO |
WO 2017077329 | May 2017 | WO |
WO 2017078751 | May 2017 | WO |
WO 2017079400 | May 2017 | WO |
WO 2017079428 | May 2017 | WO |
WO 2017079673 | May 2017 | WO |
WO 2017079724 | May 2017 | WO |
WO 2017081097 | May 2017 | WO |
WO 2017081288 | May 2017 | WO |
WO 2017083368 | May 2017 | WO |
WO 2017083722 | May 2017 | WO |
WO 2017083766 | May 2017 | WO |
WO 2017087395 | May 2017 | WO |
WO 2017090724 | Jun 2017 | WO |
WO 2017091510 | Jun 2017 | WO |
WO 2017091630 | Jun 2017 | WO |
WO 2017092201 | Jun 2017 | WO |
WO 2017093370 | Jun 2017 | WO |
WO 2017093969 | Jun 2017 | WO |
WO 2017095111 | Jun 2017 | WO |
WO 2017096041 | Jun 2017 | WO |
WO 2017096237 | Jun 2017 | WO |
WO 2017100158 | Jun 2017 | WO |
WO 2017100431 | Jun 2017 | WO |
WO 2017104404 | Jun 2017 | WO |
WO 2017105251 | Jun 2017 | WO |
WO 2017105350 | Jun 2017 | WO |
WO 2017105991 | Jun 2017 | WO |
WO 2017106414 | Jun 2017 | WO |
WO 2017106528 | Jun 2017 | WO |
WO 2017106537 | Jun 2017 | WO |
WO 2017106569 | Jun 2017 | WO |
WO 2017106616 | Jun 2017 | WO |
WO 2017106657 | Jun 2017 | WO |
WO 2017106767 | Jun 2017 | WO |
WO 2017109134 | Jun 2017 | WO |
WO 2017109757 | Jun 2017 | WO |
WO 2017112620 | Jun 2017 | WO |
WO 2017115268 | Jul 2017 | WO |
WO 2017117395 | Jul 2017 | WO |
WO 2017118598 | Jul 2017 | WO |
WO 2017118720 | Jul 2017 | WO |
WO 2017123609 | Jul 2017 | WO |
WO 2017123910 | Jul 2017 | WO |
WO 2017124086 | Jul 2017 | WO |
WO 2017124100 | Jul 2017 | WO |
WO 2017124652 | Jul 2017 | WO |
WO 2017126987 | Jul 2017 | WO |
WO 2017127807 | Jul 2017 | WO |
WO 2017131237 | Aug 2017 | WO |
WO 2017132112 | Aug 2017 | WO |
WO 2017132580 | Aug 2017 | WO |
WO 2017136520 | Aug 2017 | WO |
WO 2017136629 | Aug 2017 | WO |
WO 2017136794 | Aug 2017 | WO |
WO 2017139264 | Aug 2017 | WO |
WO 2017139505 | Aug 2017 | WO |
WO 2017141173 | Aug 2017 | WO |
WO 2017142835 | Aug 2017 | WO |
WO 2017142999 | Aug 2017 | WO |
WO 2017143042 | Aug 2017 | WO |
WO 2017147056 | Aug 2017 | WO |
WO 2017147278 | Aug 2017 | WO |
WO 2017147432 | Aug 2017 | WO |
WO 2017147446 | Aug 2017 | WO |
WO 2017147555 | Aug 2017 | WO |
WO 2017151444 | Sep 2017 | WO |
WO 2017151719 | Sep 2017 | WO |
WO 2017152015 | Sep 2017 | WO |
WO 2017155717 | Sep 2017 | WO |
WO 2017157422 | Sep 2017 | WO |
WO 2017158153 | Sep 2017 | WO |
WO 2017160689 | Sep 2017 | WO |
WO 2017160752 | Sep 2017 | WO |
WO 2017160890 | Sep 2017 | WO |
WO 2017161068 | Sep 2017 | WO |
WO 2017165826 | Sep 2017 | WO |
WO 2017165862 | Sep 2017 | WO |
WO 2017172644 | Oct 2017 | WO |
WO 2017172645 | Oct 2017 | WO |
WO 2017172860 | Oct 2017 | WO |
WO 2017173004 | Oct 2017 | WO |
WO 2017173054 | Oct 2017 | WO |
WO 2017173092 | Oct 2017 | WO |
WO 2017174329 | Oct 2017 | WO |
WO 2017176529 | Oct 2017 | WO |
WO 2017176806 | Oct 2017 | WO |
WO 2017178590 | Oct 2017 | WO |
WO 2017180694 | Oct 2017 | WO |
WO 2017180711 | Oct 2017 | WO |
WO 2017180915 | Oct 2017 | WO |
WO 2017180926 | Oct 2017 | WO |
WO 2017181107 | Oct 2017 | WO |
WO 2017181735 | Oct 2017 | WO |
WO 2017182468 | Oct 2017 | WO |
WO 2017184334 | Oct 2017 | WO |
WO 2017184768 | Oct 2017 | WO |
WO 2017184786 | Oct 2017 | WO |
WO 2017186550 | Nov 2017 | WO |
WO 2017189308 | Nov 2017 | WO |
WO 2017189336 | Nov 2017 | WO |
WO 2017190041 | Nov 2017 | WO |
WO 2017190257 | Nov 2017 | WO |
WO 2017190664 | Nov 2017 | WO |
WO 2017191210 | Nov 2017 | WO |
WO 2017191274 | Nov 2017 | WO |
WO 2017192172 | Nov 2017 | WO |
WO 2017192512 | Nov 2017 | WO |
WO 2017192544 | Nov 2017 | WO |
WO 2017192573 | Nov 2017 | WO |
WO 2017193029 | Nov 2017 | WO |
WO 2017193053 | Nov 2017 | WO |
WO 2017196768 | Nov 2017 | WO |
WO 2017197038 | Nov 2017 | WO |
WO 2017197238 | Nov 2017 | WO |
WO 2017197301 | Nov 2017 | WO |
WO 2017201476 | Nov 2017 | WO |
WO 2017205290 | Nov 2017 | WO |
WO 2017205423 | Nov 2017 | WO |
WO 2017207589 | Dec 2017 | WO |
WO 2017208247 | Dec 2017 | WO |
WO 2017209809 | Dec 2017 | WO |
WO 2017213896 | Dec 2017 | WO |
WO 2017213898 | Dec 2017 | WO |
WO 2017214460 | Dec 2017 | WO |
WO 2017216392 | Dec 2017 | WO |
WO 2017216771 | Dec 2017 | WO |
WO 2017218185 | Dec 2017 | WO |
WO 2017219027 | Dec 2017 | WO |
WO 2017219033 | Dec 2017 | WO |
WO 2017220751 | Dec 2017 | WO |
WO 2017222370 | Dec 2017 | WO |
WO 2017222773 | Dec 2017 | WO |
WO 2017222834 | Dec 2017 | WO |
WO 2017223107 | Dec 2017 | WO |
WO 2017223330 | Dec 2017 | WO |
WO 2018000657 | Jan 2018 | WO |
WO 2018002719 | Jan 2018 | WO |
WO 2018005117 | Jan 2018 | WO |
WO 2018005289 | Jan 2018 | WO |
WO 2018005691 | Jan 2018 | WO |
WO 2018005782 | Jan 2018 | WO |
WO 2018005873 | Jan 2018 | WO |
WO 201806693 | Jan 2018 | WO |
WO 2018009520 | Jan 2018 | WO |
WO 2018009562 | Jan 2018 | WO |
WO 2018009822 | Jan 2018 | WO |
WO 2018013821 | Jan 2018 | WO |
WO 2018013932 | Jan 2018 | WO |
WO 2018013990 | Jan 2018 | WO |
WO 2018014384 | Jan 2018 | WO |
WO 2018015444 | Jan 2018 | WO |
WO 2018015936 | Jan 2018 | WO |
WO 2018017754 | Jan 2018 | WO |
WO 2018018979 | Feb 2018 | WO |
WO 2018020248 | Feb 2018 | WO |
WO 2018021878 | Feb 2018 | WO |
WO 2018022480 | Feb 2018 | WO |
WO 2018022634 | Feb 2018 | WO |
WO 2018025206 | Feb 2018 | WO |
WO 2018026723 | Feb 2018 | WO |
WO 2018026976 | Feb 2018 | WO |
WO 2018027078 | Feb 2018 | WO |
WO 2018030608 | Feb 2018 | WO |
WO 2018031683 | Feb 2018 | WO |
WO 2018035250 | Feb 2018 | WO |
WO 2018035300 | Feb 2018 | WO |
WO 2018035423 | Feb 2018 | WO |
WO 2018035503 | Feb 2018 | WO |
WO 2018039145 | Mar 2018 | WO |
WO 2018039438 | Mar 2018 | WO |
WO 2018039440 | Mar 2018 | WO |
WO 2018039448 | Mar 2018 | WO |
WO 2018045630 | Mar 2018 | WO |
WO 2018048827 | Mar 2018 | WO |
WO 2018049073 | Mar 2018 | WO |
WO 2018049168 | Mar 2018 | WO |
WO 2018051347 | Mar 2018 | WO |
WO 2018058064 | Mar 2018 | WO |
WO 2018062866 | Apr 2018 | WO |
WO 2018064352 | Apr 2018 | WO |
WO 2018064371 | Apr 2018 | WO |
WO 2018064516 | Apr 2018 | WO |
WO 2018067546 | Apr 2018 | WO |
WO 2018067846 | Apr 2018 | WO |
WO 2018068053 | Apr 2018 | WO |
WO 2018069474 | Apr 2018 | WO |
WO 2018071623 | Apr 2018 | WO |
WO 2018071663 | Apr 2018 | WO |
WO 2018071868 | Apr 2018 | WO |
WO 2018071892 | Apr 2018 | WO |
WO 2018074979 | Apr 2018 | WO |
WO 2018079134 | May 2018 | WO |
WO 2018080573 | May 2018 | WO |
WO 2018081504 | May 2018 | WO |
WO 2018081535 | May 2018 | WO |
WO 2018081728 | May 2018 | WO |
WO 2018083128 | May 2018 | WO |
WO 2018083606 | May 2018 | WO |
WO 2018085288 | May 2018 | WO |
WO 2018085414 | May 2018 | WO |
WO 2018086623 | May 2018 | WO |
WO 2018089664 | May 2018 | WO |
WO 2018093990 | May 2018 | WO |
WO 2018098383 | May 2018 | WO |
WO 2018098480 | May 2018 | WO |
WO 2018098587 | Jun 2018 | WO |
WO 2018099256 | Jun 2018 | WO |
WO 2018103686 | Jun 2018 | WO |
WO 2018106268 | Jun 2018 | WO |
WO 2018107028 | Jun 2018 | WO |
WO 2018107103 | Jun 2018 | WO |
WO 2018107129 | Jun 2018 | WO |
WO 2018108272 | Jun 2018 | WO |
WO 2018109101 | Jun 2018 | WO |
WO 2018111946 | Jun 2018 | WO |
WO 2018111947 | Jun 2018 | WO |
WO 2018112336 | Jun 2018 | WO |
WO 2018112446 | Jun 2018 | WO |
WO 2018119354 | Jun 2018 | WO |
WO 2018119359 | Jun 2018 | WO |
WO 2018120283 | Jul 2018 | WO |
WO 2018130830 | Jul 2018 | WO |
WO 2018135838 | Jul 2018 | WO |
WO 2018136396 | Jul 2018 | WO |
WO 2018138385 | Aug 2018 | WO |
WO 2018142364 | Aug 2018 | WO |
WO 2018148246 | Aug 2018 | WO |
WO 2018148256 | Aug 2018 | WO |
WO 2018148647 | Aug 2018 | WO |
WO 2018149418 | Aug 2018 | WO |
WO 2018149888 | Aug 2018 | WO |
WO 2018149915 | Aug 2018 | WO |
WO 2018152197 | Aug 2018 | WO |
WO 2018152418 | Aug 2018 | WO |
WO 2018154380 | Aug 2018 | WO |
WO 2018154387 | Aug 2018 | WO |
WO 2018154412 | Aug 2018 | WO |
WO 2018154413 | Aug 2018 | WO |
WO 2018154418 | Aug 2018 | WO |
WO 2018154439 | Aug 2018 | WO |
WO 2018154459 | Aug 2018 | WO |
WO 2018154462 | Aug 2018 | WO |
WO 2018156372 | Aug 2018 | WO |
WO 2018156824 | Aug 2018 | WO |
WO 2018161009 | Sep 2018 | WO |
WO 2018165504 | Sep 2018 | WO |
WO 2018165629 | Sep 2018 | WO |
WO 2018170015 | Sep 2018 | WO |
WO 2018170340 | Sep 2018 | WO |
WO 2018175502 | Sep 2018 | WO |
WO 2018176009 | Sep 2018 | WO |
WO 2018177351 | Oct 2018 | WO |
WO 2018179578 | Oct 2018 | WO |
WO 2018183403 | Oct 2018 | WO |
WO 2018189184 | Oct 2018 | WO |
WO 2018191388 | Oct 2018 | WO |
WO 2018195402 | Oct 2018 | WO |
WO 2018195545 | Oct 2018 | WO |
WO 2018195555 | Oct 2018 | WO |
WO 2018197020 | Nov 2018 | WO |
WO 2018197495 | Nov 2018 | WO |
WO 2018202800 | Nov 2018 | WO |
WO 2018204493 | Nov 2018 | WO |
WO 2018208755 | Nov 2018 | WO |
WO 2018208998 | Nov 2018 | WO |
WO 2018209158 | Nov 2018 | WO |
WO 2018209320 | Nov 2018 | WO |
WO 2018213351 | Nov 2018 | WO |
WO 2018213708 | Nov 2018 | WO |
WO 2018213726 | Nov 2018 | WO |
WO 2018213771 | Nov 2018 | WO |
WO 2018213791 | Nov 2018 | WO |
WO 2018217852 | Nov 2018 | WO |
WO 2018217981 | Nov 2018 | WO |
WO 2018218166 | Nov 2018 | WO |
WO 2018218188 | Nov 2018 | WO |
WO 2018218206 | Nov 2018 | WO |
WO 2019005884 | Jan 2019 | WO |
WO 2019005886 | Jan 2019 | WO |
WO 2019010384 | Jan 2019 | WO |
WO 2019023680 | Jan 2019 | WO |
WO 2019051097 | Mar 2019 | WO |
WO 2019079347 | Apr 2019 | WO |
WO 2019084062 | May 2019 | WO |
WO 2019090367 | May 2019 | WO |
WO 2019092042 | May 2019 | WO |
WO 2019118935 | Jun 2019 | WO |
WO 2019118949 | Jun 2019 | WO |
WO 2019123430 | Jun 2019 | WO |
WO 2019139645 | Jul 2019 | WO |
WO 2019139951 | Jul 2019 | WO |
WO 2019147014 | Aug 2019 | WO |
WO 2019161251 | Aug 2019 | WO |
WO 2019168953 | Sep 2019 | WO |
WO 2019226953 | Nov 2019 | WO |
WO 2019236566 | Dec 2019 | WO |
WO 2020014261 | Jan 2020 | WO |
WO 2020028555 | Feb 2020 | WO |
WO 2020041751 | Feb 2020 | WO |
WO 2020047124 | Mar 2020 | WO |
WO 2020051360 | Mar 2020 | WO |
WO 2020086908 | Apr 2020 | WO |
WO 2020092453 | May 2020 | WO |
WO 2020102659 | May 2020 | WO |
WO 2020154500 | Jul 2020 | WO |
WO 2020157008 | Aug 2020 | WO |
WO 2020180975 | Sep 2020 | WO |
WO 2020181178 | Sep 2020 | WO |
WO 2020181180 | Sep 2020 | WO |
WO 2020181193 | Sep 2020 | WO |
WO 2020181195 | Sep 2020 | WO |
WO 2020181202 | Sep 2020 | WO |
WO 2020191153 | Sep 2020 | WO |
WO 2020191171 | Sep 2020 | WO |
WO 2020191233 | Sep 2020 | WO |
WO 2020191234 | Sep 2020 | WO |
WO 2020191239 | Sep 2020 | WO |
WO 2020191241 | Sep 2020 | WO |
WO 2020191242 | Sep 2020 | WO |
WO 2020191243 | Sep 2020 | WO |
WO 2020191245 | Sep 2020 | WO |
WO 2020191246 | Sep 2020 | WO |
WO 2020191248 | Sep 2020 | WO |
WO 2020191249 | Sep 2020 | WO |
WO 2020210751 | Oct 2020 | WO |
WO 2020214842 | Oct 2020 | WO |
WO 2020236982 | Nov 2020 | WO |
WO 2021025750 | Feb 2021 | WO |
WO 2021030666 | Feb 2021 | WO |
WO 2021072328 | Apr 2021 | WO |
WO 2021108717 | Jun 2021 | WO |
WO 2021155065 | Aug 2021 | WO |
WO 2021158921 | Aug 2021 | WO |
WO 2021158995 | Aug 2021 | WO |
WO 2021158999 | Aug 2021 | WO |
WO 2021222318 | Nov 2021 | WO |
WO 2021226558 | Nov 2021 | WO |
Entry |
---|
Bertolotti, Roger, Molecular Therapy, May 2015, vol. 23, Supp. SPPL.1, p. S139, Abstract No. 350. |
U.S. Appl. No. 61/716,256, filed Oct. 19, 2012, Jinek et al. |
U.S. Appl. No. 61/717,324, filed Oct. 23, 2012, Cho et al. |
U.S. Appl. No. 61/734,256, filed Dec. 6, 2012, Chen et al. |
U.S. Appl. No. 61/758,624, filed Jan. 30, 2013, Chen et al. |
U.S. Appl. No. 61/761,046, filed Feb. 5, 2013, Knight et al. |
U.S. Appl. No. 61/794,422, filed Mar. 15, 2013, Knight et al. |
U.S. Appl. No. 61/803,599, filed Mar. 20, 2013, Kim et al. |
U.S. Appl. No. 61/837,481, filed Jun. 20, 2013, Cho et al. |
U.S. Appl. No. 61/838,178, filed Jun. 21, 2013, Joung et al. |
U.S. Appl. No. 61/874,682, filed Sep. 6, 2013, Liu et al. |
U.S. Appl. No. 61/874,746, filed Sep. 6, 2013, Liu et al. |
U.S. Appl. No. 62/288,661, filed Jan. 29, 2016, Muir et al. |
U.S. Appl. No. 62/357,332, filed Jun. 30, 2016, Liu et al. |
[No Author Listed] Score result for SEQ 355 to W02017032580. Muir et al. 2016. |
[No Author Listed], EMBL Accession No. Q99ZW2. Nov. 2012. 2 pages. |
[No Author Listed], Invitrogen Lipofectamine™ 2000 product sheets, 2002. 2 pages. |
[No Author Listed], Invitrogen Lipofectamine™ 2000 product sheets, 2005. 3 pages. |
[No Author Listed], Invitrogen Lipofectamine™ LTX product sheets, 2011. 4 pages. |
[No Author Listed], Thermo Fisher Scientific—How Cationic Lipid Mediated Transfection Works, retrieved from the internet Aug. 27, 2015. 2 pages. |
Abudayyeh et al., C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector. Science Aug. 2016;353(6299):aaf5573. DOI: 10.1126/science.aaf5573. |
Addgene Plasmid # 44246. pdCas9-humanized, 2017, Stanley Qi. |
Addgene Plasmid # 73021. PCMV-BE3, 2017, David Liu. |
Addgene Plasmid # 79620. pcDNA3.1_pCMV-nCas-PmCDA21-ugi pH1-gRNA(HPRT), 2017, Akihiko Kondo. |
Aihara et al., A conformational switch controls the DNA cleavage activity of lambda integrase. Mol Cell. Jul. 2003;12(1):187-98. |
Alexandrov et al., Signatures of mutational processes in human cancer. Nature. Aug. 22, 2013;500(7463):415-21. doi: 10.1038/naturel2477. Epub Aug. 14, 2013. |
Ames et al., A eubacterial riboswitch class that senses the coenzyme tetrahydrofolate. Chem Biol. Jul. 30, 2010;17(7):681-5. doi: 10.1016/j.chembiol.2010.05.020. |
Anders et al., Structural basis of PAM-dependent target DNA recognition by the Cas9 endonuclease. Nature. Sep. 25, 2014;513(7519):569-73. doi: 10.1038/nature13579. Epub Jul. 27, 2014. |
Arnold et al., Mutants of Tn3 resolvase which do not require accessory binding sites for recombination activity. EMBO J. Mar. 1, 1999;18(5):1407-14. |
Banerjee et al., Cadmium inhibits mismatch repair by blocking the A'lPase activity of the MSH2-MSH6 complex [published correction appears in Nucleic Acids Res. 2005;33(5):1738]. Nucleic Acids Res. 2005;33(4):1410-1419. Published Mar. 3, 2005. doi:10.1093/nar/gki291. |
Barnes et al., Repair and genetic consequences of endogenous DNA base damage in mammalian cells. Annu Rev Genet. 2004;38:445-76. |
Barrangou et al., CRISPR provides acquired resistance against viruses in prokaryotes. Science. Mar. 23, 2007;315(5819):1709-12. |
Barrangou, RNA-mediated programmable DNA cleavage. Nat Biotechnol. Sep. 2012;30(9):836-8. doi: 10.1038/nbt.2357. |
Basha et al., Influence of cationic lipid composition on gene silencing properties of lipid nanoparticle formulations of siRNA in antigen-presenting cells. Mol Ther. Dec. 2011;19(12):2186-200. doi: 10.1038/mt.2011.190. Epub Oct. 4, 2011. |
Batey et al., Structure of a natural guanine-responsive riboswitch complexed with the metabolite hypoxanthine. Nature. Nov. 18, 2004;432(7015):411-5. |
Beale et al., Comparison of the differential context-dependence of DNA deamination by APOBEC enzymes: correlation with mutation spectra in vivo. J Mol Biol. Mar. 26, 2004;337(3):585-96. |
Bedell et al., In vivo genome editing using a high-efficiency TALEN system. Nature. Nov. 1, 2012;491(7422):114-8. Doi: 10.1038/naturel 1537. Epub Sep. 23, 2012. |
Begley, Scientists unveil the ‘most clever CRISPR gadget’ so far. STAT, Apr. 20, 2016. https://www.statnews.com/2016/04/20/clever-crispr-advance-unveiled/. |
Bershtein et al., Advances in laboratory evolution of enzymes. Curr Opin; Chem Biol. Apr. 2008;12(2):151-8. doi: 10.1016/j.cbpa.2008.01.027. Epub Mar. 7, 2008. Review. |
Beumer et al., Efficient gene targeting in Drosophila with zinc-finger nucleases. Genetics. Apr. 2006;172(4):2391-403. Epub Feb. 1, 2006. |
Billon et al., CRISPR-Mediated Base Editing Enables Efficient Disruption of Eukaryotic Genes through Induction of STOP Codons. Mol Cell. Sep. 21, 2017;67(6):1068-1079.e4. doi: 10.1016/j.molcel.2017.08.008. Epub Sep. 7, 2017. |
Birling et al., Site-specific recombinases for manipulation of the mouse genome. Methods Mol Biol. 2009;561:245-63. doi: 10.1007/978-1-60327-019-9_16. |
Biswas et al., A structural basis for allosteric control of DNA recombination by lambda integrase. Nature. Jun. 23, 2005;435(7045):1059-66. doi: 10.1038/nature03657. |
Bitinaite et al., FokI dimerization is required for DNA cleavage. Proc Natl Acad Sci U S A. Sep. 1, 1998;95(18):10570-5. |
Boch, TALEs of genome targeting. Nat Biotechnol. Feb. 2011;29(2):135-6. Doi: 10.1038/nbt.1767. |
Böck et al., Selenocysteine: the 21st amino acid. Mol Microbiol. Mar. 1991;5(3):515-20. |
Boeckle et al., Melittin analogs with high lytic activity at endosomal pH enhance transfection with purified targeted PEI polyplexes. J Control Release. May 15, 2006; 112(2):240-8. Epub Mar. 20, 2006. |
Bogdanove et al., TAL effectors: customizable proteins for DNA targeting. Science. Sep. 30, 2011;333(6051):1843-6. doi: 10.1126/science. 1204094. |
Bohlke et al., Sense codon emancipation for proteome-wide incorporation of noncanonical amino acids: rare isoleucine codon AUA as a target for genetic code expansion. FEMS Microbiol Lett. Feb. 2014;351(2):133-44. doi: 10.1111/1574-6968.12371. Epub Jan. 27, 2014. |
Bolotin et al., Clustered regularly interspaced short palindrome repeats (CRISPRs) have spacers of extrachromosomal origin. Microbiology. Aug. 2005;151(Pt 8):2551-61. |
Borman, Improved route to single-base genome editing. Chemical & Engineering News, Apr. 25, 2016;94(17)p5. http://cen.acs.org/articles/94/i17/Improved-route-single-base-genome.html. |
Branden and Tooze, Introduction to Protein Structure. 1999; 2nd edition. Garland Science Publisher: 3-12. |
Briner et al., Guide RNA functional modules direct Cas9 activity and orthogonality. Mol Cell. Oct. 23, 2014;56(2):333-339. doi: 10.1016/j.molcel.2014.09.019. |
Britt et al., Re-engineering plant gene targeting. Trends Plant Sci. Feb. 2003;8(2):90-5. |
Brouns et al., Small CRISPR RNAs guide antiviral defense in prokaryotes. Science. Aug. 15, 2008;321(5891):960-4. doi: 10.1126/science.1159689. |
Brown et al., Serine recombinases as tools for genome engineering. Methods. Apr. 2011;53(4):372-9. doi: 10.1016/j.ymeth.2010.12.031. Epub Dec. 30, 2010. |
Brusse et al., Spinocerebellar ataxia associated with a mutation in the fibroblast growth factor 14 gene (SCA27): A new phenotype. Mov Disord. Mar. 2006;21(3):396-401. |
Buchholz et al., Alteration of Cre recombinase site specificity by substrate-linked protein evolution. Nat Biotechnol. Nov. 2001;19(11):1047-52. |
Buchwald et al., Long-term, continuous intravenous heparin administration by an implantable infusion pump in ambulatory patients with recurrent venous thrombosis. Surgery. Oct. 1980;88(4):507-16. |
Budisa et al., Residue-specific bioincorporation of non-natural, biologically active amino acids into proteins as possible drug carriers: structure and stability of the per-thiaproline mutant of annexin V. Proc Natl Acad Sci U S A. Jan. 20, 1998;95(2):455-9. |
Budker et al., Protein/amphipathic polyamine complexes enable highly efficient transfection with minimal toxicity. Biotechniques. Jul. 1997;23(1):139, 142-7. doi: 10.2144/97231rr02. |
Bulow et al., Multienzyme systems obtained by gene fusion. Trends Biotechnol. Jul. 1991;9(7):226-31. |
Burke et al., RNA Aptamers to the Adenosine Moiety of S-adenosyl Methionine: Structural Inferences From Variations on a Theme and the Reproducibility of SELEX. Nucleic Acids Res. May 15, 1997;25(10):2020-4. doi: 10.1093/nar/25.10.2020. |
Burstein et al., New CRISPR-Cas systems from uncultivated microbes. Nature Feb. 2017;542(7640):237-240. |
Buskirk et al., Directed evolution of ligand dependence: small-molecule-activated protein splicing. Proc Natl Acad Sci U S A. Jul. 20, 2004;101(29):10505-10. Epub Jul. 9, 2004. |
Cade et al., Highly efficient generation of heritable zebrafish gene mutations using homo- and heterodimeric TALENs. Nucleic Acids Res. Sep. 2012;40(16):8001-10. Doi: 10.1093/nar/gks518. Epub Jun. 7, 2012. |
Caldecott et al., Single-strand break repair and genetic disease. Nat Rev Genet. Aug. 2008;9(8):619-31. doi: 10.1038/nrg2380. |
Cameron, Recent advances in transgenic technology. Mol Biotechnol. Jun. 1997;7(3):253-65. |
Cargill et al. Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. Jul. 1999;22(3):231-8. |
Caron et al., Intracellular delivery of a Tat-eGFP fusion protein into muscle cells. Mol Ther. Mar. 2001;3(3):310-8. |
Carroll et al., Gene targeting in Drosophila and Caenorhabditis elegans with zinc-finger nucleases. Methods Mol Biol. 2008;435:63-77. doi: 10.1007/978-1-59745-232-8_5. |
Carroll et al., Progress and prospects: zinc-finger nucleases as gene therapy agents. Gene Ther. Nov. 2008;15(22):1463-8. doi: 10.1038/gt.2008.145. Epub Sep. 11, 2008. |
Carroll, A Crispr approach to gene targeting. Mol Ther. Sep. 2012;20(9):1658-60. doi: 10.1038/mt.2012.171. |
Carroll, Genome engineering with zinc-finger nucleases. Genetics. Aug. 2011;188(4):773-82. doi: 10.1534/genetics.111.131433. Review. |
Cermak et al., Efficient design and assembly of custom TALEN and other TAL effecto-rbased constructs for DNA targeting. Nucleic Acids Res. Jul. 2011;39(12):e82. Doi: 10.1093/nar/gkr218. Epub Apr. 14, 2011. |
Chadwick et al., In Vivo Base Editing of PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) as a Therapeutic Alternative to Genome Editing. Arterioscler Thromb Vasc Biol. Sep. 2017;37(9):1741-1747. doi: 10.1161/ATVBAHA.117.309881. Epub Jul. 27, 2017. |
Chaikind et al., A programmable Cas9-serine recombinase fusion protein that operates on DNA sequences in mammalian cells. Nucleic Acids Res. Nov. 16, 2016;44(20):9758-9770. Epub Aug. 11, 2016. |
Charpentier et al., Biotechnology: Rewriting a genome. Nature. Mar. 7, 2013;495(7439):50-1. doi: 10.1038/495050a. |
Chavez et al., Highly efficient Cas9-mediated transcriptional programming. Nat Methods. Apr. 2015;12(4):326-8. doi: 10.1038/nmeth.3312. Epub Mar. 2, 2015. |
Chavez et al., Precise Cas9 targeting enables genomic mutation prevention. Proc Natl Acad Sci U S A. Apr. 3, 2018;115(14):3669-3673. doi: 10.1073/pnas.l718148115. Epub Mar. 1, 20189. bioRxiv preprint first posted online Jun. 14, 2016. |
Chelico et al., Biochemical basis of immunological and retroviral responses to DNA-targeted cytosine deamination by activation-induced cytidine deaminase and APOBEC3G. J Biol Chem. Oct. 9, 2009;284(41):27761-5. doi: 10.1074/jbc.R109.052449. Epub Aug. 13, 2009. |
Chelico et al., Stochastic properties of processive cytidine DNA deaminases AID and APOBEC3G. Philos Trans R Soc Lond B Biol Sci. Mar. 12, 2009;364(1517):583-93. doi: 10.1098/rstb.2008.0195. |
Chen et al., Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. Oct. 2013;65(10):1357-69. doi: 10.1016/j.addr.2012.09.039. Epub Sep. 29, 2012. |
Chen et al., Structure of the DNA deaminase domain of the HIV-1 restriction factor APOBEC3G. Nature. Mar. 6, 2008;452(7183):116-9. doi: 10.1038/nature06638. Epub Feb. 20, 2008. |
Chesnoy et al., Structure and function of lipid-DNA complexes for gene delivery. Annu Rev Biophys Biomol Struct. 2000;29:27-47. |
Chew et al., A multifunctional AAV-CRISPR-Cas9 and its host response. Nat Methods. Oct. 2016;13(10):868-74. doi: 10.1038/nmeth.3993. Epub Sep. 5, 2016. |
Chichili et al., Linkers in the structural biology of protein-protein interactions. Protein Science. 2013;22:153-67. |
Chipev et al., A leucine—proline mutation in the H1 subdomain of keratin 1 causes epidermolytic hyperkeratosis. Cell. Sep. 4, 1992;70(5):821-8. |
Cho et al., Analysis of off-target effects of CRISPR/Cas-derived RNA-guided endonucleases and nickases. Genome Res. Jan. 2014;24(1):132-41. doi: 10.1101/gr. 162339.113. Epub Nov. 19, 2013. |
Cho et al., Targeted genome engineering in human cells with the Cas9 RNA-guided endonuclease. Nat Biotechnol. Mar. 2013;31(3):230-2. doi: 10.1038/nbt.2507. Epub Jan. 29, 2013. |
Christian et al., Targeting G with TAL effectors: a comparison of activities of TALENs constructed with NN and NK repeat variable di-residues. PLoS One. 2012;7(9):e45383. doi: 10.1371/journal.pone.0045383. Epub Sep. 24, 2012. |
Christian et al., Targeting DNA double-strand breaks with TAL effector nucleases. Genetics. Oct. 2010;186(2):757-61. Doi: 10.1534/genetics.110.120717. Epub Jul. 26, 2010. |
Chu et al., Increasing the efficiency of homology-directed repair for CRISPR-Cas9-induced precise gene editing in mammalian cells. Nat Biotech. Feb. 13, 2015;33:543-8. |
Chung-Il et al., Artificial control of gene expression in mammalian cells by modulating RNA interference through aptamer-small molecule interaction. RNA. May 2006;12(5):710-6. Epub Apr. 10, 2006. |
Chylinski et al., The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems. RNA Biol. May 2013;10(5):726-37. doi: 10.4161/rna.24321. Epub Apr. 5, 2013. |
Cobb et al., Directed evolution as a powerful synthetic biology tool. Methods. Mar. 15, 2013;60(1):81-90. doi: 10.1016/j.ymeth.2012.03.009. Epub Mar. 23, 2012. |
Cole-Strauss et al., Correction of the mutation responsible for sickle cell anemia by an RNA-DNA oligonucleotide. Science. Sep. 6, 1996;273(5280):1386-9. |
Cong et al., Multiplex genome engineering using CRISPR/Cas systems. Science. Feb. 15, 2013;339(6121):819-23. doi: 10.1126/science. 1231143. Epub Jan. 3, 2013. |
Conticello, The AID/APOBEC family of nucleic acid mutators. Genome Biol. 2008;9(6):229. doi: 10.1186/GB-2008-9-6-229. Epub Jun. 17, 2008. |
Covino et al., The CCL2/CCR2 Axis in the Pathogenesis of HIV-1 Infection: A New Cellular Target for Therapy? Current Drug Targets Dec. 2016;17(1):76-110. DOI: 10.2174/138945011701151217110917. |
Cox et al., Conditional gene expression in the mouse inner ear using Cre-loxP. J Assoc Res Otolaryngol. Jun. 2012;13(3):295-322. doi: 10.1007/sl0162-012-0324-5. Epub Apr. 24, 2012. |
Cox et al., Therapeutic genome editing: prospects and challenges. Nat Med. Feb. 2015;21(2):121-31. doi: 10.1038/nm.3793. |
Cradick et al., CRISPR/Cas9 systems targeting β-globin and CCR5 genes have substantial off-target activity. Nucleic Acids Res. Nov. 1. 2013;41(20):9584-92. doi: 10.1093/nar/gkt714. Epub Aug. 11, 2013. |
Cradick et al., ZFN-site searches genomes for zinc finger nuclease target sites and off-target sites. BMC Bioinformatics. May 13, 2011;12:152. doi: 10.1186/1471-2105-12-152. |
Cradick et al., Zinc-finger nucleases as a novel therapeutic strategy for targeting hepatitis B virus DNAs. Mol Ther. May 2010;18(5):947-54. Doi: 10.1038/mt.2010.20. Epub Feb. 16, 2010. |
Cui et al., Targeted integration in rat and mouse embryos with zinc-finger nucleases. Nat Biotechnol. Jan. 2011;29(1):64-7. Doi: 10.1038/nbt.1731. Epub Dec. 12, 2010. |
Cunningham et al., Ensembl 2015. Nucleic Acids Res. Jan. 2015;43(Database issue):D662-9. doi: 10.1093/nar/gku1010. Epub Oct. 28, 2014. |
D'Adda di Fagagna et al., The Gam protein of bacteriophage Mu is an orthologue of eukaryotic Ku. EMBO Rep. Jan. 2003;4(1):47-52. |
Dahlem et al., Simple methods for generating and detecting locus-specific mutations induced with TALENs in the zebrafish genome. PLoS Genet. 2012;8(8):e1002861. doi: 10.1371/journal.pgen.1002861. Epub Aug. 16, 2012. |
Davis et al., DNA double strand break repair via non-homologous end-joining. Transl Cancer Res. Jun. 2013;2(3):130-143. |
Davis et al., Small molecule-triggered Cas9 protein with improved genome-editing specificity. Nat Chem Biol. May 2015;11(5):316-8. doi: 10.1038/nchembio.1793. Epub Apr. 6, 2015. |
De Souza, Primer: genome editing with engineered nucleases. Nat Methods. Jan. 2012;9(1):27. |
Deltcheva et al., CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III. Nature. Mar. 31, 2011;471(7340):602-7. doi: 10.1038/nature09886. |
Dicarlo et al., Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic Acids Research Apr. 2013;41(7):4336-43. |
Ding et al., A Talen genome-editing system for generating human stem cell-based disease models. Cell Stem Cell. Feb. 7, 2013;12(2):238-51. Doi: 10.1016/j.stem.2012.11.011. Epub Dec. 13, 2012. |
Ding et al., Permanent alteration of PCSK9 with in vivo CRISPR-Cas9 genome editing. Circ Res. Aug. 15, 2014;115(5):488-92. doi: 10.1161/CIRCRESAHA.115.304351. Epub Jun. 10, 2014. |
Dixon et al., Reengineering orthogonally selective riboswitches. Proc Natl Acad Sci U S A. Feb. 16, 2010;107(7):2830-5. doi: 10.1073/pnas.0911209107. Epub Jan. 26, 2010. |
Doench et al., Optimized sgRNA design to maximize activity and minimize off-target effects of CRISPR-Cas9. Nat Biotechnol. Feb. 2016;34(2):184-191. doi: 10.1038/nbt.3437. |
Doudna et al., Genome editing. The new frontier of genome engineering with CRISPR-Cas9. Science. Nov. 28, 2014;346(6213):1258096. doi: 10.1126/science. 1258096. |
Doyon et al., Heritable targeted gene disruption in zebrafish using designed zinc-finger nucleases. Nat Biotechnol. Jun. 2008;26(6):702-8. Doi: 10.1038/nbtl409. Epub May 25, 2008. |
Dunaime, Breakthrough method means CRISPR just got a lot more relevant to human health. The Verge. Apr. 20, 2016. http://www.theverge.eom/2016/4/20/l 1450262/crispr-base-editing-single-nucleotides-dna-gene-liu-harvard. |
During et al., Controlled release of dopamine from a polymeric brain implant: in vivo characterization. Ann Neurol. Apr. 1989;25(4):351-6. |
East-Seletsky et al., Two distinct RNase activities of CRISPR-C2c2 enable guide-RNA processing and RNA detection. Nature Oct. 2016;538(7624):270-3. |
Edwards et al., An Escherichia coli tyrosine transfer RNA is a leucine-specific transfer RNA in the yeast Saccharomyces cerevisiae. Proc Natl Acad Sci U S A. Feb. 15, 1991;88(4):1153-6. |
Edwards et al., Crystal structures of the thi-box riboswitch bound to thiamine pyrophosphate analogs reveal adaptive RNA-small molecule recognition. Structure. Sep. 2006; 14(9):1459-68. |
Eiler et al., Structural Basis for the Fast Self-Cleavage Reaction Catalyzed by the Twister Ribozyme. Proc Natl Acad Sci U S A. Sep. 9, 2014; 111(36):13028-33. doi: 10.1073/pnas. 1414571111. Epub Aug. 25, 2014. |
Eltoukhy et al., Nucleic acid-mediated intracellular protein delivery by lipid-like nanoparticles. Biomaterials. Aug. 2014;35(24):6454-61. doi: 10.1016/j.biomaterials.2014.04.014. Epub May 13, 2014. |
Endo et al., Toward establishing an efficient and versatile gene targeting system in higher plants. Biocatalysis and Agricultural Biotechnology 2014;3,(1):2-6. |
Esvelt et al., A system for the continuous directed evolution of biomolecules. Nature. Apr. 28, 2011;472(7344):499-503. doi: 10.1038/nature09929. Epub Apr. 10, 2011. |
Esvelt et al., Genome-scale engineering for systems and synthetic biology. Mol Syst Biol. 2013;9:641. doi: 10.1038/msb.2012.66. |
Esvelt et al., Orthogonal Cas9 proteins for RNA-guided gene regulation and editing. Nat Methods. Nov. 2013;10(11):1116-21. doi: 10.1038/nmeth.2681. Epub Sep. 29, 2013. |
Fagerlund et al., The Cpf1 CRISPR-Cas protein expands genome-editing tools. Genome Biology Nov. 17, 2015;16:251. https://doi.org/10.1186/s13059-015-0824-9. |
Fang et al., Synthetic Studies Towards Halichondrins: Synthesis of the Left Halves of Norhalichondrins and Homohalichondrins. Tetrahedron Letters 1992;33(12):1557-1560. |
Farhood et al., Codelivery to mammalian cells of a transcriptional factor with cis-acting element using cationic liposomes. Anal Biochem. Feb. 10, 1995;225(1):89-93. |
Felletti et al., Twister Ribozymes as Highly Versatile Expression Platforms for Artificial Riboswitches. Nat Commun. Sep. 27, 2016;7:12834. doi: 10.1038/ncomms12834. |
Ferretti et al., Complete genome sequence of an MI strain of Streptococcus pyogenes. Proc Natl Acad Sci U S A. Apr. 10, 2001;98(8):4658-63. |
Ferry et al., Rational design of inducible CRISPR guide RNAs for de novo assembly of transcriptional programs. Nat Commun. Mar. 3, 2017;8:14633. doi: 10.1038/ncomms14633. |
Fine et al., Trans-spliced Cas9 allows cleavage of HBB and CCR5 genes in human cells using compact expression cassettes. Scientific Reports 2015;5(1):Article No. 10777. doi:10.1038/srep10777. With Supplementary Information. |
Fischer et al., Cryptic epitopes induce high-titer humoral immune response in patients with cancer. J Immunol. Sep. 1, 2010;185(5):3095-102. doi: 10.4049/jimmunol.0902166. Epub Jul. 26, 2010. |
Fogg et al., New applications for phage integrases. J Mol Biol. Jul. 29, 2014;426(15):2703-16. doi: 10.1016/j.jmb.2014.05.014. Epub May 22, 2014. |
Fonfara et al., Phylogeny of Cas9 determines functional exchangeability of dual-RNA and Cas9 among orthologous type II CRISPR-Cas systems. Nucleic Acids Res. Feb. 2014;42(4):2577-90. doi: 10.1093/nar/gkt1074. Epub Nov. 22, 2013. |
Freshney, Culture of Animal Cells. A Manual of Basic Technique. Alan R. Liss, Inc. New York. 1983;4. |
Fu et al., Improving CRISPR-Cas nuclease specificity using truncated guide RNAs. Nat Biotechnol. Mar. 2014;32(3):279-84. doi: 10.1038/nbt.2808. Epub Jan. 26, 2014. |
Fu et al., High-frequency off-target mutagenesis induced by CRISPR-Cas nucleases in human cells. Nat Biotechnol. Sep. 2013;31(9):822-6. doi: 10.1038/nbt.2623. Epub Jun. 23, 2013. |
Fuchs et al., Polyarginine as a multifunctional fusion tag. Protein Sci. Jun. 2005; 14(6):1538-44. |
Fujisawa et al., Disease-associated mutations in CIAS1 induce cathepsin B-dependent rapid cell death of human THP-1 monocytic cells. Blood. Apr. 1, 2007;109(7):2903-11. |
Fukui et al., DNA Mismatch Repair in Eukaryotes and Bacteria. J Nucleic Acids. Jul. 27, 2010;2010. pii: 260512. doi: 10.4061/2010/260512. |
Fung et al., Repair at single targeted DNA double-strand breaks in pluripotent and differentiated human cells. PLoS One. 2011;6(5):e20514. doi: 10.1371/journal.pone.0020514. Epub May 25, 2011. |
Gaj et al., A comprehensive approach to zinc-finger recombinase customization enables genomic targeting in human cells. Nucleic Acids Res. Feb. 6, 2013;41(6):3937-46. |
Gaj et al., Enhancing the specificity of recombinase-mediated genome engineering through dimer interface redesign. J Am Chem Soc. Apr. 2, 2014;136(13):5047-56. doi: 10.1021/ja4130059. Epub Mar. 20, 2014. |
Gaj et al., Expanding the scope of site-specific recombinases for genetic and metabolic engineering. Biotechnol Bioeng. Jan. 2014;111(1):1-15. doi: 10.1002/bit.25096. Epub Sep. 13, 2013. |
Gaj et al., ZFN, TALEN, and CRISPR/Cas-based methods for genome engineering. Trends Biotechnol. Jul. 2013;31(7):397-405. doi: 10.1016/j.tibtech.2013.04.004. Epub May 9, 2013. |
Gallo et al., A novel pathogenic PSEN1 mutation in a family with Alzheimer's disease: phenotypical and neuropathological features. J Alzheimers Dis. 2011;25(3):425-31. doi: 10.3233/JAD-2011-110185. |
Gao et al., DNA-guided genome editing using the Natronobacterium gregoryi Argonaute. Nat Biotechnol. Jul. 2016;34(7):768-73. doi: 10.1038/nbt.3547. Epub May 2, 2016. |
Gardlik et al., Vectors and delivery systems in gene therapy. Med Sci Monit. Apr. 2005;11(4):RA1 10-21. Epub Mar. 24, 2005. |
Garneau et al., The CRISPR/Cas bacterial immune system cleaves bacteriophage and plasmid DNA. Nature. Nov. 4, 2010;468(7320):67-71. doi: 10.1038/nature09523. |
Gasiunas et al., Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria. Proc Natl Acad Sci U S A. Sep. 25, 2012;109(39):E2579-86. Epub Sep. 4, 2012. Supplementary materials included. |
Gasiunas et al., RNA-dependent DNA endonuclease Cas9 of the CRISPR system: Holy Grail of genome editing? Trends Microbiol. Nov. 2013;21(11):562-7. doi: 10.1016/j.tim.2013.09.001. Epub Oct. 1, 2013. |
GENBANK Submission; NIH/NCBI, Accession No. J04623. Kita et al., Apr. 26, 1993. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NC_002737.1. Ferretti et al., Jun. 27, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NC_015683.1. Trost et al., Jul. 6, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NC_016782.1. Trost et al., Jun. 11, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NC_016786.1. Trost et al., Aug. 28, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NC_017053.1. Fittipaldi et al., Jul. 6, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NC_017317.1. Trost et al., Jun. 11, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NC_017861.1. Heidelberg et al., Jun. 11, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NC_018010.1. Lucas et al., Jun. 11, 2013. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NC_018721.1. Feng et al., Jun. 11, 2013. 1 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NC_021284.1. Ku et al., Jul. 12, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NC_021314.1. Zhang et al., Jul. 15, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NC_021846.1. Lo et al., Jul. 22, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NM_174936. Guo et al., Oct. 28, 2015. 6 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NP_472073.1. Glaser et al., Jun. 27, 2013. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. P42212. Prasher et al., Mar. 19, 2014. 7 pages. |
GENBANK Submission; NIH/NCBI, Accession No. YP_002342100.1. Bernardini et al., Jun. 10, 2013. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. YP_002344900.1. Gundogdu et al., Mar. 19, 2014. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. YP_820832.1. Makarova et al., Aug. 27, 2013. 2 pages. |
Gerber et al., RNA editing by base deamination: more enzymes, more targets, new mysteries. Trends Biochem Sci. Jun. 2001;26(6):376-84. |
Gersbach et al., Directed evolution of recombinase specificity by split gene reassembly. Nucleic Acids Res. Jul. 2010;38(12):4198-206. doi: 10.1093/nar/gkql25. Epub Mar. 1, 2010. |
Gersbach et al., Targeted plasmid integration into the human genome by an engineered zinc-finger recombinase. Nucleic Acids Res. Sep. 1, 2011;39(17):7868-78. doi: 10.1093/nar/pkr421. Epub Jun. 7, 2011. |
Gilbert et al., CRISPR-mediated modular RNA-guided regulation of transcription in eukaryotes. Cell. 2013 154(2):442-51. |
Gilleron et al., Image-based analysis of lipid nanoparticle-mediated siRNA delivery, intracellular trafficking and endosomal escape. Nat Biotechnol. Jul. 2013;31(7):638-46. doi: 10.1038/nbt.2612. Epub Jun. 23, 2013. |
Gonzalez et al., An iCRISPR platform for rapid, multiplexable, and inducible genome editing in human pluripotent stem cells. Cell Stem Cell. Aug. 7, 2014;15(2):215-26. doi: 10.1016/j.stem.2014.05.018. Epub Jun. 12, 2014. |
Grainge et al., The integrase family of recombinase: organization and function of the active site. Mol Microbiol. Aug. 1999;33(3):449-56. |
Guilinger et al., Broad specificity profiling of TALENs results in engineered nucleases with improved DNA-cleavage specificity. Nat Methods. Apr. 2014;11(4):429-35. doi: 10.1038/nmeth.2845. Epub Feb. 16, 2014. |
Guilinger et al., Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat Biotechnol. Jun. 2014;32(6):577-82. doi: 10.1038/nbt.2909. Epub Apr. 25, 2014. |
Guo et al., Protein tolerance to random amino acid change. Proc Natl Acad Sci U S A. Jun. 22, 2004;101(25):9205-10. Epub Jun. 14, 2004. |
Haeussler et al., Evaluation of off-target and on-target scoring algorithms and integration into the guide RNA selection tool CRISPOR. Genome Biol. Jul. 5, 2016;17(1):148. doi: 10.1186/s13059-016-1012-2. |
Hale et al., RNA-guided RNA cleavage by a CRISPR RNA-Cas protein complex. Cell. Nov. 25, 2009;139(5):945-56. doi: 10.1016/j.cell.2009.07.040. |
Hamano-Takaku et al., A mutant Escherichia coli tyrosyl-tRNA synthetase utilizes the unnatural amino acid azatyrosine more efficiently than tyrosine. J Biol Chem. Dec. 22, 2000;275(51):40324-8. |
Han, New CRISPR/Cas9-based Tech Edits Single Nucleotides Without Breaking DNA. Genome Web, Apr. 20, 2016. https://www.genomeweb.com/gene-silencinggene-editing/new-crisprcas9-based-tech-edits-single-nucleotides-without-breaking-dna. |
Harrington et al., Recent developments and current status of gene therapy using viral vectors in the United Kingdom. BMJ. 2004;329(7470):839?842. doi:10.1136/bmj.329.7470.839. |
Harris et al., RNA Editing Enzyme APOBEC1 and Some of Its Homologs Can Act as DNA Mutators. Mol Cell. Nov. 2002;10(5):1247-53. |
Hartung et al., Correction of metabolic, craniofacial, and neurologic abnormalities in MPS I mice treated at birth with adeno-associated virus vector transducing the human alpha-L-iduronidase gene. Mol Ther. Jun. 2004;9(6):866-75. |
Hasadsri et al., Functional protein delivery into neurons using polymeric nanoparticles. J Biol Chem. Mar. 13, 2009;284(11):6972-81. doi: 10.1074/jbc.M805956200. Epub Jan. 7, 2009. |
Hayes et al., Stop codons preceded by rare arginine codons are efficient determinants of SsrA tagging in Escherichia coli. Proc Natl Acad Sci U S A. Mar. 19, 2002;99(6):3440-5. Epub Mar. 12, 2002. |
Heller et al., Replisome assembly and the direct restart of stalled replication forks. Nat Rev Mol Cell Biol. Dec. 2006;7(12):932-43. Epub Nov. 8, 2006. |
Hess et al., Directed evolution using dCas9-targeted somatic hypermutation in mammalian cells. Nat Methods. Dec. 2016;13(12):1036-1042. doi: 10.1038/nmeth.4038. Epub Oct. 31, 2016. |
Hickford et al., Antitumour polyether macrolides: four new halichondrins from the New Zealand deep-water marine sponge Lissodendoryx sp. Bioorg Med Chem. Mar. 15, 2009;17(6):2199-203. doi: 10.1016/j.bmc.2008.10.093. Epub Nov. 19, 2008. |
Hida et al., Directed evolution for drug and nucleic acid; delivery. Adv Drug Deliv Rev. Dec. 22, 2007;59(15):1562-78. Epub Aug. 28, 2007.; Review. |
Hill et al., Functional analysis of conserved histidines in ADP-glucose pyrophosphorylase from Escherichia coli.Biochem Biophys Res Commun. Mar. 17, 1998;244(2):573-7. |
Hilton et al., Enabling functional genomics with genome engineering. Genome Res. Oct. 2015;25(10):1442-55. doi: 10.1101/gr.190124.115. |
Hirano et al., Structural Basis for the Altered PAM Specificities of Engineered CRISPR-Cas9. Mol Cell. Mar. 17, 2016;61(6):886-94. doi: 10.1016/j.molcel.2016.02.018. |
Hockemeyer et al., Efficient targeting of expressed and silent genes in human ESCs and iPSCs using zinc-finger nucleases. Nat Biotechnol. Sep. 2009;27(9):851-7. doi: 10.1038/nbt.1562. Epub Aug. 13, 2009. |
Hockemeyer et al., Genetic engineering of human pluripotent cells using TALE nucleases. Nat Biotechnol. Jul. 7, 2011;29(8):731-4. doi: 10.1038/nbt.1927. |
Holden et al., Crystal structure of the anti-viral APOBEC3G catalytic domain and functional implications. Nature. Nov. 6, 2008;456(7218):121-4. doi: 10.1038/nature07357. Epub Oct. 12, 2008. |
Hondares et al., Peroxisome Proliferator-activated Receptor ? (PPAR?) Induces PPAR? Coactivator 1? (PGC-1?) Gene Expression and Contributes to Thermogenic Activation of Brown Fat. J Biol. Chem Oct. 2011;286(50):43112-22. doi: 10.1074/jbc.M111.252775. |
Horvath et al., CRISPR/Cas, the immune system of bacteria and archaea. Science. Jan. 8, 2010;327(5962): 167-70. doi: 10.1126/science.1179555. |
Horvath et al., Diversity, Activity, and Evolution of CRISPR Loci in Streptococcus thermophilus. J Bacteriol. Feb. 2008;190(4):1401-12. doi: 10.1128/JB.01415-07. Epub Dec. 7, 2007. |
Hou et al., Efficient genome engineering in human pluripotent stem cells using Cas9 from Neisseria meningitidis. Proc Natl Acad Sci U S A. Sep. 24, 2013;110(39): 15644-9. doi: 10.1073/pnas.1313587110. Epub Aug. 12, 2013. |
Houdebine, The methods to generate transgenic animals and to control transgene expression. J Biotechnol. Sep. 25, 2002;98(2-3):145-60. |
Howard et al., Intracerebral drug delivery in rats with lesion-induced memory deficits. J Neurosurg. Jul. 1989;71(1):105-12. |
Hower et al., Shape-based peak identification for ChIP-Seq. BMC Bioinformatics. Jan. 12, 2011;12:15. doi: 10.1186/1471-2105-12-15. |
Hsu et al., DNA targeting specificity of RNA-guided Cas9 nucleases. Nat Biotechnol. Sep. 2013;31(9):827-32. doi: 10.1038/nbt.2647. Epub Jul. 21, 2013. |
Hu et al., Chemical Biology Approaches to Genome Editing: Understanding, Controlling, and Delivering Programmable Nucleases. Cell Chem Biol. Jan. 21, 2016;23(1):57-73. doi: 10.1016/j.chembiol.2015.12.009. |
Hu et al., Evolved Cas9 variants with broad PAM compatibility and high DNA specificity. Nature. Apr. 5, 2018;556(7699):57-63. doi: 10.1038/nature26155. Epub Feb. 28, 2018. |
Huang et al., Heritable gene targeting in zebrafish using customized TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):699-700. doi: 10.1038/nbt.1939. |
Humbert et al., Targeted gene therapies: tools, applications, optimization. Crit Rev Biochem Mol Biol. May-Jun. 2012;47(3):264-81. doi: 10.3109/10409238.2012.658112. |
Hurt et al., Highly specific zinc finger proteins obtained by directed domain shuffling and cell-based selection. Proc Natl Acad Sci U S A. Oct. 14, 2003; 100(21):12271-6. Epub Oct. 3, 2003. |
Husimi, Selection and evolution of bacteriophages in cellstat. Adv Biophys. ; 1989;25:1-43. Review. |
Hwang et al., Efficient genome editing in zebrafish using a CRISPR-Cas system. Nat Biotechnol. Mar. 2013;31(3):227-9. doi: 10.1038/nbt.2501. Epub Jan. 29, 2013. |
Hwang et al., Efficient In Vivo Genome Editing Using RNA-Guided Nucleases. Nat Biotechnol. Mar. 2013; 31(3): 227-229. doi: 10.1038/nbt.2501. Epub Jan. 29, 2013. |
Ikediobi et al., Mutation analysis of 24 known cancer genes in the NCI-60 cell line set. Mol Cancer Ther. Nov. 2006;5(11):2606-12. Epub Nov. 6, 2006. |
International Preliminary Report on Patentability for PCT/US2017/046144, dated Feb. 21, 2019. |
International Search Report and Written Opinion for PCT/US2017/046144, dated Oct. 10, 2017. |
Irrthum et al., Congenital hereditary lymphedema caused by a mutation that inactivates VEGFR3 tyrosine kinase. Am J Hum Genet. Aug. 2000;67(2):295-301. Epub Jun. 9, 2000. |
Ishino et al., Nucleotide sequence of the iap gene, responsible for alkaline phosphatase isozyme conversion in Escherichia coli, and identification of the gene product. J Bacteriol. Dec. 1987;169(12):5429-33. |
Jamieson et al., Drug discovery with engineered zinc-finger proteins. Nat Rev Drug Discov. May 2003;2(5):361-8. |
Jansen et al., Backbone and nucleobase contacts to glucosamine-6-phosphate in the glmS ribozyme. Nat Struct Mol Biol. Jun. 2006;13(6):517-23. Epub May 14, 2006. |
Jansen et al., Identification of genes that are associated with DNA repeats in prokaryotes. Mol Microbiol. Mar. 2002;43(6):1565-75. |
Jenkins et al., Comparison of a preQ1 riboswitch aptamer in metabolite-bound and free states with implications for gene regulation. J Biol Chem. Jul. 15, 2011;286(28):24626-37. doi: 10.1074/jbc.M111.230375. Epub May 18, 2011. |
Jiang et al., RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Nat Biotechnol. Mar. 2013;31(3):233-9. doi: 10.1038/nbt.2508. Epub Jan. 29, 2013. |
Jiang et al., Structural Biology. A Cas9-guide RNA Complex Preorganized for Target DNA Recognition. Science. Jun. 26, 2015;348(6242):1477-81. doi: 10.1126/science.aab1452. |
Jiang et al., Structures of a CRISPR-Cas9 R-loop complex primed for DNA cleavage. Science. Feb. 19, 2016;351(6275):867-71. doi: 10.1126/science.aad8282. Epub Jan. 14, 2016. |
Jinek et al., A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science. Aug. 17, 2012;337(6096):816-21. doi: 10.1126/science 1225829. Epub Jun. 28, 2012. |
Jinek et al., RNA-programmed genome editing in human cells. Elife. Jan. 29, 2013;2:e00471. doi: 10.7554/eLife.00471. |
Jinek et al., Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science. Mar. 14, 2014;343(6176):1247997. doi: 10.1126/science.1247997. Epub Feb. 6, 2014. |
Jore et al., Structural basis for CRISPR RNA-guided DNA recognition by Cascade. Nat Struct Mol Biol. May 2011;18(5):529-36. doi: 10.1038/nsmb.2019. Epub Apr. 3, 2011. |
Joung et al.,TALENs: a widely applicable technology for targeted genome editing. Nat Rev Mol Cell Biol. Jan. 2013;14(1):49-55. doi: 10.1038/nrm3486. Epub Nov. 21, 2012. |
Kaiser et al., Gene therapy. Putting the fingers on gene repair. Science. Dec. 23, 2005;310(5756):1894-6. |
Kakiyama et al., A peptide release system using a photo-cleavable linker in a cell array format for cell-toxicity analysis. Polymer J. Feb. 27, 2013;45:535-9. |
Kandavelou et al., Targeted manipulation of mammalian genomes using designed zinc finger nucleases. Biochem Biophys Res Commun. Oct. 9, 2009;388(1):56-61. doi: 10.1016/j.bbrc.2009.07.112. Epub Jul. 25, 2009. |
Kang et al., Structural Insights into riboswitch control of the biosynthesis of queuosine, a modified nucleotide found in the anticodon of tRNA. Mol Cell. Mar. 27, 2009;33(6):784-90. doi: 10.1016/j.molcel.2009.02.019. Epub Mar. 12, 2009. |
Kappel et al., Regulating gene expression in transgenic animals.Curr Opin Biotechnol. Oct. 1992;3(5):548-53. |
Karpenshih et al., From yeast to mammals: recent advances in genetic control of homologous recombination. DNA Repair (Amst). Oct. 1, 2012;11(10):781-8. doi: 10.1016/j.dnarep.2012.07.001. Epub Aug. 11, 2012. Review. |
Karpinsky et al., Directed evolution of a recombinase that excises the provirus of most HIV-1 primary isolates with high specificity. Nat Biotechnol. Apr. 2016;34(4):401-9. doi: 10.1038/nbt.3467. Epub Feb. 22, 2016. |
Kaya et al., A bacterial Argonaute with noncanonical guide RNA specificity. Proc. Natl. Acad. Sci. USA Apr. 2016;113(15):4057-62. |
Kellendonk et al., Regulation of Cre recombinase activity by the synthetic steroid RU 486. Nucleic Acids Res. Apr. 15, 1996;24(8):1404-11. |
Kiga et al., An engineered Escherichia coli tyrosyl-tRNA synthetase for site-specific incorporation of an unnatural amino acid into proteins in eukaryotic translation and its application in a wheat germ cell-free system. Proc Natl Acad Sci U S A. Jul. 23, 2002;99(15):9715-20. Epub Jul. 3, 2002. |
Kim et al., A library of TAL effector nucleases spanning the human genome. Nat Biotechnol. Mar. 2013;31(3):251-8. Doi: 10.1038/nbt.2517. Epub Feb. 17, 2013. |
Kim et al., Genome-wide target specificities of CRISPR RNA-guided programmable deaminases. Nat Biotechnol. May 2017;35(5):475-480. doi: 10.1038/nbt.3852. Epub Apr. 10, 2017. |
Kim et al., Highly efficient RNA-guided base editing in mouse embryos. Nat Biotechnol. May 2017;35(5):435-437. doi: 10.1038/nbt.3816. Epub Feb. 27, 2017. |
Kim et al., Highly efficient RNA-guided genome editing in human cells via delivery of purified Cas9 ribonucleoproteins. Genome Res. Jun. 2014;24(6):012-9. doi: 10.1101/gr.171322.113. Epub Apr. 2, 2014. |
Kim et al., Increasing the genome-targeting scope and precision of base editing with engineered Cas9-cytidine deaminase fusions. Nat Biotechnol. Apr. 2017;35(4):371-376. doi: 10.1038/nbt.3803. Epub Feb. 13, 2017. |
Kim et al., TALENs and ZFNs are associated with different mutationsignatures. Nat Methods. Mar. 2013;10(3):185. doi: 10.1038/nmeth.2364. Epub Feb. 10, 2013. |
Kim et al., Targeted genome editing in human cells with zinc finger nucleases constructed via modular assembly. Genome Res. Jul. 2009;19(7):1279-88. doi: 10.1101/gr.089417.108. Epub May 21, 2009. |
Kim et al., The role of apolipoprotein E in Alzheimer's disease. Neuron. Aug. 13, 2009;63(3):287-303. doi: 10.1016/j.neuron.2009.06.026. |
Kim et al., Transcriptional repression by zinc finger peptides. Exploring the potential for applications in gene therapy. J Biol Chem. Nov. 21, 1997;272(47):29795-800. |
Kitamura et al., Uracil DNA glycosylase counteracts APOBEC3G-induced hypermutation of hepatitis B viral genomes: excision repair of covalently closed circular DNA. PLoS Pathog. 2013;9(5):e1003361. doi: 10.1371/journal.ppat.1003361. Epub May 16, 2013. |
Klauser et al., An engineered small RNA-mediated genetic switch based on a ribozyme expression platform. Nucleic Acids Res. May 1, 2013;41(10):5542-52. doi: 10.1093/nar/gkt253. Epub Apr. 12, 2013. |
Klein et al., Cocrystal structure of a class I preQ1 riboswitch reveals a pseudoknot recognizing an essential hypermodified nucleobase. Nat Struct Mol Biol. Mar. 2009;16(3):343-4. doi: 10.1038/nsmb.1563.Epub Feb. 22, 2009. |
Kleinstiver et al., Broadening the targeting range of Staphylococcus aureus CRISPR-Cas9 by modifying PAM recognition. Nat Biotechnol. Dec. 2015;33(12):1293-1298. doi: 10.1038/nbt.3404. Epub Nov. 2, 2015. |
Kleinstiver et al., Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature. Jul. 23, 2015;523(7561):481-5. doi: 10.1038/nature14592. Epub Jun. 22, 2015. |
Kleinstiver et al., High-fidelity CRISPR-Cas9 nucleases with No. detectable genome-wide off-target effects. Nature. Jan. 28, 2016;529(7587):490-5. doi: 10.1038/nature16526. Epub Jan. 6, 2016. |
Kleinstiver et al., Monomeric site-specific nucleases for genome editing. Proc Natl Acad Sci U S A. May 22, 2012;109(21):8061-6. doi: 10.1073/pnas.1117984109. Epub May 7, 2012. |
Klippel et al., Isolation and characterization of unusual gin mutants. EMBO J. Dec. 1, 1988;7(12):3983-9. |
Klippel et al., The DNA invertase Gin of phage Mu: formation of a covalent complex with DNA via a phosphoserine at amino acid position 9. EMBO J. Apr. 1988;7(4):1229-37. |
Kobori et al., Deep Sequencing Analysis of Aptazyme Variants Based on a Pistol Ribozyme. ACS Synth Biol. Jul. 21, 2017;6(7):1283-1288. doi: 10.1021/acssynbio.7b00057. Epub Apr. 14, 2017. |
Kohli et al., Local sequence targeting in the AID/APOBEC family differentially impacts retroviral restriction and antibody diversification. J Biol Chem. Dec. 24, 2010;285(52):40956-64. doi: 10.1074/jbc.M1110.177402. Epub Oct. 6, 2010. |
Köhrer et al., A possible approach to site-specific insertion of two different unnatural amino acids into proteins in mammalian cells via nonsense suppression. Chem Biol. Nov. 2003;10(11):1095-102. |
Köhrer et al., Complete set of orthogonal 21st aminoacyl-tRNA synthetase-amber, ochre and opal suppressor tRNA pairs: concomitant suppression of three different termination codons in an mRNA in mammalian cells. Nucleic Acids Res. Dec. 1, 2004;32(21):6200-11. Print 2004. |
Komor et al., CRISPR-Based Technologies for the Manipulation of Eukaryotic Genomes. Cell. Jan. 12, 2017;168(1-2):20-36. doi: 10.1016/j.cell.2016.10.044. |
Komor et al., Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity. Sci Adv. Aug. 30, 2017;3(8):eaao4774. doi: 10.1126/sciadv.aao4774. eCollection Aug. 2017. |
Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature. Apr. 20, 2016;533(7603):420-4. doi: 10.1038/nature17946. |
Koonin et al., Diversity, classification and evolution of CRISPR-Cas systems. Curr Opin Microbiol. 2017;37:67?78. doi:10.1016/j.mib.2017.05.008. |
Kouzminova et al., Patterns of chromosomal fragmentation due to uracil-DNA incorporation reveal a novel mechanism of replication-dependent double-stranded breaks. Mol Microbiol. Apr. 2008;68(1):202-15. doi: 10.1111/j.1365-2958.2008.06149.x. |
Kowal et al., Exploiting unassigned codons in Micrococcus luteus for tRNA-based amino acid mutagenesis. Nucleic Acids Res. Nov. 15, 1997;25(22):4685-9. |
Kumar et al., Structural and functional consequences of the mutation of a conserved arginine residue in alphaA and alphaB crystallins. J Biol Chem. Aug. 20, 1999;274(34):24137-41. |
Kundu et al., Leucine to proline substitution by SNP at position 197 in Caspase-9 gene expression leads to neuroblastoma: a bioinformatics analysis. 3 Biotech. 2013; 3:225-34. |
Kunz et al., DNA Repair in mammalian cells: Mismatched repair: variations on a theme. Cell Mol Life Sci. Mar. 2009;66(6):1021-38. doi: 10.1007/s00018-009-8739-9. |
Kury et al., De Novo Disruption of the Proteasome Regulatory Subunit PSMD12 Causes a Syndromic Neurodevelopmental Disorder. Am J Hum Genet. Feb. 2, 2017;100(2):352-363. doi: 10.1016/j.ajhg.2017.01.003. Epub Jan. 26, 2017. |
Kuscu et al., CRISPR-STOP: gene silencing through base-editing-induced nonsense mutations. Nat Methods. Jul. 2017;14(7):710-712. doi: 10.1038/nmeth.4327. Epub Jun. 5, 2017. |
Kuscu et al., Genome-wide analysis reveals characteristics of off-target sites bound by the Cas9 endonuclease. Nat Biotechnol. Jul. 2014;32(7):677-83. doi: 10.1038/nbt.2916. Epub May 18, 2014. |
Kwon et al., Chemical basis of glycine riboswitch cooperativity. RNA. Jan. 2008;14(1):25-34. Epub Nov. 27, 2007. |
Landrum et al., ClinVar: public archive of interpretations of clinically relevant variants. Nucleic Acids Res. Jan. 4, 2016;44(D1):D862-8. doi: 10.1093/nar/gkvl222. Epub Nov. 17, 2015. |
Langer et al., Chemical and Physical Structure of Polymers as Carriers for Controlled Release of Bioactive Agents: A Review. Journal of Macromolecular Science, 2006;23(1):61-126. DOI: 10.1080/07366578308079439. |
Langer et al., New methods of drug delivery. Science. Sep. 28, 1990;249(4976):1527-33. |
Larson et al., CRISPR interference (CRISPRi) for sequence-specific control of gene expression. Nat Protoc. Nov. 2013;8(11):2180-96. doi: 10.1038/nprot.2013.132. Epub Oct. 17, 2013. |
Lau et al., Molecular basis for discriminating between normal and damaged bases by the human alkyladenine glycosylase, AAG. Proc Natl Acad Sci U S A. Dec. 5, 2000;97(25):13573-8. |
Lavergne et al., Defects in type IIA von Willebrand disease: a cysteine 509 to arginine substitution in the mature von Willebrand factor disrupts a disulphide loop involved in the interaction with platelet glycoprotein Ib-IX. Br J Haematol. Sep. 1992;82(1):66-72. |
Lawrence et al., Supercharging proteins can impart unusual resilience. J Am Chem Soc. Aug. 22, 2007; 129(33):10110-2. Epub Aug. 1, 2007. |
Lazar et al., Transforming growth factor alpha: mutation of aspartic acid 47 and leucine 48 results in different biological activities. Mol Cell Biol. Mar. 1988;8(3):1247-52. |
Ledford, Gene-editing hack yields pinpoint precision. Nature, Apr. 20, 2016. http://www.nature.com/news/gene-editing-hack-yields-pinpoint-precision-1.19773. |
Lee et al., A chimeric thyroid hormone receptor constitutively bound to DNA requires retinoid X receptor for hormone-dependent transcriptional activation in yeast. Mol Endocrinol. Sep. 1994;8(9):1245-52. |
Lee et al., An allosteric self-splicing ribozyme triggered by a bacterial second messenger. Science. Aug. 13, 2010;329(5993):845-8. doi: 10.1126/science.1190713. |
Lee et al., Failure to detect DNA-guided genome editing using Natronobacterium gregoryi Argonaute. Nat Biotechnol. Nov. 28, 2016;35(1):17-18. doi: 10.1038/nbt.3753. |
Lee et al., PIK3CA gene is frequently mutated in breast carcinomas and hepatocellular carcinomas. Oncogene. Feb. 17, 2005;24(8):1477-80. |
Lee et al., Recognition of liposomes by cells: in vitro binding and endocytosis mediated by specific lipid headgroups and surface charge density. Biochim Biophys Acta. Jan. 31, 1992;1103(2):185-97. |
Lee et al., Ribozyme Mediated gRNA Generation for In Vitro and In Vivo CRISPR/Cas9 Mutagenesis. PLoS One. Nov. 10, 2016;11(11):e0166020. doi: 10.1371/journal.pone.0166020. eCollection 2016. |
Lei et al., Efficient targeted gene disruption in Xenopus embryos using engineered transcription activator-like effector nucleases (TALENs). Proc Natl Acad Sci U S A. Oct. 23, 2012; 109(43):17484-9. Doi: 10.1073/pnas.1215421109. Epub Oct. 8, 2012. |
Lenk et al., Pathogenic mechanism of the FIG4 mutation responsible for Charcot-Marie-Tooth disease CMT4J. PLoS Genet. Jun. 2011;7(6):e1002104. doi: 10.1371/journal.pgen.1002104. Epub Jun. 2, 2011. |
Levy et al., Inhibition of calcification of bioprosthetic heart valves by local controlled-release diphosphonate. Science. Apr. 12, 1985;228(4696):190-2. |
Lewis et al., A serum-resistant cytofectin for cellular delivery of antisense oligodeoxynucleotides and plasmid DNA. Proc Natl Acad Sci U S A. Apr. 16, 1996;93(8):3176-81. |
Lewis et al., Building the Class 2 CRISPR-Cas Arsenal. Mol Cell 2017;65(3);377-379. |
Lewis et al., Codon 129 polymorphism of the human prion protein influences the kinetics of amyloid formation. J Gen Virol. Aug. 2006;87(Pt 8):2443-9. |
Li et al., Base editing with a Cpf1-cytidine deaminase fusion. Nat Biotechnol. Apr. 2018;36(4):324-327. doi: 10.1038/nbt.4102. Epub Mar. 19, 2018. |
Li et al., Current approaches for engineering proteins with diverse biological properties. Adv Exp Med Biol. 2007;620:18-33. |
Li et al., Generation of Targeted Point Mutations in Rice by a Modified CRISPR/Cas9 System. Mol Plant. Mar. 6, 2017;10(3):526-529. doi: 10.1016/j.molp.2016.12.001. Epub Dec. 8, 2016. |
Li et al., Highly efficient and precise base editing in discarded human tripronuclear embryos. Protein Cell. Aug. 19, 2017. doi: 10.1007/s13238-017-0458-7. [Epub ahead of print]. |
Li et al., Modularly assembled designer TAL effector nucleases for targeted gene knockout and gene replacement in eukaryotes. Nucleic Acids Res. Aug. 2011;39(14):6315-25. doi: 10.1093/nar/gkr188. Epub Mar. 31, 2011. |
Li et al., Multiplex and homologous recombination-mediated genome editing in Arabidopsis and Nicotiana benthamiana using guide RNA and Cas9. Nat Biotechnol. Aug. 2013;31(8):688-91. doi: 10.1038/nbt.2654. |
Li et al., TAL nucleases (TALNs): hybrid proteins composed of TAL effectors and FokI DNA-cleavage domain. Nucleic Acids Res. Jan. 2011;39(1):359-72. doi: 10.1093/nar/gkq704. Epub Aug. 10, 2010. |
Liang et al., Rapid and highly efficient mammalian cell engineering via Cas9 protein transfection. Send to; J Biotechnol. Aug. 20, 2015;208:44-53. doi: 10.1016/j.jbiotec.2015.04.024. |
Lieber et al., Mechanism and regulation of human non-homologous DNA end-joining. Nat Rev Mol Cell Biol. Sep. 2003;4(9):712-20. |
Lilley, D.M. The Varkud Satellite Ribozyme. RNA. Feb. 2004;10(2):151-8.doi: 10.1261/rna.5217104. |
Lin et al., Enhanced homology-directed human genome engineering by controlled timing of CRISPR/Cas9 delivery. Elife. Dec. 15, 2014;3:e04766. doi: 10.7554/eLife.04766. |
Link et al., Engineering ligand-responsive gene-control elements: lessons learned from natural riboswitches. Gene Ther. Oct. 2009;16(10):1189-201. doi: 10.1038/gt.2009.81. Epub Jul. 9, 2009. Review. |
Liu et al., C2c1-sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism. Molecular Cell Jan. 2017;65(2):310-22. |
Liu et al., Apolipoprotein E and Alzheimer disease: risk, mechanisms and therapy. Nat Rev Neurol. Feb. 2013;9(2):106-18. doi: 10.1038/nrneurol.2012.263. Epub Jan. 8, 2013. |
Liu et al., Balancing AID and DNA repair during somatic hypermutation. Trends Immunol. Apr. 2009;30(4):173-81. doi: 10.1016/j.it.2009.01.007. |
Liu et al., Cell-penetrating peptide-mediated delivery of TALEN proteins via bioconjugation for genome engineering. PLoS One. Jan. 20, 2014;9(1):e85755. doi: 10.1371/journal.pone.0085755. eCollection 2014. |
Liu et al., Design of polydactyl zinc-finger proteins for unique addressing within complex genomes. Proc Natl Acad Sci U S A. May 27, 1997;94(11):5525-30. |
Liu et al., Distance determination by GIY-YIG intron endonucleases: discrimination between repression and cleavage functions. Nucleic Acids Res. Mar. 31, 2006;34(6):1755-64. Print 2006. |
Liu et al., Engineering a tRNA and aminoacyl-tRNA synthetase for the site-specific incorporation of unnatural amino acids into proteins in vivo. Proc Natl Acad Sci U S A. Sep. 16, 1997;94(19):10092-7. |
Liu et al., Fast Colorimetric Sensing of Adenosine and Cocaine Based on a General Sensor Design Involving Aptamers and Nanoparticles. Angew Chem. Dec. 16, 2006;45(1):90-4. DOI: 10.1002/anie.200502589. |
Liu et al., Fast Colorimetric Sensing of Adenosine and Cocaine Based on a General Sensor Design Involving Aptamers and Nanoparticles. Angew Chem. 2006;118(1):96-100. |
Liu et al., Functional Nucleic Acid Sensors. Chem Rev. May 2009;109(5): 1948-98. doi: 10.1021/cr030183i. |
Lombardo et al., Gene editing in human stem cells using zinc finger nucleases and integrase-defective lentiviral vector delivery. Nat Biotechnol. Nov. 2007;25(11):1298-306. Epub Oct. 28, 2007. |
Losey et al., Crystal structure of Staphylococcus sureus tRNA adenosine deaminase tadA in complex with RNA. Nature Struct. Mol. Biol. Feb. 2006;13(2):153-9. |
Lu et al., Precise Editing of a Target Base in the Rice Genome Using a Modified CRISPR/Cas9 System. Mol Plant. Mar. 6, 2017;10(3):523-525. doi: 10.1016/j.molp.2016.11.013. Epub Dec. 6, 2016. |
Lundberg et al., Delivery of short interfering RNA using endosomolytic cell-penetrating peptides. FASEB J. Sep. 2007;21(11):2664-71. Epub Apr. 26, 2007. |
Lundquist et al., Site-directed mutagenesis and characterization of uracil-DNA glycosylase inhibitor protein. Role of specific carboxylic amino acids in complex formation with Escherichia coli uracil-DNA glycosylase. J Biol Chem. Aug. 22, 1997;272(34):21408-19. |
Lyons et al., Efficient Recognition of an Unpaired Lesion by a DNA Repair Glycosylase. J. Am. Chem. Soc., 2009;131(49):17742-3. DOI: 10.1021/ja908378y. |
Ma et al., Single-Stranded DNA Cleavage by Divergent CRISPR-Cas9 Enzymes. Mol Cell. Nov. 5, 2015;60(3):398-407. doi: 10.1016/j.molcel.2015.10.030. |
Ma et al., Targeted AID-mediated mutagenesis (TAM) enables efficient genomic diversification in mammalian cells. Nature Methods. Oct. 2016; 13:1029-35. doi:10.1038/nmeth.4027 . |
Maeder et al., CRISPR RNA-guided activation of endogenous human genes. Nat Methods. Oct. 2013;10(10):977-9. doi: 10.1038/nmeth.2598. Epub Jul. 25, 2013. |
Maeder et al., Rapid “open-source” engineering of customized zinc-finger nucleases for highly efficient gene modification. Mol Cell. Jul. 25, 2008;31(2):294-301. doi:10.1016/j.molcel.2008.06.016. |
Maeder et al., Robust, synergistic regulation of human gene expression using TALE activators. Nat Methods. Mar. 2013;10(3):243-5. doi: 10.1038/nmeth.2366. Epub Feb. 10, 2013. |
Mahfouz et al., De novo-engineered transcription activator-like effector (TALE) hybrid nuclease with novel DNA binding specificity creates double-strand breaks. Proc Natl Acad Sci U S A. Feb. 8, 2011;108(6):2623-8. doi: 10.1073/pnas.1019533108. Epub Jan. 24, 2011. |
Makarova et al., Prokaryotic homologs of Argonaute proteins are predicted to function as key components of a novel system of defense against mobile genetic elements. Biology Direct 2009;4:29. |
Makarova et al., An updated evolutionary classification of CRISPR-Cas systems. Nat Rev Microbiol. Nov. 2015;13(11):722-36. doi: 10.1038/nrmicro3569. Epub Sep. 28, 2015. |
Makarova et al., Evolution and classification of the CRISPR-Cas systems. Nat Rev Microbiol. Jun. 2011;9(6):467-77. doi: 10.1038/nrmicro2577. Epub May 9, 2011. |
Mali et al., Cas9 as a versatile tool for engineeringbiology. Nat Methods. Oct. 2013;10(10):957-63. doi: 10.1038/nmeth.2649. |
Mali et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nat Biotechnol. Sep. 2013;31(9):833-8. doi: 10.1038/nbt.2675. Epub Aug. 1, 2013. |
Mali et al., RNA-guided human genome engineering via Cas9. Science. Feb. 15, 2013;339(6121):823-6. doi: 10.1126/science.1232033. Epub Jan. 3, 2013. |
Mandal et al., Riboswitches Control Fundamental Biochemical Pathways in Bacillus Subtilis and Other Bacteria. Cell. May 30, 2003;113(5):577-86. doi: 10.1016/s0092-8674(03)00391-x. |
Mani et al., Design, engineering, and characterization of zinc finger nucleases. Biochem Biophys Res Commun. Sep. 23, 2005;335(2):447-57. |
Marioni et al., DNA methylation age of blood predicts all-cause mortality in later life. Genome Biol. Jan. 30, 2015;16:25. doi: 10.1186/s13059-015-0584-6. |
Marrafhini et al., CRISPR interference limits horizontal gene transfer in staphylococci by targeting DNA. Science. Dec. 19, 2008;322(5909):1843-5. doi: 10.1126/science.1165771. |
Maruyama et al., Increasing the efficiency of precise genome editing with CRISPR-Cas9 by inhibition of nonhomologous end joining. Nat Biotechnol. May 2015;33(5):538-42. doi: 10.1038/nbt.3190. Epub Mar. 23, 2015. |
Mei et al., Recent Progress in CRISPR/Cas9 Technology. J Genet Genomics. Feb. 20, 2016;43(2):63-75. doi: 10.1016/j.jgg.2016.01.001. Epub Jan. 18, 2016. |
Meng et al., Targeted gene inactivation in zebrafish using engineered zinc-finger nucleases. Nat Biotechnol. Jun. 2008;26(6):695-701. doi: 10.1038/nbt1398. Epub May 25, 2008. |
Mercer et al., Chimeric TALE recombinases with programmable DNA sequence specificity. Nucleic Acids Res. Nov. 2012;40(21):11163-72. doi: 10.1093/nar/gks875. Epub Sep. 26, 2012. |
Mertens et al., Site-specific recombination in bacteriophage Mu: characterization of binding sites for the DNA invertase Gin. EMBO J. Apr. 1988;7(4):1219-27. |
Meyer et al., Breathing life into polycations: functionalization with pH-responsive endosomolytic peptides and polyethylene glycol enables siRNA delivery. J Am Chem Soc. Mar. 19, 2008;130(11):3272-3. doi: 10.1021/ja710344v. Epub Feb. 21, 2008. |
Meyer et al., Confirmation of a second natural preQ1 aptamer class in Streptococcaceae bacteria. RNA. Apr. 2008;14(4):685-95. doi: 10.1261/rna.937308. Epub Feb. 27, 2008. |
Midoux et al., Chemical vectors for gene delivery: a current review on polymers, peptides and lipids containing histidine or imidazole as nucleic acids carriers. Br J Pharmacol. May 2009;157(2):166-78. doi: 10.1111/j.l476-5381.2009.00288.x. |
Miller et al., A TALE nuclease architecture for efficient genome editing. Nat Biotechnol. Feb. 2011;29(2):143-8. doi:10.1038/nbt.1755. Epub Dec. 22, 2010. |
Miller et al., An improved zinc-finger nuclease architecture for highly specific genome editing. Nat Biotechnol. Jul. 2007;25(7):778-85. Epub Jul. 1, 2007. |
Minoche et al., Evaluation of genomic high-throughput sequencing data generated on Illumina HiSeq and genome analyzer systems. Genome Biol. Nov. 8, 2011;12(11):R112. doi: 10.1186/gb-2011-12-11-r112. |
Minoretti et al., A W148R mutation in the human FOXD4 gene segregating with dilated cardiomyopathy, obsessive-compulsive disorder, and suicidality. Int J Mol Med. Mar. 2007;19(3):369-72. |
Mir et al., Two Active Site Divalent Ions in the Crystal Structure of the Hammerhead Ribozyme Bound to a Transition State Analogue. Biochemistry. . Feb. 2, 2016;55(4):633-6. doi: 10.1021/acs.biochem.5b01139. Epub Jan. 19, 2016. |
Mishina et al., Conditional gene targeting on the pure C57BL/6 genetic background. Neurosci Res. Jun. 2007;58(2):105-12. doi: 10.1016/j.neures.2007.01.004. Epub Jan. 18, 2007. |
Mojica et al., Intervening sequences of regularly spaced prokaryotic repeats derive from foreign genetic elements. J Mol Evol. Feb. 2005;60(2):174-82. |
Mol et al., Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA. Cell. Sep. 8, 1995;82(5):701-8. |
Monahan et al., Site-specific incorporation of unnatural amino acids into receptors expressed in Mammalian cells. Chem Biol. Jun. 2003;10(6):573-80. |
Montange et al., Structure of the S-adenosylmethionine riboswitch regulatory mRNA element. Nature. Jun. 29, 2006;441(7097):1172-5. |
Moore et al., Improved somatic mutagenesis in zebrafish using transcription activator-like effector nucleases (TALENs). PloS One. 2012;7(5):e37877. Doi: 10.1371/journal.pone.0037877. Epub May 24, 2012. |
Mootz et al., Conditional protein splicing: a new tool to control protein structure and function in vitro and in vivo. J Am Chem Soc. Sep. 3, 2003; 125(35):10561-9. |
Mootz et al., Protein splicing triggered by a small molecule. J Am Chem Soc. Aug. 7, 2002;124(31):9044-5. |
Morbitzer et al., Assembly of custom TALE-type DNA binding domains by modular cloning. Nucleic Acids Res. Jul. 2011;39(13):5790-9. doi: 10.1093/nar/gkr151. Epub Mar. 18, 2011. |
Morris et al., A peptide carrier for the delivery of biologically active proteins into mammalian cells. Nat Biotechnol. Dec. 2001;19(12):1173-6. |
Moscou et al., A simple cipher governs DNA recognition by TAL effectors. Science. Dec. 11, 2009;326(5959):1501. doi: 10.1126/science.1178817. |
Mullins et al., Transgenesis in nonmurine species. Hypertension. Oct. 1993;22(4):630-3. |
Mussolino et al., A novel TALE nuclease scaffold enables high genome editing activity in combination with low toxicity. Nucleic Acids Res. Nov. 2011;39(21):9283-93. Doi: 10.1093/nar/gkr597. Epub Aug. 3, 2011. |
Mussolino et al., TALE nucleases: tailored genome engineering made easy. Curr Opin Biotechnol. Oct. 2012;23(5):644-50. doi: 10.1016/j.copbio.2012.01.013. Epub Feb. 17, 2012. |
Nahvi et al., Coenzyme B12 riboswitches are widespread genetic control elements in prokaryotes. Nucleic Acids Res. Jan. 2, 2004;32(1):143-50. |
Narayanan et al., Clamping down on weak terminal base pairs: oligonucleotides with molecular caps as fidelity-enhancing elements at the 5′- and 3′-terminal residues. Nucleic Acids Res. May 20, 2004;32(9):2901-11. Print 2004. |
Navaratnam et al., An overview of cytidine deaminases. Int J Hematol. Apr. 2006;83(3):195-200. |
NCBI Reference Sequence: NM_002427.3. Wu et al., May 3, 2014. 5 pages. |
Neel et al., Riboswitches: Classification, function and in silico approach, International Journal of Pharma Sciences and Research. 2010;1(9):409-420. |
Nelson et al., Filamentous phage DNA cloning vectors: a noninfective mutant with a nonpolar deletion in gene III. Virology. 1981; 108(2): 338-50. |
Ni et al., A PCSK9-binding antibody that structurally mimics the EGF(A) domain of LDL-receptor reduces LDL cholesterol in vivo. J Lipid Res. 2011;52:76-86. |
Ni et al., Nucleic acid aptamers: clinical applications and promising new horizons. Curr Med Chem. 2011;18(27):4206-14. Review. |
Nishida et al., Targeted nucleotide editing using hybrid prokaryotic and vertebrate adaptive immune systems. Science. Sep. 16, 2016;353(6305):1248. pii: aaf8729. doi: 10.1126/science.aaf8729. Epub Aug. 4, 2016. |
Nishikura, Functions and regulation of RNA editing by ADAR deaminases. Annu Rev Biochem. 2010;79:321-349. doi:10.1146/annurev-biochem-060208-105251. |
Nishimasu et al., Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell. Feb. 27, 2014;156(5):935-49. doi: 10.1016/j.cell.2014.02.001. Epub Feb. 13, 2014. |
Nishimasu et al., Crystal Structure of Staphylococcus aureus Cas9. Cell. Aug. 27, 2015;162(5):1113-26. doi: 10.1016/j.cell.2015.08.007. |
Nomura et al., Controlling Mammalian Gene Expression by Allosteric Hepatitis Delta Virus Ribozymes. ACS Synth Biol. Dec. 20, 2013;2(12):684-9. doi: 10.1021/sb400037a. Epub May 22, 2013. |
Nomura et al., Synthetic mammalian riboswitches based on guanine aptazyme. Chem Commun (Camb). Jul. 21, 2012;48(57):7215-7. doi: 10.1039/c2cc33140c. Epub Jun. 13, 2012. |
Noris et al., A phenylalanine-55 to serine amino-acid substitution in the human glycoprotein IX leucine-rich repeat is associated with Bernard-Soulier syndrome. Br J Haematol. May 1997;97(2):312-20. |
Nowak et al., Guide RNA Engineering for Versatile Cas9 Functionality. Nucleic Acids Res. Nov. 16, 2016;44(20):9555-9564. doi: 10.1093/nar/gkw908. Epub Oct. 12, 2016. |
Numrych et al., A comparison of the effects of single-base and triple-base changes in the integrase arm-type binding sites on the site-specific recombination of bacteriophage lambda. Nucleic Acids Res. Jul. 11, 1990;18(13):3953-9. doi: 10.1093/nar/18.13.3953. |
Oakes et al., Protein engineering of Cas9 for enhanced function. Methods Enzymol. 2014;546:491-511. |
O'Connell et al., Programmable RNA recognition and cleavage by CRISPR/Cas9. Nature. Dec. 11, 2014;516(7530):263-6. doi: 10.1038/nature13769. Epub Sep. 28, 2014. |
Offord, Advances in Genome Editing. The Scientist, Apr. 20, 2016. http://www.the-scientist.com/?articles.view/articleNo/45903/title/Advances-in-Genome-Editing/. |
Osborn et al., TALEN-based gene correction for epidermolysis bullosa. Mol Ther. Jun. 2013;21(6):1151-9. doi: 10.1038/mt.2013.56. Epub Apr. 2, 2013. |
Pan et al., Biological and biomedical applications of engineered nucleases. Mol Biotechnol. Sep. 2013;55(1):54-62. doi: 10.1007/s12033-012-9613-9. |
Parker et al., Admixture mapping identifies a quantitative trait locus associated with FEV1/FVC in the COPDGene Study. Genet Epidemiol. Nov. 2014;38(7):652-9. doi: 10.1002/gepi.21847. Epub Aug. 11, 2014. |
Pattanayak et al., Determining the specificities of TALENs, Cas9, and other genome-editing enzymes. Methods Enzymol. 2014;546:47-78. doi: 10.1016/978-0-12-801185-0.00003-9. |
Pattanayak et al., High-throughput profiling of off-target DNA cleavage reveals RNA-programmed Cas9 nuclease specificity. Nat Biotechnol. Sep. 2013;31(9):839-43. doi: 10.1038/nbt.2673. Epub Aug. 11, 2013. |
Pattanayak et al., Revealing off-target cleavage specificities of zinc-finger nucleases by in vitro selection. Nat Methods. Aug. 7, 2011;8(9):765-70. doi: 10.1038/nmeth.1670. |
Pavletich et al., Zinc finger-DNA recognition: crystal structure of a Zif268-DNA complex at 2.1 A. Science. May 10, 1991;252(5007):809-17. |
Pearl, Structure and function in the uracil-DNA glycosylase superfamily. Mutat Res. Aug. 30, 2000;460(3-4):165-81. |
Peck et al., Directed evolution of a small-molecule-triggered intein with improved splicing properties in mammalian cells. Chem Biol. May 27, 2011;18(5):619-30. doi: 10.1016/j.chembiol.2011.02.014. |
Pelletier, CRISPR-Cas systems for the study of the immune function. Nov. 15, 2016. https://doi.org/10.1002/9780470015902.a0026896. |
Pennisi et al., The CRISPR craze. Science. Aug. 23, 2013;341(6148):833-6. doi: 10.1126/science.341.6148.833. |
Pennisi et al., The tale of the TALEs. Science. Dec. 14, 2012;338(6113):1408-11. doi: 10.1126/science.338.6113.1408. |
Perez et al., Establishment of HIV-1 resistance in CD4+ T cells by genome editing using zinc-finger nucleases. Nat Biotechnol. Jul. 2008;26(7):808-16. Doi: 10.1038/nbtl410. Epub Jun. 29, 2008. |
Perez-Pinera et al., Advances in targeted genome editing. Curr Opin Chem Biol. Aug. 2012;16(3-4):268-77. doi: 10.1016/j.cbpa.2012.06.007. Epub Jul. 20, 2012. |
Perez-Pinera et al., RNA-guided gene activation by CRISPR-Cas9-based transcription factors. Nat Methods. Oct. 2013;10(10):973-6. doi: 10.1038/nmeth.2600. Epub Jul. 25, 2013. |
Petek et al., Frequent endonuclease cleavage at off-target locations in vivo. Mol Ther. May 2010;18(5):983-6. Doi: 10.1038/mt.2010.35. Epub Mar. 9, 2010. |
Petolino et al., Editing Plant Genomes: a new era of crop improvement. Plant Biotechnol J. Feb. 2016;14(2):435-6. doi: 10.1111/pbi.12542. |
Phillips, The challenge of gene therapy and DNA delivery. J Pharm Pharmacol. Sep. 2001;53(9):1169-74. |
Plasterk et al., DNA inversions in the chromosome of Escherichia coli and in bacteriophage Mu: relationship to other site-specific recombination systems. Proc Natl Acad Sci U S A. Sep. 1983;80(17):5355-8. |
Plosky et al., CRISPR-Mediated Base Editing without DNA Double-Strand Breaks. Mol Cell. May 19, 2016;62(4):477-8. doi: 10.1016/j.molcel.2016.05.006. |
Pluciennik et al., PCNA function in the activation and strand direction of MutL? endonuclease in mismatch repair. Proc Natl Acad Sci U S A. Sep. 14, 2010;107(37):16066-71. doi: 10.1073/pnas.1010662107. Epub Aug. 16, 2010. |
Poller et al., A leucine-to-proline substitution causes a defective alpha 1-antichymotrypsin allele associated with familial obstructive lung disease. Genomics. Sep. 1993;17(3):740-3. |
Porteus, Design and testing of zinc finger nucleases for use in mammalian cells. Methods Mol Biol. 2008;435:47-61. doi: 10.1007/978-1-59745-232-8_4. |
Pospísilová et al., Hydrolytic cleavage of N6-substituted adenine derivatives by eukaryotic adenine and adenosine deaminases. Biosci Rep. 2008;28(6):335-347. doi:10.1042/BSR20080081. |
Pourcel et al., CRISPR elements in Yersinia pestis acquire new repeats by preferential uptake of bacteriophage DNA, and provide additional tools for evolutionary studies. Microbiology. Mar. 2005;151(Pt 3):653-63. |
Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology 2013;31(9):833-8. |
Prorocic et al., Zinc-finger recombinase activities in vitro. Nucleic Acids Res. Nov. 2011;39(21):9316-28. doi: 10.1093/nar/gkr652. Epub Aug. 17, 2011. |
Proudfoot et al., Zinc finger recombinases with adaptable DNA sequence specificity. PLoS One. Apr. 29, 2011;6(4):e19537. doi: 10.1371/journal.pone.0019537. |
Prykhozhij et al., CRISPR multitargeter: a web tool to find common and unique CRISPR single guide RNA targets in a set of similar sequences. PLoS One. Mar. 5, 2015;10(3):e0119372. doi: 10.1371/journal.pone.0119372. eCollection 2015. |
Putnam et al., Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase. J Mol Biol. Mar. 26, 1999;287(2):331-46. |
Qi et al., Engineering naturally occurring trans-acting non-coding RNAs to sense molecular signals. Nucleic Acids Res. Jul. 2012;40(12):5775-86. doi: 10.1093/nar/gks168. Epub Mar. 1, 2012. |
Qi et al., Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression. Cell. Feb. 28, 2013;152(5):1173-83. doi: 10.1016/j.cell.2013.02.022. |
Rakonjac et al., Roles of PIII in filamentous phage assembly. J Mol Biol. 1998; 282(1)25-41. |
Ramakrishna et al., Gene disruption by cell-penetrating peptide-mediated delivery of Cas9 protein and guide RNA. Genome Res. Jun. 2014;24(6):1020-7. doi: 10.1101/gr. 171264.113. Epub Apr. 2, 2014. |
Ramirez et al., Engineered zinc finger nickases induce homology-directed repair with reduced mutagenic effects. Nucleic Acids Res. Jul. 2012;40(12):5560-8. doi: 10.1093/nar/gks179. Epub Feb. 28, 2012. |
Ramirez et al., Unexpected failure rates for modular assembly of engineered zinc fingers. Nat Methods. May 2008;5(5):374-5. Doi: 10.1038/nmeth0508-374. |
Ran et al., Double Nicking by RNA-guided CRISPR Cas9 for Enhanced Genome Editing Specificity. Cell. Sep. 12, 2013;154(6):1380-9. doi: 10.1016/j.cell.2013.08.021. Epub Aug. 29, 2013. |
Ran et al., Genome engineering using the CRISPR-Cas9 system. Nat Protoc. Nov. 2013;8(11):2281-308. doi: 10.1038/nprot.2013.143. Epub Oct. 24, 2013. |
Ran et al., In vivo genome editing using Staphylococcus aureus Cas9. Nature. Apr. 9, 2015;520(7546):186-91. doi: 10.1038/nature14299. Epub Apr. 1, 2015. |
Rath et al., Fidelity of end joining in mammalian episomes and the impact of Metnase on joint processing. BMC Mol Biol. Mar. 22, 2014;15:6. doi: 10.1186/1471-2199-15-6. |
Ravishankar et al., X-ray analysis of a complex of Escherichia coli uracil DNA glycosylase (EcUDG) with a proteinaceous inhibitor. The structure elucidation of a prokaryotic UDG. Nuclei Acids Res. 26 (21): 4880-4887 (1998). |
Ray et al., Homologous recombination: ends as the means. Trends Plant Sci. Oct. 2002;7(10):435-40. |
Rebuzzini et al., New mammalian cellular systems to study mutations introduced at the break site by non-homologous end-joining. DNA Repair (Amst). May 2, 2005;4(5):546-55. |
Rees et al., Improving the DNA specificity and applicability of base editing through protein engineering and protein delivery. Nat Commun. Jun. 6, 2017;8:15790. doi: 10.1038/ncomms15790. |
Ren et al., In-line Alignment and Mg2? Coordination at the Cleavage Site of the env22 Twister Ribozyme. Nat Commun. Nov. 20, 2014;5:5534. doi: 10.1038/ncomms6534. |
Ren et al., Pistol Ribozyme Adopts a Pseudoknot Fold Facilitating Site-Specific In-Line Cleavage. Nat Chem Biol. Sep. 2016;12(9):702-8. doi: 10.1038/nchembio.2125. Epub Jul. 11, 2016. |
Reyon et al., FLASH assembly of TALENs for high-throughput genome editing. Nat Biotechnol. May 2012;30(5):460-5. doi: 10.1038/nbt.2170. |
Richardson et al., Enhancing homology-directed genome editing by catalytically active and inactive CRISPR-Cas9 using asymmetric donor DNA. Nat Biotechnol. Mar. 2016;34(3):339-44. doi: 10.1038/nbt.3481. Epub Jan. 20, 2016. |
Richter et al., Function and regulation of clustered regularly interspaced short palindromic repeats (CRISPR) / CRISPR associated (Cas) systems. Viruses. Oct. 19, 2012;4(10):2291-311. doi: 10.3390/v4102291. |
Riechmann et al.,. The C-terminal domain of To1A is the coreceptor for filamentous phage infection of E. coli. Cell. 1997; 90(2):351-60. PMID:9244308. |
Rong et al., Homologous recombination in human embryonic stem cells using CRISPR/Cas9 nickase and a long DNA donor template. Protein Cell. Apr. 2014;5(4):258-60. doi: 10.1007/S13238-014-0032-5. |
Rowland et al., Regulatory mutations in Sin recombinase support a structure-based model of the synaptosome. Mol Microbiol. Oct. 2009;74(2):282-98. doi: 10.1111/j.1365-2958.2009.06756.x. Epub Jun. 8, 2009. |
Rudolph et al., Synthetic riboswitches for the conditional control of gene expression in Streptomyces coelicolor. Microbiology. Jul. 2013;159(Pt 7):1416-22. doi: 10.1099/mic.0.067322-0. Epub May 15, 2013. |
Sadelain et al., Safe harbours for the integration of new DNA in the human genome. Nat Rev Cancer. Dec. 1, 2011;12(1):51-8. doi: 10.1038/nrc3179. |
Sage et al., Proliferation of functional hair cells in vivo in the absence of the retinoblastoma protein. Science. Feb. 18, 2005;307(5712):1114-8. Epub Jan. 13, 2005. |
Saleh-Gohari et al., Conservative homologous recombination preferentially repairs DNA double-strand breaks in the S phase of the cell cycle in human cells. Nucleic Acids Res. Jul. 13, 2004;32(12):3683-8. Print 2004. |
Samal et al., Cationic polymers and their therapeutic potential. Chem Soc Rev. Nov. 7, 2012;41(21):7147-94. doi: 10.1039/c2cs35094g. Epub Aug. 10, 2012. |
Sander et al., CRISPR-Cas systems for editing, regulating and targeting genomes. Nat Biotechnol. Apr. 2014;32(4):347-55. doi: 10.1038/nbt.2842. Epub Mar. 2, 2014. |
Sander et al., In silico abstraction of zinc finger nuclease cleavage profiles reveals an expanded landscape of off-target sites. Nucleic Acids Res. Oct. 2013;41(19):el81. doi: 10.1093/nar/gkt716. Epub Aug. 14, 2013. |
Sander et al., Targeted gene disruption in somatic zebrafish cells using engineered TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):697-8. doi: 10.1038/nbt.1934. |
Sang, Prospects for transgenesis in the chick. Meeh Dev. Sep. 2004;121(9):1179-86. |
Sanjana et al., A transcription activator-like effector toolbox for genome engineering. Nat Protoc. Jan. 5, 2012;7(1):171-92. doi: 10.1038/nprot.2011.431. |
Santiago et al., Targeted gene knockout in mammalian cells by using engineered zinc-finger nucleases. Proc Natl Acad Sci U S A. Apr. 15, 2008;105(15):5809-14. doi: 10.1073/pnas.0800940105. Epub Mar. 21, 2008. |
Sapranauskas et al., The Streptococcus thermophilus CRISPR/Cas system provides immunity in Escherichia coli. Nucleic Acids Res. Nov. 2011;39(21):9275-82. doi: 10.1093/nar/gkr606. Epub Aug. 3, 2011. |
Saraconi et al., The RNA editing enzyme APOBEC 1 induces somatic mutations and a compatible mutational signature is present in esophageal adenocarcinomas. Genome Biol. Jul. 31, 2014;15(7):417. doi: 10.1186/s13059-014-0417-z. |
Sashital et al., Mechanism of foreign DNA selection in a bacterial adaptive immune system. Mol Cell. Jun. 8, 2012;46(5):606-15. doi: 10.1016/j.molcel.2012.03.020. Epub Apr. 19, 2012. |
Sasidharan et al., The selection of acceptable protein mutations. PNAS; Jun. 12, 2007;104(24):10080-5. www.pnas.org/cgi/doi/10.1073.pnas.0703737104. |
Saudek et al., A preliminary trial of the programmable implantable medication system for insulin delivery. N Engl J Med. Aug. 31, 1989;321(9):574-9. |
Schriefer et al., Low pressure DNA shearing: a method for random DNA sequence analysis. Nucleic Acids Res. Dec. 25, 1990;18(24):7455-6. |
Schwank et al., Functional repair of CFTR by CRISPR/Cas9 in intestinal stem cell organoids of cystic fibrosis patients. Cell Stem Cell. Dec. 5, 2013;13(6):653-8. doi:10.1016/j.stem.2013.11.002. |
Schwartz et al., Post-translational enzyme activation in an animal via optimized conditional protein splicing. Nat Chem Biol. Jan. 2007;3(1):50-4. Epub Nov. 26, 2006. |
Schwarze et al., In vivo protein transduction: delivery of a biologically active protein into the mouse. Science. Sep. 3, 1999;285(5433):1569-72. |
Sclimenti et al., Directed evolution of a recombinase for improved genomic integration at a native human sequence. Nucleic Acids Res. Dec. 15, 2001;29(24):5044-51. |
Sefton et al., Implantable pumps. Crit Rev Biomed Eng. 1987;14(3):201-40. |
Segal et al., Toward controlling gene expression at will: selection and design of zinc finger domains recognizing each of the 5′-GNN-3′ DNA target sequences. Proc Natl Acad Sci U S A. Mar. 16, 1999;96(6):2758-63. |
Sells et al., Delivery of protein into cells using polycationic liposomes. Biotechniques. Jul. 1995;19(1):72-6, 78. |
Semenova et al., Interference by clustered regularly interspaced short palindromic repeat (CRISPR) RNA is governed by a seed sequence. Proc Natl Acad Sci U S A. Jun. 21, 2011;108(25):10098-103. doi: 10.1073/pnas.1104144108. Epub Jun. 6, 2011. |
Semple et al., Rational design of cationic lipids for siRNA delivery. Nat Biotechnol. Feb. 2010;28(2):172-6. doi: 10.1038/nbt.1602. Epub Jan. 17, 2010. |
Serganov et al., Coenzyme recognition and gene regulation by a flavin mononucleotide riboswitch. Nature. Mar. 12, 2009;458(7235):233-7. doi: 10.1038/nature07642. Epub Jan. 25, 2009. |
Serganov et al., Structural basis for discriminative regulation of gene expression by adenine-and guanine-sensing mRNAs. Chem Biol. Dec. 2004;11(12):1729-41. |
Serganov et al., Structural basis for gene regulation by a thiamine pyrophosphate-sensing riboswitch. Nature. Jun. 29, 2006;441(7097): 1167-71. Epub May 21, 2006. |
Seripa et al., The missing ApoE allele. Ann Hum Genet. Jul. 2007;71(Pt 4):496-500. Epub Jan. 22, 2007. |
Shah et al., Inteins: nature's gift to protein chemists. Chem Sci. 2014;5(1):446-461. |
Shah et al., Kinetic control of one-pot trans-splicing reactions by using a wild-type and designed split intein. Angew Chem Int Ed Engl. Jul. 11, 2011;50(29):6511-5. doi: 10.1002/anie.201102909. Epub Jun. 8, 2011. |
Shah et al., Target-specific variants of Flp recombinase mediate genome engineering reactions in mammalian cells. FEBS J. Sep. 2015;282(17):3323-33. doi: 10.1111/febs.13345. Epub Jul. 1, 2015. |
Shalem et al., Genome-scale CRISPR-Cas9 knockout screening in human cells. Science. Jan. 3, 2014;343(6166):84-7. doi: 10.1126/science.1247005. Epub Dec. 12, 2013. |
Sharbeen et al., Ectopic restriction of DNA repair reveals that UNG2 excises AID-induced uracils predominantly or exclusively during G1 phase. J Exp Med. May 7, 2012;209(5):965-74. doi: 10.1084/jem.20112379. Epub Apr. 23, 2012. |
Sharma et al., Efficient introduction of aryl bromide functionality into proteins in vivo. FEBS Lett. Feb. 4, 2000;467(1):37-40. |
Shcherbakova et al., Near-infrared fluorescent proteins for multicolor in vivo imaging. Nat Methods. Aug. 2013;10(8):751-4. doi: 10.1038/nmeth.2521. Epub Jun. 16, 2013. |
Shee et al., Engineered proteins detect spontaneous DNA breakage in human and bacterial cells. Elife. Oct. 29, 2013;2:e01222. doi: 10.7554/eLife.01222. |
Sheridan, First CRISPR-Cas patent opens race to stake out intellectual property. Nat Biotechnol. 2014;32(7):599-601. |
Sheridan, Gene therapy finds its niche. Nat Biotechnol. Feb. 2011;29(2):121-8. doi: 10.1038/nbt.1769. |
Shimantani et al., Targeted base editing in rice and tomato using a CRISPR-Cas9 cytidine deaminase fusion. Nat Biotechnol. May 2017;35(5):441-443. doi: 10.1038/nbt.3833. Epub Mar. 27, 2017. |
Shimojima et al., Spinocerebellar ataxias type 27 derived from a disruption of the fibroblast growth factor 14 gene with mimicking phenotype of paroxysmal non-kinesigenic dyskinesia. Brain Dev. Mar. 2012;34(3):230-3. doi: 10.1016/j.braindev.2011.04.014. Epub May 19, 2011. |
Shmakov et al., Discovery and Functional Characterization of Diverse Class 2 CRISPR Cas Systems. Molecular Cell Nov. 2015;60(3):385-97. |
Siebert et al., An improved PCR method for walking in uncloned genomic DNA. Nucleic Acids Res. Mar. 25, 1995;23(6):1087-8. |
Simonelli et al., Base excision repair intermediates are mutagenic in mammalian cells. Nucleic Acids Res. Aug. 2, 2005;33(14):4404-11. Print 2005. |
Sirk et al., Expanding the zinc-finger recombinase repertoire: directed evolution and mutational analysis of serine recombinase specificity determinants. Nucleic Acids Res. Apr. 2014;42(7):4755-66. doi: 10.1093/nar/gkt1389. Epub Jan. 21, 2014. |
Sjoblom et al., The consensus coding sequences of human breast and colorectal cancers. Science. Oct. 13, 2006;314(5797):268-74. Epub Sep. 7, 2006. |
Skretas et al., Regulation of protein activity with small-molecule-controlled inteins. Protein Sci. Feb. 2005;14(2):523-32. Epub Jan. 4, 2005. |
Slaymaker et al., Rationally engineered Cas9 nucleases with improved specificity. Science. Jan. 1, 2016 ;351(6268):84-8. doi: 10.1126/science.aad5227. Epub Dec. 1, 2015. |
Smith et al., Expression of a dominant negative retinoic acid receptor γ in Xenopus embryos leads to partial resistance to retinoic acid. Roux Arch Dev Biol. Mar. 1994;203(5):254-265. doi: 10.1007/BF00360521. |
Smith, Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface. Science. Jun. 14, 1985;228(4705):1315-7. |
Stenglein et al., APOBEC3 proteins mediate the clearance of foreign DNA from human cells. Nat Struct Mol Biol. Feb. 2010;17(2):222-9. doi: 10.1038/nsmb.1744. Epub Jan. 10, 2010. |
Stephens et al., The landscape of cancer genes and mutational processes in breast cancer. Nature Jun. 2012;486:400-404. doi: 10.1038/nature11017. |
Sternberg et al., DNA interrogation by the CRISPR RNA-guided endonuclease Cas9. Nature.Mar. 6, 2014;507(7490):62-7. doi: 10.1038/nature13011. Epub Jan. 29, 2014. |
Stevens et al., Design of a Split Intein with Exceptional Protein-Splicing Activity. J Am Chem Soc. Feb. 24, 2016;138(7):2162-5. doi: 10.1021/jacs.5b13528. Epub Feb. 8, 2016. |
Sudarsan et al., An mRNA structure in bacteria that controls gene expression by binding lysine. Genes Dev. Nov. 1, 2003;17(21):2688-97. |
Suess et al., A theophylline responsive riboswitch based on helix slipping controls gene expression in vivo. Nucleic Acids Res. Mar. 5, 2004;32(4):1610-4. |
Sun et al., Optimized TAL effector nucleases (TALENs) for use in treatment of sickle cell disease. Mol Biosyst. Apr. 2012;8(4):1255-63. doi: 10.1039/c2mb05461b. Epub Feb. 3, 2012. |
Sun et al., The CRISPR/Cas9 system for gene editing and its potential application in pain research. Transl Periop & Pain Med. Aug. 3, 2016;1(3):22-33. |
Swarts et al., Argonaute of the archaeon Pyrococcus furiosus is a DNA-guided nuclease that targets cognate DNA. Nucleic Acids Res. May 26, 2015;43(10):5120-9. doi: 10.1093/nar/gkv415. Epub Apr. 29, 2015. |
Swarts et al., DNA-guided DNA interference by a prokaryotic Argonaute. Nature. Mar. 13, 2014;507(7491):258-61. doi: 10.1038/nature12971. Epub Feb. 16, 2014. |
Swarts et al., The evolutionary journey of Argonaute proteins. Nat Struct Mol Biol. Sep. 2014;21(9):743-53. doi: 10.1038/nsmb.2879. |
Szczepek et al., Structure-based redesign of the dimerization interface reduces the toxicity of zinc-finger nucleases. Nat Biotechnol. Jul. 2007;25(7):786-93. Epub Jul. 1, 2007. |
Tagalakis et al., Lack of RNA-DNA oligonucleotide (chimeraplast) mutagenic activity in mouse embryos. Mol Reprod Dev. Jun. 2005;71(2):140-4. |
Tang et al., Aptazyme-embedded guide RNAs enable ligand-responsive genome editing and transcriptional activation. Nat Commun. Jun. 28, 2017;8:15939. doi: 10.1038/ncomms15939. |
Tebas et al., Gene editing of CCR5 in autologous CD4 T cells of persons infected with Hiv. N Engl J Med. Mar. 6, 2014;370(10):901-10. doi: 10.1056/NEJMoa1300662. |
Tessarollo et al., Targeted mutation in the neurotrophin-3 gene results in loss of muscle sensory neurons. Proc Natl Acad Sci U S A. Dec. 6, 1994;91(25):11844-8. |
Tesson et al., Knockout rats generated by embryo microinjection of TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):695-6. doi: 10.1038/nbt.1940. |
Thompson et al., Cellular uptake mechanisms and endosomal trafficking of supercharged proteins. Chem Biol. Jul. 27, 2012;19(7):831-43. doi: 10.1016/j.chembiol.2012.06.014. |
Thompson et al., Engineering and identifying supercharged proteins for macromolecule delivery into mammalian cells. Methods Enzymol. 2012;503:293-319. doi: 10.1016/B978-0-12396962-0.00012-4. |
Thorpe et al., Functional correction of episomal mutations with short DNA fragments and RNA-DNA oligonucleotides. J Gene Med. Mar.-Apr. 2002;4(2):195-204. |
Thyagarajan et al., Mammalian genomes contain active recombinase recognition sites. Gene. Feb. 22, 2000;244(1-2):47-54. |
Thyagarajan et al., Site-specific genomic integration in mammalian cells mediated by phage phiC31 integrase. Mol Cell Biol. Jun. 2001;21(12):3926-34. |
Tirumalai et al., Recognition of core-type DNA sites by lambda integrase. J Mol Biol. Jun. 12, 1998;279(3):513-27. |
Tourdot et al., A general strategy to enhance immunogenicity of low-affinity HLA-A2. 1-associated peptides: implication in the identification of cryptic tumor epitopes. Eur J Immunol. Dec. 2000;30(12):3411-21. |
Trausch et al., The structure of a tetrahydrofolate-sensing riboswitch reveals two ligand binding sites in a single aptamer. Structure. Oct. 12, 2011;19(10):1413-23. doi: 10.1016/j.str.2011.06.019. Epub Sep. 8, 2011. |
Truong et al., Development of an intein-mediated split-Cas9 system for gene therapy. Nucleic Acids Res. Jul. 27, 2015;43(13):6450-8. doi: 10.1093/nar/gkv601. Epub Jun. 16, 2015. With Supplementary Data. |
Tsai et al., Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editing. Nat Biotechnol. Jun. 2014;32(6):569-76. doi: 10.1038/nbt.2908. Epub Apr. 25, 2014. |
Tsai et al., GUIDE-seq enables genome-wide profiling of off-target cleavage by CRISPR-Cas nucleases. Nat Biotechnol. Feb. 2015;33(2):187-97. doi: 10.1038/nbt.3117. Epub Dec. 16, 2014. |
Turan et al., Recombinase-mediated cassette exchange (RMCE)—a rapidly-expanding toolbox for targeted genomic modifications. Gene. Feb. 15, 2013;515(1):1-27. doi: 10.1016/j.gene.2012.1 1.016. Epub Nov. 29, 2012. |
Turan et al., Recombinase-mediated cassette exchange (RMCE): traditional concepts and current challenges. J Mol Biol. Mar. 25, 2011;407(2):193-221. doi: 10.1016/j.jmb.2011.01.004. Epub Jan. 15, 2011. |
Turan et al., Site-specific recombinases: from tag-and-target-to tag-and-exchange-based genomic modifications. FASEB J. Dec. 2011;25(12):4088-107. doi: 10.1096/fj.11-186940. Epub Sep. 2, 2011. Review. |
UNIPROT Submission; UniProt, Accession No. P01011. Last modified Jun. 11, 2014, version 2. 15 pages. |
UNIPROT Submission; UniProt, Accession No. P01011. Last modified Sep. 18, 2013, version 2. 15 pages. |
UNIPROT Submission; UniProt, Accession No. P04264. Last modified Jun. 11, 2014, version 6. 15 pages. |
UNIPROT Submission; UniProt, Accession No. P04275. Last modified Jul. 9, 2014, version 107. 29 pages. |
Urnov et al., Genome editing with engineered zinc finger nucleases. Nat Rev Genet. Sep. 2010;11(9):636-46. doi: 10.1038/nrg2842. |
Urnov et al., Highly efficient endogenous human gene correction using designed zinc-finger nucleases. Nature. Jun. 2, 2005;435(7042):646-51. Epub Apr. 3, 2005. |
Vagner et al., Efficiency of homologous DNA recombination varies along the Bacillus subtilis chromosome. J Bacteriol. Sep. 1988;170(9):3978-82. |
Van Duyne et al., Teaching Cre to follow directions. Proc Natl Acad Sci U S A. Jan. 6, 2009;106(1):4-5. doi: 10.1073/pnas.0811624106. Epub Dec. 31, 2008. |
Van Swieten et al., A mutation in the fibroblast growth factor 14 gene is associated with autosomal dominant cerebellar ataxia [corrected]. Am J Hum Genet. Jan. 2003;72(l):191-9. Epub Dec. 13, 2002. |
Vanamee et al., FokI requires two specific DNA sites for cleavage. J Mol Biol. May 25, 2001;309(1):69-78. |
Vitreschak et al., Regulation of the vitamin B12 metabolism and transport in bacteria by a conserved RNA structural element. RNA. Sep. 2003;9(9):1084-97. |
Wacey et al., Disentangling the perturbational effects of amino acid substitutions in the DNA-binding domain of p53. Hum Genet. Jan. 1999;104(1):15-22. |
Wadia et al., Modulation of cellular function by TAT mediated transduction of full length proteins. Curr Protein Pept Sci. Apr. 2003;4(2):97-104. |
Wadia et al., Transducible TAT-HA fusogenic peptide enhances escape of TAT-fusion proteins after lipid raft macropinocytosis. Nat Med. Mar. 2004;10(3):310-5. Epub Feb. 8, 2004. |
Wah et al., Structure of FokI has implications for DNA cleavage. Proc Natl Acad Sci U S A. Sep. 1, 1998;95(18):10564-9. |
Wals et al., Unnatural amino acid incorporation in E. coli: current and future applications in the design of therapeutic proteins. Front Chem. Apr. 1, 2014;2:15. doi: 10.3389/fchem.2014.00015. eCollection 2014. |
Wang et al. CRISPR-Cas9 and CRISPR-Assisted Cytidine Deaminase Enable Precise and Efficient Genome Editing in Klebsiella pneumoniae. Appl Environ Microbiol. 2018;84(23):e01834-18. Published Nov. 15, 2018. doi:10.1128/AEM.01834-18. |
Wang et al., CRISPR-Cas9 Targeting of PCSK9 in Human Hepatocytes In Vivo-Brief Report. Arterioscler Thromb Vase Biol. May 2016;36(5):783-6. doi: 10.1161/ATVBAHA.116.307227. Epub Mar. 3, 2016. |
Wang et al., Efficient delivery of genome-editing proteins using bioreducible lipid nanoparticles. Proc Natl Acad Sci U S A. Feb. 29, 2016. pii: 201520244. [Epub ahead of print]. |
Wang et al., Enhanced base editing by co-expression of free uracil DNA glycosylase inhibitor. Cell Res. Oct. 2017;27(1):1289-92. doi: 10.1038/cr.2017.111. Epub Aug. 29, 2017. |
Wang et al., Genetic screens in human cells using the CRISPR-Cas9 system. Science. Jan. 3, 2014;343(6166):80-4. doi: 10.1126/science.l246981. Epub Dec. 12, 2013. |
Wang et al., Nucleation, propagation and cleavage of target RNAs in Ago silencing complexes. Nature. Oct. 8, 2009;461(7265):754-61. doi: 10.1038/nature08434. |
Wang et al., One-step generation of mice carrying mutations in multiple genes by CRISPR/Cas-mediated genome engineering. Cell. May 9, 2013;153(4):910-8. doi: 10.1016/j.cell.2013.04.025. Epub May 2, 2013. |
Wang et al., Recombinase technology: applications and possibilities. Plant Cell Rep. Mar. 2011;30(3):267-85. doi: 10.1007/s00299-010-0938-1. Epub Oct. 24, 2010. |
Wang et al., Riboswitches that sense S-adenosylhomocysteine and activate genes involved in coenzyme recycling. Mol Cell. Mar. 28, 2008;29(6):691-702. doi: 10.1016/j.molcel.2008.01.012. |
Wang et al., Targeted gene addition to a predetermined site in the human genome using a ZHN-based nicking enzyme. Genome Res. Jul. 2012;22(7):1316-26. doi: 10.1101/gr.122879.111. Epub Mar. 20, 2012. |
Wang et al., Uracil-DNA glycosylase inhibitor gene of bacteriophage PBS2 encodes a binding protein specific for uracil-DNA glycosylase. J Biol Chem. Jan. 15, 1989;264(2):1163-71. |
Warren et al., A chimeric Cre recombinase with regulated directionality. Proc Natl Acad Sci U S A. Nov. 25, 2008;105(47):18278-83. doi: 10.1073/pnas.0809949105. Epub Nov. 14, 2008. |
Warren et al., Mutations in the amino-terminal domain of lambda-integrase have differential effects on integrative and excisive recombination. Mol Microbiol. Feb. 2005;55(4):1104-12. |
Weber et al., Assembly of designer TAL effectors by Golden Gate cloning. PLoS One. 2011;6(5):e19722. doi:10.1371/journal.pone.0019722. Epub May 19, 2011. |
Weinberg et al., New Classes of Self-Cleaving Ribozymes Revealed by Comparative Genomics Analysis. Nat Chem Biol. Aug. 2015;11(8):606-10. doi: 10.1038/nchembio.1846. Epub Jul. 13, 2015. |
Weinberg et al., The aptamer core of SAM-IV riboswitches mimics the ligand-binding site of SAM-I riboswitches. RNA. May 2008;14(5):822-8. doi: 10.1261/rna.988608. Epub Mar. 27, 2008. |
Weinberger et al., Disease-causing mutations C277R and C277Y modify gating of human C1C-1 chloride channels in myotonia congenita. J Physiol. Aug. 1, 2012;590(Pt 15):3449-64. doi: 0.1113/jphysiol.2012.232785. Epub May 28, 2012. |
Wiedenheft et al., RNA-guided genetic silencing systems in bacteria and archaea. Nature. Feb. 15, 2012;482(7385):331-8. doi: 10.1038/naturel0886. Review. |
Wijesinghe et al., Efficient deamination of 5-methylcytosines in DNA by human APOBEC3A, but not by AID or APOBEC3G. Nucleic Acids Res. Oct. 2012;40(18):9206-17. doi: 10.1093/nar/gks685. Epub Jul. 13, 2012. |
Wijnker et al., Managing meiotic recombination in plant breeding. Trends Plant Sci. Dec. 2008;13(12):640-6. doi: 10.1016/j.tplants.2008.09.004. Epub Oct. 22, 2008. |
Wilson et al., Assessing annotation transfer for genomics: quantifying the relations between protein sequence, structure and function through traditional and probabilistic scores. J Mol Biol 2000;297:233-49. |
Wilson et al., In Vitro Selection of Functional Nucleic Acids. Annu Rev Biochem. 1999;68:611-47. doi: 10.1146/annurev.biochem.68.1.611. |
Winkler et al., An mRNA structure that controls gene expression by binding FMN. Proc Natl Acad Sci U S A. Dec. 10, 2002;99(25):15908-13. Epub Nov. 27, 2002. |
Winkler et al., Control of gene expression by a natural metabolite-responsive ribozyme. Nature. Mar. 18, 2004;428(6980):281-6. |
Winkler et al., Thiamine derivatives bind messenger RNAs directly to regulate bacterial gene expression. Nature. Oct. 31, 2002;419(6910):952-6. Epub Oct. 16, 2002. |
Wolf et al., tadA, an essential tRNA-specific adenosine deaminase from Escherichia coli. Embo J. Jul. 15, 2002;21(14):3841-51. |
Wolfe et al., Analysis of zinc fingers optimized via phage display: evaluating the utility of a recognition code. J Mol Biol. Feb. 5, 1999;285(5):1917-34. |
Wood et al., Targeted genome editing across species using ZFNs and TALENs. Science. Jul. 15, 2011;333(6040):307. doi: 10.1126/science. 1207773. Epub Jun. 23, 2011. |
Wu et al., Correction of a genetic disease in mouse via use of CRISPR-Cas9. Cell Stem Cell. Dec. 5, 2013;13(6):659-62. doi: 10.1016/j.stem.2013.10.016. |
Wu et al., Genome-wide binding of the CRISPR endonuclease Cas9 in mammalian cells. Nat Biotechnol. Jul. 2014;32(7):670-6. doi: 10.1038/nbt.2889. Epub Apr. 20, 2014. |
Xu et al., Sequence determinants of improved CRISPR sgRNA design. Genome Res. Aug. 2015;25(8):1147-57. doi: 10.1101/gr. 191452.115. Epub Jun. 10, 2015. |
Yahata et al., Unified, Efficient, and Scalable Synthesis of Halichondrins: Zirconium/Nickel-Mediated One-Pot Ketone Synthesis as the Final Coupling Reaction. Angew Chem Int Ed Engl. Aug. 28, 2017;56(36):10796-10800. doi: 10.1002/anie.201705523. Epub Jul. 28, 2017. |
Yamamoto et al., Virological and immunological bases for HIV-1 vaccine design. Uirusu 2007;57(2): 133-139. https://doi.org/10.2222/jsv.57.133. |
Yamano et al., Crystal Structure of Cpf1 in Complex with Guide RNA and Target DNA. Cell May 2016;165(4)949-62. |
Yang et al., APOBEC: From mutator to editor. J Genet Genomics. Sep. 20, 2017;44(9):423-437. doi: 10.1016/j.jgg.2017.04.009. Epub Aug. 7, 2017. |
Yang et al., Engineering and optimising deaminase fusions for genome editing. Nat Commun. Nov. 2, 2016;7:13330. doi: 10.1038/ncomms13330. |
Yang et al., Genome editing with targeted deaminases. BioRxiv. Preprint. First posted online Jul. 28, 2016. |
Yang et al., New CRISPR-Cas systems discovered. Cell Res. Mar. 2017;27(3):313-314. doi: 10.1038/cr.2017.21. Epub Feb. 21, 2017. |
Yang et al., PAM-dependent Target DNA Recognition and Cleavage by C2C1 CRISPR-Cas endonuclease. Cell Dec. 2016;167(7):1814-28. |
Yanover et al., Extensive protein and DNA backbone sampling improves structure-based specificity prediction for C2H2 zinc fingers. Nucleic Acids Res. Jun. 2011;39(11):4564-76. doi: 10.1093/nar/gkr048. Epub Feb. 22, 2011. |
Yazaki et al., Hereditary systemic amyloidosis associated with a new apolipoprotein AII stop codon mutation Stop78Arg. Kidney Int. Jul. 2003;64(1):-6. |
Yin et al., Genome editing with Cas9 in adult mice corrects a disease mutation and phenotype. Nat Biotechnol. Jun. 2014;32(6):551-3. doi: 10.1038/nbt.2884. Epub Mar. 30, 2014. |
Young et al., Beyond the canonical 20 amino acids: expanding the genetic lexicon. J Biol Chem. Apr. 9, 2010;285(15):11039-44. doi: 10.1074/jbc.R109.091306. Epub Feb. 10, 2010. |
Yu et al., Liposome-mediated in vivo E1 A gene transfer suppressed dissemination of ovarian cancer cells that overexpress HER-2/neu. Oncogene. Oct. 5, 1995;11(7):1383-8. |
Yuan et al., Laboratory-directed protein evolution. Microbiol Mol Biol Rev. 2005; 69(3):373-92. PMID: 16148303. |
Yuan et al., Tetrameric structure of a serine integrase catalytic domain. Structure. Aug. 6, 2008;16(8):1275-86. doi: 10.1016/j.str.2008.04.018. |
Yuen et al., Control of transcription factor activity and osteoblast differentiation in mammalian cells using an evolved small-molecule-dependent intein. J Am Chem Soc. Jul. 12, 2006;128(27):8939-46. |
Zelphati et al., Intracellular delivery of proteins with a new lipid-mediated delivery system. J Biol Chem. Sep. 14, 2001;276(37):35103-10. Epub Jul. 10, 2001. |
Zetsche et al., A split-Cas9 architecture for inducible genome editing and transcription modulation. Nat Biotechnol. Feb. 2015;33(2):139-42. doi: 10.1038/nbt.3149. |
Zetsche et al., Cpf1 is a single RNA-guided endonuclease of a class 2 CRISPR-Cas system. Cell. Oct. 22, 2015;163(3):759-71. doi: 10.1016/j.cell.2015.09.038. Epub Sep. 25, 2015. |
Zhang et al., Comparison of non-canonical PAMs for CRISPR/Cas9-mediated DNA cleavage in human cells. Sci Rep. Jun. 2014;4:5405. |
Zhang et al., Conditional gene manipulation: Cre-ating a new biological era. J Zhejiang Univ Sci B. Jul. 2012;13(7):511-24. doi: 10.1631/jzus.B1200042. Review. |
Zhang et al., CRISPR/Cas9 for genome editing: progress, implications and challenges. Hum Mol Genet. Sep. 15, 2014;23(R1):R40-6. doi: 10.1093/hmg/ddu125. Epub Mar. 20, 2014. |
Zhang et al., Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription. Nat Biotechnol. Feb. 2011;29(2):149-53. doi: 10.1038/nbt.1775. Epub Jan. 19, 2011. |
Zhang et al., Programmable base editing of zebrafish genome using a modified CRISPR-Cas9 system. Nat Commun. Jul. 25, 2017;8(1):118. doi: 10.1038/s41467-017-00175-6. |
Zhang et al., Ribozymes and Riboswitches: Modulation of RNA Function by Small Molecules. Biochemistry. Nov. 2, 2010;49(43):9123-31. doi: 10.1021/bi1012645. |
Zhang et al., Stabilized plasmid-lipid particles for regional gene therapy: formulation and transfection properties. Gene Ther. Aug. 1999;6(8):1438-47. |
Zheng et al., DNA editing in DNA/RNA hybrids by adenosine deaminases that act on RNA. Nucleic Acids Res. Apr. 7, 2017;45(6):3369-3377. doi: 10.1093/nar/gkx050. |
Zhong et al., Rational Design of Aptazyme Riboswitches for Efficient Control of Gene Expression in Mammalian Cells. Elife. Nov. 2, 2016;5:e18858. doi: 10.7554/eLife.18858. |
Zimmermann et al., Molecular interactions and metal binding in the theophylline-binding core of an RNA aptamer. RNA. May 2000;6(5):659-67. |
Zong et al., Precise base editing in rice, wheat and maize with a Cas9-cytidine deaminase fusion. Nat Biotechnol. May 2017;35(5):438-440. doi: 10.1038/nbt.3811. Epub Feb. 27, 2017. |
Zorko et al., Cell-penetrating peptides: mechanism and kinetics of cargo delivery. Adv Drug Deliv Rev. Feb. 28, 2005;57(4):529-45. Epub Jan. 22, 2005. |
Zou et al., Gene targeting of a disease-related gene in human induced pluripotent stem and embryonic stem cells. Cell Stem Cell. Jul. 2, 2009;5(1):97-110. doi: 10.1016/j.stem.2009.05.023. Epub Jun. 18, 2009. |
Zuris et al., Cationic lipid-mediated delivery of proteins enables efficient protein-based genome editing in vitro and in vivo. Nat Biotechnol. 2015;33:73-80. |
GENBANK Submission; NIH/NCBI, Accession No. NM 174936.3. Bernardini et al., Oct. 28, 2015. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. YP_009283008.1. Bernardini et al., Sep. 23, 2016. 2 pages. |
Anders et al., Structural basis of PAM-dependent target DNA recognition by the Cas9 endonuclease. Nature. Sep. 25, 2014;513(7519):569-73. doi: 10.1038/nature13579. Epub Jul. 27, 2014. Europe PMC Funders Group. Author manuscript. Available OMC Mar. 25, 2015. |
Bertolotti et al., Toward genosafe endonuclease-boosted gene targeting using breakthrough CRISP/Cas9 for next generation stem cell gene therapy culminating in efficient ex VIVO in VIVO gene repair/genomic editing. Molecular Therapy. May 2015;23(Suppl1):S139. Abstract 350. 18th Ann Meeting of the American Society of Gene and Cell Therapy. ASGCT 2015. New Orleans, LA. May 13, 2015-May 16, 2015. |
Li et al., Protein trans-splicing as a means for viral vector-mediated in vivo gene therapy. Hum GeneTher. Sep. 2008;19(9):958-64. doi: 10.1089/hum.2008.009. |
Lienert et al., Two- and three-input TALE-based and logic computation in embryonic stem cells. Nucleic Acids Res. Nov. 2013;41(21):9967-75. doi: 10.1093/nar/gkt758. Epub Aug. 27, 2013. |
Rogozin et al., Evolution and diversification of lamprey antigen receptors: evidence for involvement of an AID-APOBEC family cytosine deaminase. Nat Immunol. Jun. 2007;8(6):647-56. doi: 10.1038/ni1463. Epub Apr. 29, 2007. |
Wright et al., Rational design of a split-Cas9 enzyme complex. Proc Natl Acad Sci U S A. Mar. 10, 2015;112(10):2984-9. doi: 10.1073/pnas.1501698112. Epub Feb. 23, 2015. |
U.S. Appl. No. 17/160,329, filed Jan. 27, 2021, Liu et al. |
U.S. Appl. No. 17/130,812, filed Dec. 22, 2020, Liu et al. |
U.S. Appl. No. 17/148,059, filed Jan. 13, 2021, Liu et al. |
U.S. Appl. No. 16/976,047, filed Aug. 26, 2020, Liu et al. |
U.S. Appl. No. 17/289,665, filed Apr. 28, 2021, Liu et al. |
U.S. Appl. No. 16/772,747, filed Jun. 12, 2020, Shen et al. |
U.S. Appl. No. 17/425,261, filed Jul. 22, 2021, Kim et al. |
U.S. Appl. No. 17/270,396, filed Feb. 22, 2021, Liu et al. |
U.S. Appl. No. 17/273,688, filed Mar. 4, 2021, Liu et al. |
U.S. Appl. No. 17/288,504, filed Apr. 23, 2021, Liu et al. |
U.S. Appl. No. 17/219,590, filed Mar. 31, 2021, Liu et al. |
U.S. Appl. No. 17/219,635, filed Mar. 31, 2021, Liu et al. |
U.S. Appl. No. 17/219,672, filed Mar. 31, 2021, Liu et al. |
U.S. Appl. No. 17/294,287, filed May 14, 2021, Liu et al. |
U.S. Appl. No. 17/408,306, filed Aug. 20, 2021, Liu et al. |
U.S. Appl. No. 17/436,048, filed Sep. 2, 2021, Liu et al. |
[No Author Listed] “Human genome.” Encyclopedia Britannica. Encyclopedia Brittanica, Inc. Published Feb. 15, 2019. Last accessed online via https://www.britannica.com/science/human-genome on Mar. 19, 2021. 2 pages. |
[No Author Listed] HyPhy—Hypothesis testing using Phylogenies. Last modified Apr. 21, 2017. Accessed online via http://hyphy.org/w/index.php/Main_Page on Apr. 28, 2021. |
[No Author Listed] NCBI Accession No. XP_015843220.1. C->U editing enzyme APOBEC-1 [Peromyscus maniculatus bairdii], XP002793540. Mar. 21, 2016. |
[No Author Listed] NCBI Accession No. XP_021505673.1. C->U editing enzyme APOBEC-1 [Meriones unguiculatus], XP002793541. Jun. 27, 2017. |
Abremski et al., Bacteriophage P1 site-specific recombination. Purification and properties of the Cre recombinase protein. J Biol Chem. Feb. 10, 1984;259(3):1509-14. |
Abudayyeh et al., A cytosine deaminase for programmable single-base RNA editing. Science. Jul. 26, 2019;365(6451):382-386. doi: 10.1126/science.aax7063. Epub Jul. 11, 2019. |
Abudayyeh et al., RNA targeting with CRISPR-Casl3. Nature. Oct. 12, 2017;550(7675):280-284. doi: 10.1038/nature24049. Epub Oct. 4, 2017. |
Ada et al., Carbohydrate-protein conjugate vaccines. Clin Microbiol Infect. Feb. 2003;9(2):79-85. doi: 10.1046/j.1469-0691.2003.00530.x. |
Adamala et al., Programmable RNA-binding protein composed of repeats of a single modular unit. Proc Natl Acad Sci U S A. May 10, 2016;113(19):E2579-88. doi: 10.1073/pnas.1519368113. Epub Apr. 26, 2016. |
Adams et al., New biarsenical ligands and tetracysteine motifs for protein labeling in vitro and in vivo: synthesis and biological applications. J Am Chem Soc. May 29, 2002;124(21):6063-76. doi: 10.1021/ja017687n. |
Adli, The CRISPR tool kit for genome editing and beyond. Nat Commun. May 15, 2018;9(1):1911. doi: 10.1038/s41467-018-04252-2. |
Aguilo et al., Coordination of m(6)A mRNA Methylation and Gene Transcription by ZFP217 Regulates Pluripotency and Reprogramming. Cell Stem Cell. Dec. 3, 2015;17(6):689-704. doi: 10.1016/j.stem.2015.09.005. Epub Oct. 29, 2015. |
Ahmad et al., Antibody-mediated specific binding and cytotoxicity of liposome-entrapped doxorubicin to lung cancer cells in vitro. Cancer Res. Sep. 1, 1992;52(17):4817-20. |
Aik et al., Structure of human RNA N?-methyladenine demethylase ALKBH5 provides insights into its mechanisms of nucleic acid recognition and demethylation. Nucleic Acids Res. Apr. 2014;42(7):4741-54. doi: 10.1093/nar/gku085. Epub Jan. 30, 2014. |
Aird et al., Increasing Cas9-mediated homology-directed repair efficiency through covalent tethering of DNA repair template. Commun Biol. May 31, 2018; 1:54. doi: 10.1038/s42003-018-0054-2. |
Akcakaya et al., In vivo CRISPR editing with no detectable genome-wide off-target mutations. Nature. Sep. 2018;561(7723):416-419. doi: 10.1038/s41586-018-0500-9. Epub Sep. 12, 2018. PMID: 30209390; PMCID: PMC6194229. |
Akins et al., Mitochondrial plasmids of Neurospora: integration into mitochondrial DNA and evidence for reverse transcription in mitochondria. Cell. Nov. 21, 1986;47(4):505-16. doi: 10.1016/0092-8674(86)90615-x. |
Akinsheye et al., Fetal hemoglobin in sickle cell anemia. Blood. Jul. 7, 2011; 118(1):19-27. doi: 10.1182/blood-2011-03-325258. Epub Apr. 13, 2011. |
Alarcón et al., HNRNPA2B1 is a Mediator of m(6)A-Dependent Nuclear RNA Processing Events. Cell. Sep. 10, 2015;162(6):1299-308. doi: 10.1016/j.cell.2015.08.011. Epub Aug. 27, 2015. |
Alarcón et al., N6-methyladenosine marks primary microRNAs for processing. Nature. Mar. 26, 2015;519(7544):482-5. doi: 10.1038/nature14281. Epub Mar. 18, 2015. |
Alexander, HFE-associated hereditary hemochromatosis. Genet Med. May 2009;11(5):307-13. doi: 10.1097/GIM.0b013e31819d30f2. |
Altschul et al., Basic local alignment search tool. J Mol Biol. Oct. 5, 1990;215(3):403-10. doi: 10.1016/S0022-2836(05)80360-2. |
Amrann et al., Tightly regulated tac promoter vectors useful for the expression of unfused and fused proteins in Escherichia coli. Gene. Sep. 30, 1988;69(2):301-15. |
Anders et al., Chapter One: In Vitro Enzymology of Cas9. in Methods in Enzymology, eds Doudna et al. 2014:546:1-20. |
Anderson, Human gene therapy. Science. May 8, 1992;256(5058):808-13. doi: 10.1126/science.1589762. |
Anzalone et al., Reprogramming eukaryotic translation with ligand-responsive synthetic RNA switches. Nat Methods. May 2016;13(5):453-8. doi: 10.1038/nmeth.3807. Epub Mar. 21, 2016. |
Aplan, Causes of oncogenic chromosomal translocation. Trends Genet. Jan. 2006;22(1):46-55. doi: 10.1016/j.tig.2005.10.002. Epub Oct. 28, 2005. |
Arakawa et al., A method to convert mRNA into a gRNA library for CRISPR/Cas9 editing of any organism. Sci Adv. Aug. 24, 2016;2(8):e1600699. doi: 10.1126/sciadv.1600699. |
Araki et al., Comparative analysis of right element mutant lox sites on recombination efficiency in embryonic stem cells. BMC Biotechnol. Mar. 31, 2010;10:29. doi: 10.1186/1472-6750-10-29. |
Araki et al., Site-specific recombinase, R, encoded by yeast plasmid pSR1. J Mol Biol. May 5, 1992;225(1):25-37. doi: 10.1016/0022-2836(92)91023-i. |
Araki et al., Targeted integration of DNA using mutant lox sites in embryonic stem cells. Nucleic Acids Res. Feb. 15, 1997;25(4):868-72. doi: 10.1093/nar/25.4.868. |
Arambula et al., Surface display of a massively variable lipoprotein by a Legionella diversity-generating retroelement. Proc Natl Acad Sci U S A. May 14, 2013;110(20):8212-7. doi: 10.1073/pnas.1301366110. Epub Apr. 30, 2013. |
Arazoe et al., Targeted Nucleotide Editing Technologies for Microbial Metabolic Engineering. Biotechnol J. Sep. 2018;13(9):e1700596. doi: 10.1002/biot.201700596. Epub Jun. 19, 2018. |
Arb Ab et al., Cloning-free CRISPR. Stem Cell Reports. Nov. 10, 2015;5(5):908-917. doi: 10.1016/j.stemcr.2015.09.022. Epub Oct. 29, 2015. |
Arezi et al., Novel mutations in Moloney Murine Leukemia Virus reverse transcriptase increase thermostability through tighter binding to template-primer. Nucleic Acids Res. Feb. 2009;37(2):473-81. doi: 10.1093/nar/gkn952. Epub Dec. 4, 2008. |
Asante et al., A naturally occurring variant of the human prion protein completely prevents prion disease. Nature. Jun. 25, 2015;522(7557):478-81. doi: 10.1038/nature14510. Epub Jun. 10, 2015. |
Auer et al., Highly efficient CRISPR/Cas9-mediated knock-in in zebrafish by homology-independent DNA repair. Genome Res. Jan. 2014;24(1):142-53. doi: 10.1101/gr.161638.113. Epub Oct. 31, 2013. |
Autieri et al., IRT-1, a novel interferon-gamma-responsive transcript encoding a growth-suppressing basic leucine zipper protein. J Biol Chem. Jun. 12, 1998;273(24):14731-7. doi: 10.1074/jbc.273.24.14731. |
Avidan et al., The processivity and fidelity of DNA synthesis exhibited by the reverse transcriptase of bovine leukemia virus. Eur J Biochem. Feb. 2002;269(3):859-67. doi: 10.1046/j.0014-2956.2001.02719.x. |
Babacic et al., CRISPR-cas gene-editing as plausible treatment of neuromuscular and nucleotide-repeat-expansion diseases: A systematic review. PLoS One. Feb. 22, 2019;14(2):e0212198. doi: 10.1371/journal.pone.0212198. |
Bacman et al., Specific elimination of mutant mitochondrial genomes in patient-derived cells by mitoTALENs. Nat Med. Sep. 2013;19(9):1111-3. doi: 10.1038/nm.3261. Epub Aug. 4, 2013. |
Badran et al., Continuous evolution of Bacillus thuringiensis toxins overcomes insect resistance. Nature. May 5, 2016;533(7601):58-63. doi: 10.1038/nature17938. Epub Apr. 27, 2016. |
Badran et al., Development of potent in vivo mutagenesis plasmids with broad mutational spectra. Nat Commun. Oct. 7, 2015;6:8425. doi: 10.1038/ncomms9425. |
Bae et al., Microhomology-based choice of Cas9 nuclease target sites. Nat Methods. Jul. 2014;11(7):705-6. doi: 10.1038/nmeth.3015. |
Bagyinszky et al., Characterization of mutations in PRNP (prion) gene and their possible roles in neurodegenerative diseases. Neuropsychiatr Dis Treat. Aug. 14, 2018;14:2067-2085. doi: 10.2147/NDT.S165445. |
Balakrishnan et al., Flap endonuclease 1. Annu Rev Biochem. 2013;82:119-38. doi: 10.1146/annurev-biochem-072511-122603. Epub Feb. 28, 2013. |
Baldari et al., A novel leader peptide which allows efficient secretion of a fragment of human interleukin 1 beta in Saccharomyces cerevisiae. EMBO J. Jan. 1987;6(1):229-34. |
Banerji et al., A lymphocyte-specific cellular enhancer is located downstream of the joining region in immunoglobulin heavy chain genes. Cell. Jul. 1983;33(3):729-40. doi: 10.1016/0092-8674(83)90015-6. |
Bannert et al., Retroelements and the human genome: new perspectives on an old relation. Proc Natl Acad Sci U S A. Oct. 5, 2004;101 Suppl 2(Suppl 2):14572-9. doi: 10.1073/pnas.0404838101. Epub Aug. 13, 2004. |
Baranauskas et al., Generation and characterization of new highly thermostable and processive M-MuLV reverse transcriptase variants. Protein Eng Des Sei. Oct. 2012;25(10):657-68. doi: 10.1093/protein/gzs034. Epub Jun. 12, 2012. |
Barnes et al., The fidelity of Taq polymerase catalyzing PCR is improved by an N-terminal deletion. Gene. Mar. 1, 1992;112(1):29-35. doi: 10.1016/0378-1119(92)90299-5. |
Bartlett et al., Efficient expression of protein coding genes from the murine U1 small nuclear RNA promoters. Proc Natl Acad Sci U S A. Aug. 20, 1996;93(17):8852-7. doi: 10.1073/pnas.93.17.8852. |
Bartosovic et al., N6-methyladenosine demethylase FTO targets pre-mRNAs and regulates alternative splicing and 3′-end processing. Nucleic Acids Res. Nov. 2, 2017;45(19):11356-11370. doi: 10.1093/nar/gkx778. |
Basturea et al., Substrate specificity and properties of the Escherichia coli 16S rRNA methyltransferase, RsmE. RNA. Nov. 2007;13(11):1969-76. doi: 10.1261/rna.700507. Epub Sep. 13, 2007. |
Bebenek et al., Error-prone polymerization by HIV-1 reverse transcriptase. Contribution of template-primer misalignment, miscoding, and termination probability to mutational hot spots. J Biol Chem. May 15, 1993;268(14):10324-34. |
Behr, Gene transfer with synthetic cationic amphiphiles: prospects for gene therapy. Bioconjug Chem. Sep.-Oct. 1994;5(5):382-9. doi: 10.1021/bc00029a002. |
Belshaw et al., Controlling programmed cell death with a cyclophilin-cyclosporin-based chemical inducer of dimerization. Chem Biol. Sep. 1996;3(9):731-8. doi: 10.1016/s1074-5521(96)90249-5. |
Belshaw et al., Controlling protein association and subcellular localization with a synthetic ligand that induces heterodimerization of proteins. Proc Natl Acad Sci U S A. May 14, 1996;93(10):4604-7. doi: 10.1073/pnas.93.10.4604. |
Bennett et al., Painful and painless channelopathies. Lancet Neurol. Jun. 2014;13(6):587-99. doi: 10.1016/S1474-4422(14)70024-9. Epub May 6, 2014. |
Berger et al., Reverse transcriptase and its associated ribonuclease H: interplay of two enzyme activities controls the yield of single-stranded complementary deoxyribonucleic acid. Biochemistry. May 10, 1983;22(10):2365-72. doi: 10.1021/bi00279a010. |
Berkhout et al., Identification of an active reverse transcriptase enzyme encoded by a human endogenous HERV-K retrovirus. J Virol. Mar. 1999;73(3):2365-75. doi: 10.1128/JVI.73.3.2365-2375.1999. |
Bernhart et al., Local RNA base pairing probabilities in large sequences. Bioinformatics. Mar. 1, 2006;22(5):614-5. doi: 10.1093/bioinformatics/btk014. Epub Dec. 20, 2005. |
Bernstein et al., Role for a bidentate ribonuclease in the initiation step of RNA interference. Nature. Jan. 18, 2001;409(6818):363-6. doi: 10.1038/35053110. |
Bertrand et al., Localization of ASH1 mRNA particles in living yeast. Mol Cell. Oct. 1998;2(4):437-45. doi: 10.1016/sl097-2765(00)80143-4. |
Bessen et al., High-resolution specificity profiling and off-target prediction for site-specific DNA recombinases. Nat Commun. Apr. 26, 2019;10(1):1937. doi: 10.1038/s41467-019-09987-0. |
Bi et al., Pseudo attP sites in favor of transgene integration and expression in cultured porcine cells identified by Streptomyces phage phiC31 integrase. BMC Mol Biol. Sep. 8, 2013;14:20. doi: 10.1186/1471-2199-14-20. |
Bibb et al., Integration and excision by the large serine recombinase phiRv1 integrase. Mol Microbiol. Mar. 2005;55(6):1896-910. doi: 10.1111/j.1365-2958.2005.04517.X. |
Biehs et al., DNA Double-Strand Break Resection Occurs during Non-homologous End Joining in G1 but is Distinct from Resection during Homologous Recombination. Mol Cell. Feb. 16, 2017;65(4):671-684.e5. doi: 10.1016/j.molcel.2016.12.016. Epub Jan. 26, 2017. |
Blaese et al., Vectors in cancer therapy: how will they deliver? Cancer Gene Ther. Dec. 1995;2(4):291-7. |
Blain et al., Nuclease activities of Moloney murine leukemia virus reverse transcriptase. Mutants with altered substrate specificities. J Biol Chem. Nov. 5, 1993;268(31):23585-92. |
Blaisonneau et al., A circular plasmid from the yeast Torulaspora delbrueckii. Plasmid. 1997;38(3):202-9. doi: 10.1006/plas.1997.1315. |
Blau et al., A proliferation switch for genetically?modified?cells. PNAS Apr. 1, 1997 94 (7) 3076-3081; https://doi.org/10.1073/pnas.94.7.3076. |
Bloom et al., Evolving strategies for enzyme engineering. Curr Opin Struct Biol. Aug. 2005;15(4):447-52. |
Bodi et al., Yeast m6A Methylated mRNAs are Enriched on Translating Ribosomes during Meiosis, and under Rapamycin Treatment. PLoS One. Jul. 17, 2015;10(7):e0132090. doi: 10.1371/journal.pone.0132090. |
Boersma et al., Selection strategies for improved biocatalysts. FEBS J. May 2007;274(9):2181-95. |
Bogdanove et al., Engineering altered protein-DNA recognition specificity. Nucleic Acids Res. Jun. 1, 2018;46(10):4845-4871. doi: 10.1093/nar/gky289. |
Bolusani et al., Evolution of variants of yeast site-specific recombinase Flp that utilize native genomic sequences as recombination target sites. Nucleic Acids Res. 2006;34(18):5259-69. Epub Sep. 26, 2006. |
Bondeson et al., Inversion of the IDS gene resulting from recombination with IDS-related sequences is a common cause of the Hunter syndrome. Hum Mol Genet. Apr. 1995;4(4):615-21. doi: 10.1093/hmg/4.4.615. |
Borchardt et al., Controlling mRNA stability and translation with the CRISPR endoribonuclease Csy4. RNA. Nov. 2015;21(11):1921-30. doi: 10.1261/rna.051227.115. Epub Sep. 9, 2015. |
Boutabout et al., DNA synthesis fidelity by the reverse transcriptase of the yeast retrotransposon Ty1. Nucleic Acids Res. Jun. 1, 2001;29(11):2217-22. doi: 10.1093/nar/29.11.2217. |
Box et al., A multi-domain protein system based on the HC fragment of tetanus toxin for targeting DNA to neuronal cells. J Drug Target. Jul. 2003;11(6):333-43. doi: 10.1080/1061186310001634667. |
Braun et al., Immunogenic duplex nucleic acids are nuclease resistant. J Immunol. Sep. 15, 1988;141(6):2084-9. |
Brown et al., A mammalian protein targeted by G1-arresting rapamycin-receptor complex. Nature. Jun. 30, 1994;369(6483):756-8. doi: 10.1038/369756a0. |
Brown et al., Characterization of the genetic elements required for site-specific integration of plasmid pSE211 in Saccharopolyspora erythraea. J Bacteriol. Apr. 1990;172(4):1877-88. doi: 10.1128/jb.172.4.1877-1888.1990. |
Brown et al., Structural insights into the stabilization of MALAT1 noncoding RNA by a bipartite triple helix. Nat Struct Mol Biol. Jul. 2014;21(7):633-40. doi: 10.1038/nsmb.2844. Epub Jun. 22, 2014. |
Brzezicha et al., Identification of human tRNA:m5C methyltransferase catalysing intron-dependent m5C formation in the first position of the anticodon of the pre-tRNA Leu (CAA). Nucleic Acids Res. 2006;34(20):6034-43. doi: 10.1093/nar/gk1765. Epub Oct. 27, 2006. |
Buchschacher et al., Human immunodeficiency virus vectors for inducible expression of foreign genes. J Virol. May 1992;66(5):2731-9. doi: 10.1128/JVI.66.5.2731-2739.1992. |
Buckley et al., Targeting the von Hippel-Lindau E3 ubiquitin ligase using small molecules to disrupt the VHL/HIF-1? interaction. J Am Chem Soc. Mar. 14, 2012;134(10):4465-8. doi: 10.1021/ja209924v. Epub Feb. 27, 2012. |
Budworth et al., A brief history of triplet repeat diseases. Methods Mol Biol. 2013; 1010:3-17. doi: 10.1007/978-1-62703-411-1_1. |
Buskirk et al., In vivo evolution of an RNA-based transcriptional activator. Chem Biol. Jun. 2003;10(6):533-40. doi: 10.1016/s1074-5521(03)00109-1. |
Byrne et al., Multiplex gene regulation: a two-tiered approach to transgene regulation in transgenic mice. Proc Natl Acad Sci U S A. Jul. 1989;86(14):5473-7. doi: 10.1073/pnas.86.14.5473. |
Cadwell et al., Randomization of genes by PCR mutagenesis. PCR Methods Appl. Aug. 1992;2(1):28-33. doi: 10.1101/gr.2.1.28. |
Calame et al., Transcriptional controlling elements in the immunoglobulin and T cell receptor loci. Adv Immunol. 1988;43:235-75. doi: 10.1016/s0065-2776(08)60367-3. |
Camarero et al., Biosynthesis of a Head-to-Tail Cyclized Protein with Improved Biological Activity. J. Am. Chem. Soc. May 29, 1999; 121(23):5597-5598. https://doi.org/10.1021/ja990929n. |
Camper et al., Postnatal repression of the alpha-fetoprotein gene is enhancer independent. Genes Dev. Apr. 1989;3(4):537-46. doi: 10.1101/gad.3.4.537. |
Camps et al., Targeted gene evolution in Escherichia coli using a highly error-prone DNA polymerase I. Proc Natl Acad Sci U S A. Aug. 19, 2003;100(17):9727-32. Epub Aug. 8, 2003. |
Canchaya et al., Genome analysis of an inducible prophage and prophage remnants integrated in the Streptococcus pyogenes strain SF370. Virology. Oct. 25, 2002;302(2):245-58. doi: 10.1006/viro.2002.1570. |
Carlier et al., Burkholderia cenocepacia H111 Rhy-family protein. Apr. 16, 2015. Retrieved from the Internet via https://www.ebi.ac.uk/ena/browser/api/embl/CDN65395.1?lineLimit=1000. Last retrieved Apr. 26, 2021. |
Carlson et al., Negative selection and stringency modulation in phage-assisted continuous evolution. Nat Chem Biol. Mar. 2014;10(3):216-22. doi: 10.1038/nchembio.l453. Epub Feb. 2, 2014. With Supplementary Results. |
Carr et al., Genome engineering. Nat Biotechnol. Dec. 2009;27(12):1151-62. doi: 10.1038/nbt.1590. |
Carvalho et al., Evolution in health and medicine Sackler colloquium: Genomic disorders: a window into human gene and genome evolution. Proc Natl Acad Sci USA. Jan. 2, 20106;107 Suppl 1(Suppl 1):1765-71. doi: 10.1073/pnas.0906222107. Epub Jan. 13, 2010. |
Cattaneo et al., SEL1L affects human pancreatic cancer cell cycle and invasiveness through modulation of PTEN and genes related to cell-matrix interactions. Neoplasia. 2005;7(11):1030-1038. |
Ceccaldi et al., Repair Pathway Choices and Consequences at the Double-Strand Break. Trends Cell Biol. Jan. 2016;26(1):52-64. doi: 10.1016/j.tcb.2015.07.009. Epub Oct. 1, 2015. |
Chadalavada et al., Wild-type is the optimal sequence of the HDV ribozyme under cotranscriptional conditions. RNA. Dec. 2007;13(12):2189-201. doi: 10.1261/rna.778107. Epub Oct. 23, 2007. |
Chalberg et al., Integration specificity of phage phiC31 integrase in the human genome. J Mol Biol. Mar. 17, 2006;357(1):28-48. doi: 10.1016/j.jmb.2005.11.098. Epub Dec. 22, 2005. |
Chalberg et al., phiC31 integrase confers genomic integration and long-term transgene expression in rat retina. Invest Ophthalmol Vis Sci. Jun. 2005;46(6):2140-6. doi: 10.1167/iovs.04-1252. |
Chan et al., Novel selection methods for DNA-encoded chemical libraries. Curr Opin Chem Biol. 2015;26:55-61. doi:10.1016/j.cbpa.2015.02.010. |
Chan et al., The choice of nucleotide inserted opposite abasic sites formed within chromosomal DNA reveals the polymerase activities participating in translesion DNA synthesis. DNA Repair (Amst). Nov. 2013;12(11):878-89. doi: 10.1016/j.dnarep.2013.07.008. Epub Aug. 26, 2013. |
Chapman et al., Playing the end game: DNA double-strand break repair pathway choice. Mol Cell. Aug. 24, 2012;47(4):497-510. doi: 10.1016/j.molcel.2012.07.029. |
Chaturvedi et al., Stabilization of triple-stranded oligonucleotide complexes: use of probes containing alternating phosphodiester and stereo-uniform cationic phosphoramidate linkages. Nucleic Acids Res. Jun. 15, 1996;24(12):2318-23. |
Chen et al., Enhanced proofreading governs CRISPR-Cas9 targeting accuracy. Nature. Oct. 19, 2017;550(7676):407-410. doi: 10.1038/nature24268. Epub Sep. 20, 2017. |
Chen et al., A general strategy for the evolution of bond-forming enzymes using yeast display. Proc Natl Acad Sci U S A. Jul. 12, 2011;108(28):11399-404. doi: 10.1073/pnas. 1101046108. Epub Jun. 22, 2011. |
Chen et al., Highly Efficient Mouse Genome Editing by CRISPR Ribonucleoprotein Electroporation of Zygotes. J Biol Chem. Jul. 8, 2016;291(28):14457-67. doi: 10.1074/jbc.M116.733154. Epub May 5, 2016. |
Chen et al., m(6)A RNA methylation is regulated by microRNAs and promotes reprogramming to pluripotency. Cell Stem Cell. Mar. 5, 2015;16(3):289-301. doi: 10.1016/j.stem.2015.01.016. Epub Feb. 12, 2015. |
Chew et al., A multifunctional AAV-CRISPR-Cas9 and its host response. Nat Methods. Oct. 2016;13(10):868-74. doi: 10.1038/nmeth.3993. Epub Sep. 5, 2016. Supplementary Information. |
Chin, Expanding and reprogramming the genetic code of cells and animals. Annu Rev Biochem. 2014;83:379-408. doi: 10.1146/annurev-biochem-060713-035737. Epub Feb. 10, 2014. |
Cho et al., Site-specific recombination of bacteriophage P22 does not require integration host factor. J Bacteriol. Jul. 1999;181(14):4245-9. doi: 10.1128/JB.181.14.4245-4249.1999. |
Choe et al., Forging Ahead through Darkness: PCNA, Still the Principal Conductor at the Replication Fork. Mol Cell. Feb. 2, 2017;65(3):380-392. doi: 10.1016/j.molcel.2016.12.020. |
Choi et al., N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics. Nat Struct Mol Biol. Feb. 2016;23(2): 110-5. doi: 10.1038/nsmb.3148. Epub Jan. 11, 2016. |
Choi et al., Protein trans-splicing and characterization of a split family B-type DNA polymerase from the hyperthermophilic archaeal parasite Nanoarchaeum equitans. J Mol Biol. Mar. 1, 2006;356(5):1093-106. doi: 10.1016/j.jmb.2005.12.036. Epub Dec. 27, 2005. |
Choi et at al., Translesion synthesis across abasic lesions by human B-family and Y-family DNA polymerases ?, ?, ?, ?, ?, and Revl J Mol Biol. Nov. 19, 2010;404(1):34-44. doi: 10.1016/j.jmb.2010.09.015. Epub Oct. 1, 2010. |
Chong et al., Modulation of protein splicing of the Saccharomyces cerevisiae vacuolar membrane ATPase intein. J Biol Chem. Apr. 24, 1998;273(17): 10567-77. doi: 10.1074/jbc.273.17.10567. |
Chong et al., Utilizing the C-terminal cleavage activity of a protein splicing element to purify recombinant proteins in a single chromatographic step. Nucleic Acids Res. Nov. 15, 1998;26(22):5109-15. doi: 10.1093/nar/26.22.5109. |
Chong et al., Protein splicing involving the Saccharomyces cerevisiae VMA intein. The steps in the splicing pathway, side reactions leading to protein cleavage, and establishment of an in vitro splicing system. J Biol Chem. Sep. 6, 1996;271(36):22159-68. doi: 10.1074/jbc.271.36.22159. |
Chong et al., Single-column purification of free recombinant proteins using a self-cleavable affinity tag derived from a protein splicing element. Gene. Jun. 19, 1997;192(2):271-81. doi: 10.1016/s0378 -1119(97)00105-4. |
Choudhury et al., Engineering RNA endonucleases with customized sequence specificities. Nat Commun. 2012;3:1147. doi: 10.1038/ncomms2154. |
Choulika et al., Induction of homologous recombination in mammalian chromosomes by using the I-SceI system of Saccharomyces cerevisiae. Mol Cell Biol. Apr. 1995;15(4):1968-73. doi: 10.1128/MCB.15.4.1968. |
Christiansen et al., Characterization of the lactococcal temperate phage TP901-1 and its site-specific integration. J Bacteriol. Feb. 1994;176(4):1069-76. doi: 10.1128/jb.176.4.1069-1076.1994. |
Chu et al., Increasing the efficiency of homology-directed repair for CRISPR-Cas9-induced precise gene editing in mammalian cells. Nat Biotech. Feb. 13, 2015;33:543-8. doi: 10.1038/nbt.3198. Epub Mar. 24, 2015. |
Chuai et al., DeepCRISPR: optimized CRISPR guide RNA design by deep learning. Genome Biol. Jun. 26, 2018;19(1):80. doi: 10.1186/s13059-018-1459-4. |
Chuai et al., In Silico Meets In Vivo: Towards Computational CRISPR-Based sgRNA Design. Trends Biotechnol. Jan. 2017;35(1):12-21. doi: 10.1016/j.tibtech.2016.06.008. Epub Jul. 11, 2016. |
Chuang et al., Novel Heterotypic Rox Sites for Combinatorial Dre Recombination Strategies. G3 (Bethesda). Dec. 29, 2015;6(3):559-71. doi: 10.1534/g3.115.025841. |
Chujo et al, Trmt61B is a methyltransferase responsible for 1-methyladenosine at position 58 of human mitochondrial tRNAs. RNA. Dec. 2012;18(12):2269-76. doi: 10.1261/rna.035600.112. Epub Oct. 24, 2012. |
Clackson et al., Redesigning an FKBP-ligand interface to generate chemical dimerizers with novel specificity. Proc Natl Acad Sci U S A. Sep. 1, 1998;95(18):10437-42. doi: 10.1073/pnas.95.18.10437. |
Clement et al., CRISPResso2 provides accurate and rapid genome editing sequence analysis. Nat Biotechnol. Mar. 2019;37(3):224-226. doi: 10.1038/s41587-019-0032-3. |
Cokol et al., Finding nuclear localization signals. EMBO Rep. Nov. 2000;1(5):411-5. doi: 10.1093/embo-reports/kvd092. |
Cole et al., Reconstructing evolutionary adaptive paths for protein engineering. Methods Mol Biol. 2013;978:115-25. doi: 10.1007/978-l-62703-293-3_8. |
Collinge, Prion diseases of humans and animals: their causes and molecular basis. Annu Rev Neurosci. 2001;24:519-50. doi: 10.1146/annurev.neuro.24.1.519. |
Conrad et al., A Kaposi's sarcoma virus RNA element that increases the nuclear abundance of intronless transcripts. EMBO J. May 18, 2005;24(10):1831-41. doi: 10.1038/sj.emboj.7600662. Epub Apr. 28, 2005. |
Cornu et al., Refining strategies to translate genome editing to the clinic. Nat Med. Apr. 3, 2017;23(4):415-423. doi: 10.1038/nm.4313. |
Cotton et al., Insertion of a Synthetic Peptide into a Recombinant Protein Framework:? A Protein Biosensor. J. Am. Chem. Soc. Jan. 22, 1999; 121(5):1100-1. https://doi.org/10.1021/ja983804b. |
Cox et al., RNA editing with CRISPR-Cas13. Science. Nov. 24, 2017;358(6366):1019-1027. doi: 10.1126/science.aaq0180. Epub Oct. 25, 2017. |
Cox, Proteins pinpoint double strand breaks. Elife. Oct. 29, 2013;2:e01561. doi: 10.7554/eLife.01561. |
Crabtree et al., Three-part inventions: intracellular signaling and induced proximity. Trends Biochem Sci. Nov. 1996;21(11):418-22. doi: 10.1016/s0968-0004(96)20027-1. |
Crick, On protein synthesis. Symp Soc Exp Biol. 1958;12:138-63. |
Crystal, Transfer of genes to humans: early lessons and obstacles to success. Science. Oct. 20, 1995;270(5235):404-10. doi: 10.1126/science.270.5235.404. |
Cui et al., Consequences of Cas9 cleavage in the chromosome of Escherichia coli. Nucleic Acids Res. May 19, 2016;44(9):4243-51. doi: 10.1093/nar/gkw223. Epub Apr. 8, 2016. |
Cui et al., m6A RNA Methylation Regulates the Self-Renewal and Tumorigenesis of Glioblastoma Stem Cells. Cell Rep. Mar. 14, 2017; 18(11):2622-2634. doi: 10.1016/j.cehep.2017.02.059. |
Cui et al., Review of CRISPR/Cas9 sgRNA Design Tools. Interdiscip Sci. Jun. 2018;10(2):455-465. doi: 10.1007/s12539-018-0298-z. Epub Apr. 11, 2018. |
Cupples et al., A set of lacZ mutations in Escherichia coli that allow rapid detection of each of the six base substitutions. Proc Natl Acad Sci U S A. Jul. 1989;86(14):5345-9. |
Dahlgren et al., A novel mutation in ribosomal protein S4 that affects the function of a mutated RF1. Biochimie. Aug. 2000;82(8):683-91. |
Dahlman et al., Orthogonal gene knockout and activation with a catalytically active Cas9 nuclease. Nat Biotechnol. Nov. 2015;33(11):1159-61. doi: 10.1038/nbt.3390. |
Dandage et al., beditor: A Computational Workflow for Designing Libraries of Guide RNAs for CRISPR-Mediated Base Editing. Genetics. Jun. 2019;212(2):377-385. doi: 10.1534/genetics. 119.302089. Epub Apr. 1, 2019. |
Dang et al., Optimizing sgRNA structure to improve CRISPR-Cas9 knockout efficiency. Genome Biol. Dec. 15, 2015;16:280. doi: 10.1186/s13059-015-0846-3. |
Das et al.,The crystal structure of the monomeric reverse transcriptase from Moloney murine leukemia virus. Structure. May 2004;12(5):819-29. doi: 10.1016/j.str.2004.02.032. |
Dassa et al., Fractured genes: a novel genomic arrangement involving new split inteins and a new homing endonuclease family. Nucleic Acids Res. May 2009;37(8):2560-73. doi: 10.1093/nar/gkp095. Epub Mar. 5, 2009. |
Dassa et al., Trans protein splicing of cyanobacterial split inteins in endogenous and exogenous combinations. Biochemistry. Jan. 9, 2007;46(1):322-30. doi: 10.1021/bi0611762. |
Datsenko et al., One-step inactivation of chromosomal genes in Escherichia coli K-12 using PCR products. Proc Natl Acad Sci U S A. Jun. 6, 2000;97(12):6640-5. |
De Felipe et al., Co-translational, intraribosomal cleavage of polypeptides by the foot-and-mouth disease virus 2A peptide. J Biol Chem. Mar. 28, 2003;278(13): 11441-8. doi: 10.1074/jbc.M211644200. Epub Jan. 8, 2003. |
De Wit et al., The Human CD4+ T Cell Response against Mumps Virus Targets a Broadly Recognized Nucleoprotein Epitope. J Virol. Mar. 5, 2019;93(6):e01883-18. doi: 10.1128/JVI.01883-18. |
Dean et al., Genetic restriction of HIV-1 infection and progression to AIDS by a deletion allele of the CKR5 structural gene. Hemophilia Growth and Development Study, Multicenter AIDS Cohort Study, Multicenter Hemophilia Cohort Study, San Francisco City Cohort, ALIVE Study. Science. Sep. 27, 1996;273(5283): 1856-62. doi: 10.1126/science.273.5283.1856. |
Dekosky et al., Large-scale sequence and structural comparisons of human naive and antigen-experienced antibody repertoires. Proc Natl Acad Sci U S A. May 10, 2016;113(19):E2636-45. doi: 10.1073/pnas.1525510113. Epub Apr. 25, 2016. |
Delebecque et al., Organization of intracellular reactions with rationally designed RNA assemblies. Science. Jul. 22, 2011;333(6041):470-4. doi: 10.1126/science. 1206938. Epub Jun. 23, 2011. |
Deng et al., Widespread occurrence of N6-methyladenosine in bacterial mRNA. Nucleic Acids Res. Jul. 27, 2015;43(13):6557-67. doi: 10.1093/nar/gkv596. Epub Jun. 11, 2015. |
Deriano et al., Modernizing the nonhomologous end-joining repertoire: alternative and classical NHEJ share the stage. Annu Rev Genet. 2013;47:433-55. doi: 10.1146/annurev-genet-110711-155540. Epub Sep. 11, 2013. |
Deussing, Targeted mutagenesis tools for modelling psychiatric disorders. Cell Tissue Res. Oct. 2013;354(1):9-25. doi: 10.1007/s00441-013-1708-5. Epub Sep. 10, 2013. |
Dever et al., CRISPR/Cas9 ?-globin gene targeting in human haematopoietic stem cells. Nature. Nov. 17, 2016;539(7629):384-389. doi: 10.1038/nature20134. Epub Nov. 7, 2016. |
Dianov et al., Mammalian base excision repair: the forgotten archangel. Nucleic Acids Res. Apr. 1, 2013;41(6):3483-90. doi: 10.1093/nar/gkt076. Epub Feb. 13, 2013. |
Dicarlo et al., Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic Acids Res. Apr. 2013;41(7):4336-43. doi: 10.1093/nar/gkt135. Epub Mar. 4, 2013. |
Dicarlo et al., Safeguarding CRISPR-Cas9 gene drives in yeast. Nat Biotechnol. Dec. 2015;33(12):1250-1255. doi: 10.1038/nbt.3412. Epub Nov. 16, 2015. |
Dickey et al., Single-stranded DNA-binding proteins: multiple domains for multiple functions. Structure. Jul. 2, 2013;21(7):1074-84. doi: 10.1016/j.str.2013.05.013. |
Dickinson et al., Experimental interrogation of the path dependence and stochasticity of protein evolution using phage-assisted continuous evolution. Proc Natl Acad Sci U S A. May 2013;110(22):9007-12. |
Dillon, Regulating gene expression in gene therapy. Trends Biotechnol. May 1993;11(5):167-73. doi: 10.1016/0167-7799(93)90109-M. |
Dingwall et al., Nuclear targeting sequences—a consensus? Trends Biochem Sci. Dec. 1991;16(12):478-81. doi: 10.1016/0968-0004(91)90184-w. |
Diver et al., Single-Step Synthesis of Cell-Permeable Protein Dimerizers That Activate Signal Transduction and Gene Expression. J. Am. Chem. Soc. Jun. 4, 1997;119(22):5106-5109. https://doi.org/10.1021/ja963891c. |
Dominissini et al., Topology of the human and mouse m6A RNA methylomes revealed by m6A-seq. Nature. Apr. 29, 2012;485(7397):201-6. doi: 10.1038/nature11112. |
Dorgan et al., An enzyme-coupled continuous spectrophotometric assay for S-adenosylmethionine-dependent methyltransferases. Anal Biochem. Mar. 15, 2006;350(2):249-55. doi: 10.1016/j.ab.2006.01.004. Epub Feb. 7, 2006. |
Dorr et al., Reprogramming the specificity of sortase enzymes. Proc Natl Acad Sci U S A. Sep. 16, 2014;111(37):13343-8. doi: 10.1073/pnas.1411179111. Epub Sep. 3, 2014. |
Dove et al., Conversion of the omega subunit of Escherichia coli RNA polymerase into a transcriptional activator or an activation target. Genes Dev. Mar. 1, 1998;12(5):745-54. |
Doyon et al., Directed evolution and substrate specificity profile of homing endonuclease I-Scel. J Am Chem Soc. Feb. 22, 2006;128(7):2477-84. |
Drake, A constant rate of spontaneous mutation in DNA-based microbes. Proc Natl Acad Sci U S A. Aug. 15, 1991;88(16):7160-4. |
Dubois et al., Retroviral RNA Dimerization: From Structure to Functions. Front Microbiol. Mar. 22, 2018;9:527. doi: 10.3389/fmicb.2018.00527. |
Dunbar et al., Gene therapy comes of age. Science. Jan. 12, 2018;359(6372):eaan4672. doi: 10.1126/science.aan4672. |
Dupuy et al., Le syndrome de De La Chapelle [De La Chapelle syndrome]. Presse Med. Mar. 3, 2001;30(8):369-72. French. |
Durai et al., A bacterial one-hybrid selection system for interrogating zinc finger-DNA interactions. Comb Chem High Throughput Screen. May 2006;9(4):301-11. |
Durai et al., Zinc finger nucleases: custom-designed molecular scissors for genome engineering of plant and mammalian cells. Nucleic Acids Res. Oct. 26, 2005;33(18):5978-90. doi: 10.1093/nar/gki912. |
Edlund et al., Cell-specific expression of the rat insulin gene: evidence for role of two distinct 5′ flanking elements. Science. Nov. 22, 1985;230(4728):912-6. doi: 10.1126/science.3904002. |
Eick et al., Robustness of Reconstructed Ancestral Protein Functions to Statistical Uncertainty. Mol Biol Evol. Feb. 1, 2017;34(2):247-261. doi: 10.1093/molbev/msw223. |
Engel et al., The emerging role of mRNA methylation in normal and pathological behavior. Genes Brain Behav. Mar. 2018;17(3):e12428. doi: 10.1111/gbb.12428. Epub Nov. 17, 2017. |
Engelward et al., Base excision repair deficient mice lacking the Aag alkyladenine DNA glycosylase. Proc Natl Acad Sci U S A. Nov. 25, 1997;94(24):13087-92. |
England, Unnatural amino acid mutagenesis: a precise tool for probing protein structure and function. Biochemistry. Sep. 21, 2004;43(37):11623-9. |
Enyeart et al., Biotechnological applications of mobile group II introns and their reverse transcriptases: gene targeting, RNA-seq, and non-coding RNA analysis. Mobile DNA 5, 2 (2014). https://doi.org/10.1186/1759-8753-5-2. https://doi.org/10.1186/1759-8753-5-2. |
Eriksson et al., Recurrent de novo point mutations in lamin A cause Hutchinson-Gilford progeria syndrome. Nature. May 15, 2003;423(6937):293-8. doi: 10.1038/nature01629. Epub Apr. 25, 2003. PMID: 12714972. |
Evans et al., Semisynthesis of cytotoxic proteins using a modified protein splicing element. Protein Sci. Nov. 1998;7(11):2256-64. doi: 10.1002/pro.5560071103. |
Evans et al., The cyclization and polymerization of bacterially expressed proteins using modified self-splicing inteins. J Biol Chem. Jun. 25, 1999;274(26):18359-63. doi: 10.1074/jbc.274.26.18359. |
Evans et al., The in vitro ligation of bacterially expressed proteins using an intein from Methanobacterium thermoautotrophicum. J Biol Chem. Feb. 12, 1999;274(7):3923-6. doi: 10.1074/jbc.274.7.3923. |
Evers et al., CRISPR knockout screening outperforms shRNA and CRISPRi in identifying essential genes. Nat Biotechnol. Jun. 2016;34(6):631-3. doi: 10.1038/nbt.3536. Epub Apr. 25, 2016. |
Falnes et al., DNA repair by bacterial AlkB proteins. Res Microbiol. Oct. 2003;154(8):531-8. doi: 10.1016/S0923-2508(03)00150-5. |
Falnes et al., Repair of methyl lesions in DNA and RNA by oxidative demethylation. Neuroscience. Apr. 14, 2007;145(4):1222-32. doi: 10.1016/j.neuroscience.2006.11.018. Epub Dec. 18, 2006. |
Feldstein et al., Two sequences participating in the autolytic processing of satellite tobacco ringspot virus complementary RNA. Gene. Oct. 15, 1989;82(1):53-61. doi: 10.1016/0378-1119(89)90029-2. |
Feng et al., Crystal structures of the human RNA demethylase Alkbh5 reveal basis for substrate recognition. J Biol Chem. Apr. 25, 2014;289(17):11571-11583. doi: 10.1074/jbc.M113.546168. Epub Mar. 10, 2014. |
Feng et al., Human L1 retrotransposon encodes a conserved endonuclease required for retrotransposition. Cell. Nov. 29, 1996;87(5):905-16. doi: 10.1016/s0092-8674(00)81997-2. |
Feuk, Inversion variants in the human genome: role in disease and genome architecture. Genome Med. Feb. 12, 2010;2(2):11. doi: 10.1186/gm132. |
Filippov et al., A novel type of RNase III family proteins in eukaryotes. Gene. Mar. 7, 2000;245(1):213-21. doi: 10.1016/s0378-1119(99)00571-5. |
Fischbach et al., Directed evolution can rapidly improve the activity of chimeric assembly-line enzymes. Proc Natl Acad Sci U S A. Jul. 17, 2007;104(29):11951-6. doi: 10.1073/pnas.0705348104. Epub Jul. 9, 2007. |
Fitzjohn, Diversitree: comparative phylogenetic analyses of diversification in R. Methods in Evology and Evolution. Dec. 2012;3(6):1084-92 .doi: 10.1111/j.2041-210X.2012.00234.x. |
Flajolet et al., Woodchuck hepatitis virus enhancer I and enhancer II are both involved in N-myc2 activation in woodchuck liver tumors. J Virol. Jul. 1998;72(7):6175-80. doi: 10.1128/JVI.72.7.6175-6180.1998. |
Flynn et al., CRISPR-mediated genotypic and phenotypic correction of a chronic granulomatous disease mutation in human iPS cells. Exp Hematol. Oct. 2015;43(10):838-848.e3. doi: 10.1016/j.exphem.2015.06.002. Epub Jun. 19, 2015. Including supplementary figures and data. |
Fogg et al., Genome Integration and Excision by a New Streptomyces Bacteriophage, ?Joe. Appl Environ Microbiol. Feb. 15, 2017;83(5):e02767-16. doi: 10.1128/AEM.02767-16. |
Forster et al., Self-cleavage of virusoid RNA is performed by the proposed 55-nucleotide active site. Cell. Jul. 3, 1987;50(1):9-16. doi: 10.1016/0092-8674(87)90657-x. |
Foruni et al., Different DNA polymerases are involved in the short- and long-patch base excision repair in mammalian cells. Biochemistry. Mar. 17, 1998;37(11):3575-80. doi: 10.1021/bi972999h. |
Fouts et al., Sequencing Bacillus anthracis typing phages gamma and cherry reveals a common ancestry. J Bacteriol. May 2006;188(9):3402-8. doi: 10.1128/JB.188.9.3402-3408.2006. |
Freitas et al., Mechanisms and signals for the nuclear import of proteins. Curr Genomics. Dec. 2009;10(8):550-7. doi: 10.2174/138920209789503941. |
Fu et al., Promises and Pitfalls of Intracellular Delivery of Proteins. Bioconjugate Chemistry. Aug. 2014;25:1602-8. |
Furukawa et al., In vitro selection of allosteric ribozymes that sense the bacterial second messenger c-di-GMP. Methods Mol Biol. 2014;1111:209-20. doi: 10.1007/978-1-62703-755-6_15. |
Gaj et al., 3rd. Genome engineering with custom recombinases. Methods Enzymol. 2014;546:79-91. doi: 10.1016/B978-0-12-801185-0.00004-0. |
Gajula, Designing an Elusive CoG?GoC CRISPR Base Editor. Trends Biochem Sci. Feb. 2019;44(2):91-94. doi: 10.1016/j.tibs.2018.10.004. Epub Nov. 13, 2018. |
Gao et al., Cationic liposome-mediated gene transfer. Gene Ther. Dec. 1995;2(10):710-22. |
Gao et al., Treatment of autosomal dominant hearing loss by in vivo delivery of genome editing agents. Nature. Jan. 11, 2018;553(7687):217-221. doi: 10.1038/nature25164. Epub Dec. 20, 2017. |
Gapinske et al., CRISPR-SKIP: programmable gene splicing with single base editors. Genome Biol. Aug. 15, 2018;19(1):107. doi: 10.1186/s13059-018-1482-5. |
Garibyan et al., Use of the rpoB gene to determine the specificity of base substitution mutations on the Escherichia coli chromosome. DNA Repair (Amst). May 13, 2003;2(5):593-608. |
Gaudelli et al., Programmable base editing of AoT to GoC in genomic DNA without DNA cleavage. Nature. Nov. 23, 2017;551(7681):464-471. doi: 10.1038/nature24644. Epub Oct. 25, 2017. Erratum in: Nature. May 2, 2018. |
Geary, Addgene blog. CRISPR 101: Cas9 nickase design and homology directed repair. 2018. pp. 1-12. https://blog.addgene.org/crispr-101-cas9-nickase-design-and-homlogy-directed-repair. Last retrieved online Jun. 25, 2021. |
Gehrke et al., An APOBEC3A-Cas9 base editor with minimized bystander and off-target activities. Nat Biotechnol. Nov. 2018;36(10):977-982. doi: 10.1038/nbt.4199. Epub Jul. 30, 2018. |
GenBank Accession No. J01600.1. Brooks et al., E.coli dam gene coding for DNA adenine methylase. Apr. 26, 1993. |
GenBank Accession No. U07651.1. Lu, Escherichia coli K12 negative regulator of replication initiation (seqA) gene, complete cds. Jul. 19, 1994. |
GENBANK Submission; NIH/NCBI, Accession No. AAA66622.1. Martinelli et al., May 18, 1995. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. AGT42196. Farzadfar et al., Nov. 2, 2013. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. APG80656.1. Burstein et al., Dec. 10, 2016. 1 pages. |
GENBANK Submission; NIH/NCBI, Accession No. AYD60528.1. Ram et al., Oct. 2, 2018. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NP 955579.1. Chen et al., Aug. 13, 2018. 5 pages. |
GENBANK Submission; NIH/NCBI, Accession No. RFF81513.1. Zhou et al., Aug. 21, 2018. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. SNX31424.1. Weckx, S., Feb. 16, 2018. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. TGH57013. Xu et al., Apr. 9, 2019. 2 pages. |
George et al., Adenosine deaminases acting on RNA, RNA editing, and interferon action. J Interferon Cytokine Res. Jan. 2011;31(1):99-117. doi: 10.1089/jir.2010.0097. Epub Dec. 23, 2010. PMID: 21182352; PMCID: PMC3034097. |
Gerard et al., Influence on stability in Escherichia coli of the carboxy-terminal structure of cloned Moloney murine leukemia virus reverse transcriptase. DNA. Aug. 1986;5(4):271-9. doi: 10.1089/dna.l986.5.271. |
Gerard et al., Purification and characterization of the DNA polymerase and RNase H activities in Moloney murine sarcoma-leukemia virus. J Virol. Apr. 1975;15(4):785-97. doi: 10.1128/JVI.15.4.785-797.1975. |
Gerard et al., The role of template-primer in protection of reverse transcriptase from thermal inactivation. Nucleic Acids Res. Jul. 15, 2002;30(14):3118-29. doi: 10.1093/nar/gkf417. |
Gerber et al., An adenosine deaminase that generates inosine at the wobble position of tRNAs. Science. Nov. 5, 1999;286(5442):1146-9. doi: 10.1126/science.286.5442.1146. |
Ghahfarokhi et al., Blastocyst Formation Rate and Transgene Expression are Associated with Gene Insertion into Safe and Non-Safe Harbors in the Cattle Genome. Sci Rep. Nov. 13, 2017;7(1):15432. doi: 10.1038/s41598-017-15648-3. |
Gil, Position-dependent sequence elements downstream of AAUAAA are required for efficient rabbit beta-globin mRNA 3′ end formation. Cell. May 8, 1987;49(3):399-406. doi: 10.1016/0092-8674(87)90292-3. |
Glasgow et al.,DNA-binding properties of the Hin recombinase. J Biol Chem. Jun. 15, 1989;264(17):10072-82. |
Glassner et al., Generation of a strong mutator phenotype in yeast by imbalanced base excision repair. Proc Natl Acad Sci U S A. Aug. 15, 1998;95(17):9997-10002. |
Goldberg et al., Epigenetics: a landscape takes shape. Cell. Feb. 23, 2007;128(4):635-8. doi: 10.1016/j.cell.2007.02.006. |
Gong et al., Active DNA demethylation by oxidation and repair. Cell Res. Dec. 2011;21(12):1649-51. doi: 10.1038/cr.2011.140. Epub Aug. 23, 2011. |
Goodnough et al., Development of a delivery vehicle for intracellular transport of botulinum neurotoxin antagonists. FEBS Lett. Feb. 27, 2002;513(2-3):163-8. |
Gou et al., Designing single guide RNA for CIRSPR-Cas9 base editor by deep learning. Peer reviewed Thesis/Dissertation. UCLA Electronic Theses and Dissertations. Jan. 1, 2019. Retrieved from the Internet via https://escholarship.org/uc/item/7vf9z54t. Last accessed on Apr. 29, 2021. |
Gregory et al., Integration site for Streptomyces phage phiBT1 and development of site-specific integrating vectors. J Bacteriol. Sep. 2003;185(17):5320-3. doi: 10.1128/jb. 185.17.5320-5323.2003. |
Griffiths, Endogenous retroviruses in the human genome sequence. Genome Biol. 2001 ;2(6):Reviews 1017. doi: 10.1186/GB-2001-2-6-reviews1017. Epub Jun. 5, 2001. |
Grishok et al., Genes and Mechanisms Related to RNA Interference Regulate Expression of the Small Temporal RNAs that Control C. elegans Developmental Timing. Jul. 13, 2001:106(1):P23-4. |
Groher et al., Synthetic riboswitches—A tool comes of age. Biochim Biophys Acta. Oct. 2014;1839(10):964-973. doi: 10.1016/j.bbagrm.2014.05.005. Epub May 17, 2014. |
Groth et al., Construction of transgenic Drosophila by using the site-specific integrase from phage phiC31. Genetics. Apr. 2004; 166(4):1775-82. doi: 10.1534/genetics. 166.4.1775. |
Gruber et al., Strategies for measuring evolutionary conservation of RNA secondary structures. BMC Bioinformatics. Feb. 26, 2008;9:122. doi: 10.1186/1471-2105-9-122. |
Grunebaum et al., Recent advances in understanding and managing adenosine deaminase and purine nucleoside phosphorylase deficiencies. Curr Opin Allergy Clin Immunol. Dec. 2013;13(6):630-8. doi: 10.1097/ACI.0000000000000006. |
Grünewald et al., Transcriptome-wide off-target RNA editing induced by CRISPR-guided DNA base editors. Nature. May 2019;569(7756):433-437. doi: 10.1038/s41586-019-1161-z. Epub Apr. 17, 2019. |
Guo et al., Facile functionalization of FK506 for biological studies by the thiol-ene ‘click’ reaction. RSC Advances. 2014;22:11400-3. |
Gupta et al., Cross-talk between cognate and noncognate RpoE sigma factors and Zn(2+)-binding anti-sigma factors regulates photooxidative stress response in Azospirillum brasilense. Antioxid Redox Signal. Jan. 1, 2014;20(1):42-59. doi: 10.1089/ars.2013.5314. Epub Jul. 19, 2013. |
Gupta et al., Sequences in attB that affect the ability of phiC31 integrase to synapse and to activate DNA cleavage. Nucleic Acids Res. 2007;35(10):3407-19. doi: 10.1093/nar/gkm206. Epub May 3, 2007. |
Guzman et al., Tight regulation, modulation, and high-level expression by vectors containing the arabinose PBAD promoter. J Bacteriol. 1995;177(14):4121-4130. |
Haapaniemi et al., CRISPR-Cas9 genome editing induces a p53-mediated DNA damage response. Nat Med. Jul. 2018;24(7):927-930. doi: 10.1038/s41591-018-0049-z. Epub Jun. 11, 2018. |
Haddada et al., Gene therapy using adenovirus vectors. Curr Top Microbiol Immunol. 1995; 199 ( Pt 3):297-306. doi: 10.1007/978-3-642-79586-2_14. |
Halmai et al., Targeted CRIPSR/dCas9-mediated reactivation of epigenetically silenced genes suggests limited escape from the inactive X chromosome. 2nd Inti Conf on Epigenetics and Bioengineering. Oct. 4, 2018; Retrieved from the Internet: https://aiche.confex.com/aiche/epibio18/webprogram/paper544785.html. Retrieved Jun. 29, 2020. |
Halvas et al., Role of murine leukemia virus reverse transcriptase deoxyribonucleoside triphosphate-binding site in retroviral replication and in vivo fidelity. J Virol. Nov. 2000;74(22):10349-58. doi: 10.1128/jvi.74.22.10349-10358.2000. |
Handa et al., Template-assisted synthesis of adenine-mutagenized cDNA by a retroelement protein complex. Nucleic Acids Res. Oct. 12, 2018;46(18):9711-9725. doi: 10.1093/nar/gky620. |
Hanson et al., Codon optimality, bias and usage in translation and mRNA decay. Nat Rev Mol Cell Biol. Jan. 2018;19(1):20-30. doi: 10.1038/nrm.2017.91. Epub Oct. 11, 2017. |
Harms et al., Evolutionary biochemistry: revealing the historical and physical causes of protein properties. Nat Rev Genet. Aug. 2013;14(8):559-71. doi: 10.1038/nrg3540. |
Harrington et al., A thermostable Cas9 with increased lifetime in human plasma. Nat Commun. Nov. 10, 2017;8(1):1424. doi: 10.1038/s41467-017-01408-4. |
Hasegawa et al., Spontaneous mutagenesis associated with nucleotide excision repair in Escherichia coli. Genes Cells. May 2008;13(5):459-69. doi: 10.1111/j.1365-2443.2008.01185.x. |
Hector et al., CDKL5 variants: Improving our understanding of a rare neurologic disorder. Neurol Genet. Dec. 15, 2017;3(6):e200. doi: 10.1212/NXG.0000000000000200. |
Heidenreich et al., Non-homologous end joining as an important mutagenic process in cell cycle-arrested cells. EMBO J. May 1, 2003;22(9):2274-83. doi: 10.1093/emboj/cdg203. |
Held et al., In vivo correction of murine hereditary tyrosinemia type I by phiC31 integrase-mediated gene delivery. Mol Ther. Mar. 2005;11(3):399-408. doi: 10.1016/j.ymthe.2004.11.001. |
Hendricks et al., The S. cerevisiae Mag1 3-methyladenine DNA glycosylase modulates susceptibility to homologous recombination. DNA Repair (Amst). 2002;1(8):645-659. |
Hermonat et al., Use of adeno-associated virus as a mammalian DNA cloning vector: transduction of neomycin resistance into mammalian tissue culture cells. Proc Natl Acad Sci U S A. Oct. 1984;81(20):6466-70. doi: 10.1073/pnas.81.20.6466. |
Herschhorn et al., Retroviral reverse transcriptases. Cell Mol Life Sci. Aug. 2010;67(16):2717-47. doi: 10.1007/s00018-010-0346-2. Epub Apr. 1, 2010. |
Herzig et al., A Novel Leu92 Mutant of HIV-1 Reverse Transcriptase with a Selective Deficiency in Strand Transfer Causes a Loss of Viral Replication. J Virol. Aug. 2015;89(16):8119-29. doi: 10.1128/JVI.00809-15. Epub May 20, 2015. |
Higgs et al., Genetic complexity in sickle cell disease. Proc Natl Acad Sci U S A. Aug. 19, 2008;105(33):11595-6. doi: 10.1073/pnas.0806633105. Epub Aug. 11, 2008. |
Hille et al., The Biology of CRISPR-Cas: Backward and Forward. Cell. Mar. 8, 2018;172(6):1239-1259. doi: 10.1016/j.cell.2017.11.032. |
Hoang et al., UFBoot2: Improving the Ultrafast Bootstrap Approximation. Mol Biol Evol. Feb. 1, 2018;35(2):518-522. doi: 10.1093/molbev/msx281. |
Hoernes et al., Translating the epitranscriptome. Wiley Interdiscip Rev RNA. Jan. 2017;8(1):e1375. doi: 10.1002/wrna.1375. Epub Jun. 27, 2016. |
Hollis et al., Phage integrases for the construction and manipulation of transgenic mammals. Reprod Biol Endocrinol. Nov. 7, 2003;1:79. doi: 10.1186/1477-7827-1-79. |
Holsinger et al., Signal transduction in T lymphocytes using a conditional allele of Sos. Proc Natl Acad Sci U S A. Oct. 10, 1995;92(21):9810-4. doi: 10.1073/pnas.92.21.9810. |
Hsu et al., DNA targeting specificity of RNA-guided Cas9 nucleases. Nat Biotechnol. Sep. 2013;31(9):827-32. doi: 10.1038/nbt.2647. Epub Jul. 21, 2013. Supplementary Information. 27 pages. |
Huang et al., Circularly permuted and PAM-modified Cas9 variants broaden the targeting scope of base editors. Nat Biotechnol. Jun. 2019;37(6):626-631. doi: 10.1038/s41587-019-0134-y. Epub May 20, 2019. Including Supplementary Information. |
Huggins et al., Flap endonuclease 1 efficiently cleaves base excision repair and DNA replication intermediates assembled into nucleosomes. Mol Cell. Nov. 2002;10(5):1201-11. doi: 10.1016/s1097-2765(02)00736-0. |
Hung et al., Protein localization in disease and therapy. J Cell Sci. Oct. 15, 2011;124(Pt 20):3381-92. doi: 10.1242/jcs.089110. |
Hwang et al., Web-based design and analysis tools for CRISPR base editing. BMC Bioinformatics. Dec. 27, 2018;19(1):542. doi: 10.1186/s12859-018-2585-4. |
Ibba et al., Substrate specificity is determined by amino acid binding pocket size in Escherichia coli phenylalanyl-tRNA synthetase. Biochemistry. Jun. 14, 1994;33(23):7107-12. |
Ihry et al., p53 inhibits CRISPR-Cas9 engineering in human pluripotent stem cells. Nat Med. Jul. 2018;24(7):939-946. doi: 10.1038/s41591-018-0050-6. Epub Jun. 11, 2018. |
Iida et al., A site-specific, conservative recombination system carried by bacteriophage P1. Mapping the recombinase gene cin and the cross-over sites cix for the inversion of the C segment. EMBO J. 1982;1(11):1445-53. |
Iida et al., The Min DNA inversion enzyme of plasmid p15B of Escherichia coli 15T-: a new member of the Din family of site-specific recombinases. Mol Microbiol. Jun. 1990;4(6):991-7. doi: 10.1111/j.1365-2958.1990.tb00671.x. |
Imanishi et al., Detection of N6-methyladenosine based on the methyl-sensitivity of MazF RNA endonuclease. Chem Commun (Camb). Nov. 30, 2017;53(96): 2930-12933. doi: 10.1039/c7cc07699a. |
Imburgio et al., Studies of promoter recognition and start site selection by T7 RNA polymerase using a comprehensive collection of promoter variants. Biochemistry. Aug. 29, 2000;39(34):10419-30. |
Ingram, A specific chemical difference between the globins of normal human and sickle-cell anaemia haemoglobin. Nature. Oct. 13, 1956;178(4537):792-4. doi: 10.1038/178792a0. |
Iwai et al., Circular beta-lactamase: stability enhancement by cyclizing the backbone. FEBS Lett. Oct. 8, 1999;459(2):166-72. doi: 10.1016/s0014-5793(99)01220-x. |
Iwai et al., Highly efficient protein trans-splicing by a naturally split DnaE intein from Nostoc punctiforme. FEBS Lett. Mar. 20, 2006;580(7):1853-8. doi: 10.1016/j.febslet.2006.02.045. Epub Feb. 24, 2006. |
Jaffrey et al., Emerging links between m6A and misregulated mRNA methylation in cancer. Genome Med. Jan. 12, 2017;9(1):2. doi: 10.1186/s13073-016-0395-8. |
Jardine et al., HIV-1 Vaccines. Priming a broadly neutralizing antibody response to HIV-1 using a germline-targeting immunogen. Science. Jul. 10, 2015;349(6244):156-61. doi: 10.1126/science.aac5894. Epub Jun. 18, 2015. |
Jasin et al., Repair of strand breaks by homologous recombination. Cold Spring Harb Perspect Biol. Nov. 10, 2013;5(11):a012740. doi: 10.1101/cshperspect.a012740. |
Jeggo, DNA breakage and repair. Adv Genet. 1998;38:185-218. doi: 10.1016/s0065-2660(08)60144-3. |
Jeong et al., Measurement of deoxyinosine adduct: Can it be a reliable tool to assess oxidative or nitrosative DNA damage? Toxicol Lett. Oct. 17, 2012;214(2):226-33. doi: 10.1016/j.toxlet.2012.08.013. Epub Aug. 23, 2012. |
Jiang et al., CRISPR-Cas9 Structures and Mechanisms. Annu Rev Biophys. May 22, 2017;46:505-529. doi: 10.1146/annurev-biophys-062215-010822. Epub Mar. 30, 2017. |
Jin et al., Cytosine, but not adenine, base editors induce genome-wide off-target mutations in rice. Science. Apr. 19, 2019;364(6437):292-295. doi: 10.1126/science.aaw7166. Epub Feb. 28, 2019. |
Jiricny, The multifaceted mismatch-repair system. Nat Rev Mol Cell Biol. May 2006;7(5):335-46. doi: 10.1038/nrm1907. |
Johann et al., GLVR1, a receptor for gibbon ape leukemia virus, is homologous to a phosphate permease of Neurospora crassa and is expressed at high levels in the brain and thymus. J Virol. Mar. 1992;66(3):1635-40. doi: 10.1128/JVI.66.3.1635-1640.1992. |
Johansson et al., RNA Recognition by the MS2 Phage Coat Protein. Seminars in Virology. 1997;8(3):176-85. https://doi.org/10.1006/smvy.1997.0120. |
Johansson et al., Selenocysteine in proteins-properties and biotechnological use. Biochim Biophys Acta. Oct. 30, 2005;1726(1):1-13. Epub Jun. 1, 2005. |
Johns et al., The promise and peril of continuous in vitro evolution. J Mol Evol. Aug. 2005;61(2):253-63. Epub Jun. 27, 2005. |
Joho et al., Identification of a region of the bacteriophage T3 and T7 Rna polymerases that determines promoter specificity. J Mol Biol. Sep. 5, 1990;215(1):31-9. |
Joyce et al., Amplification, mutation and selection of catalytic RNA. Gene. Oct. 15, 1989;82(1):83-7. doi: 10.1016/0378-1119(89)90033-4. |
Jusiak et al., Comparison of Integrases Identifies Bxb1-GA Mutant as the Most Efficient Site-Specific Integrase System in Mammalian Cells. ACS Synth Biol. Jan. 18, 2019;8(1):16-24. doi: 10.1021/acssynbio.8b00089. Epub Jan. 9, 2019. |
Jyothy et al., Translocation Down syndrome. Indian J Med Sci. Mar. 2002;56(3):122-6. |
Kacian et al., Purification of the DNA polymerase of avian myeloblastosis virus. Biochim Biophys Acta. Sep. 24, 1971;246(3):365-83. doi: 10.1016/0005-2787(71)90773-8. |
Kaczmarczyk et al., Manipulating the Prion Protein Gene Sequence and Expression Levels with CRISPR/Cas9. PLoS One. Apr. 29, 2016;11(4):e0154604. doi: 10.1371/journal.pone.0154604. |
Kadoch et al., Reversible disruption of mSWI/SNF (BAF) complexes by the SS18-SSX oncogenic fusion in synovial sarcoma. Cell. Mar. 28, 2013;153(1):71-85. doi: 10.1016/j.cell.2013.02.036. |
Kahmann et al., G inversion in bacteriophage Mu DNA is stimulated by a site within the invertase gene and a host factor. Cell. Jul. 1985;41(3):771-80. doi: 10.1016/s0092-8674(85)80058-1. |
Kalyaanamoorthy et al., ModelFinder: fast model selection for accurate phylogenetic estimates. Nat Methods. Jun. 2017;14(6):587-589. doi: 10.1038/nmeth.4285. Epub May 8, 2017. |
Kao et al., Cleavage specificity of Saccharomyces cerevisiae flap endonuclease 1 suggests a double-flap structure as the cellular substrate. J Biol Chem. Apr. 26, 2002;277(17):14379-89. doi: 10.1074/jbc.M110662200. Epub Feb. 1, 2002. |
Karimova et al., Discovery of Nigri/nox and Panto/pox site-specific recombinase systems facilitates advanced genome engineering. Sci Rep. Jul. 22, 2016;6:30130. doi: 10.1038/srep30130. |
Karimova et al., Vika/vox, a novel efficient and specific Cre/loxP-like site-specific recombination system. Nucleic Acids Res. Jan. 2013;41(2):e37. doi: 10.1093/nar/gks1037. Epub Nov. 9, 2012. |
Katafuchi et al., DNA polymerases involved in the incorporation of oxidized nucleotides into DNA: their efficiency and template base preference. Mutat Res. Nov. 28, 2010;703(1):24-31. doi: 10.1016/j.mrgentox.2010.06.004. Epub Jun. 11, 2010. |
Kato et al., Improved purification and enzymatic properties of three forms of reverse transcriptase from avian myeloblastosis virus. J Virol Methods. Dec. 1984;9(4):325-39. doi: 10.1016/0166-0934(84)90058-2. |
Katoh et al., MAFFT multiple sequence alignment software version 7: improvements in performance and usability. Mol Biol Evol. Apr. 2013;30(4):772-80. doi: 10.1093/molbev/mst010. Epub Jan. 16, 2013. |
Kaufman et al., Translational efficiency of polycistronic mRNAs and their utilization to express heterologous genes in mammalian cells. EMBO J. Jan. 1987;6(1):187-93. |
Kavli et al., Excision of cytosine and thymine from DNA by mutants of human uracil-DNA glycosylase. EMBO J. Jul. 1, 1996;15(13):3442-7. |
Kawarasaki et al., Enhanced crossover SCRATCHY: construction and high-throughput screening of a combinatorial library containing multiple non-homologous crossovers. Nucleic Acids Res. Nov. 1, 2003;31(21):e126. |
Keijzers et al., Human exonuclease 1 (EXO1) activity characterization and its function on flap structures. Biosci Rep. Apr. 25. 2015;35(3):e00206. doi: 10.1042/BSR20150058. |
Kelman, PCNA: structure, functions and interactions. Oncogene. Feb. 13, 1997;14(6):629-40. doi: 10.1038/sj.onc.1200886. |
Kessel et al., Murine developmental control genes. Science. Jul. 27, 1990;249(4967):374-9. doi: 10.1126/science. 1974085. |
Kessler et al., Gene delivery to skeletal muscle results in sustained expression and systemic delivery of a therapeutic protein. Proc Natl Acad Sci U S A. Nov. 26, 1996;93(24):14082-7. doi: 10.1073/pnas.93.24.14082. |
Ketha et al., Application of bioinformatics-coupled experimental analysis reveals a new transport-competent nuclear localization signal in the nucleoprotein of Influenza A virus strain. BMC Cell Biol. Apr. 28, 2008; 9:22. https://doi.org/10.1186/1471-2121-9-22. |
Kilcher et al., Brochothrix thermosphacta bacteriophages feature heterogeneous and highly mosaic genomes and utilize unique prophage insertion sites. J Bacteriol. Oct. 2010;192(20):5441-53. doi: 10.1128/JB.00709-10. Epub Aug. 13, 2010. |
Kim et al., DJ-1, a novel regulator of the tumor suppressor PTEN. Cancer Cell. 2005;7(3):263-273. |
Kim et al., Genome-wide target specificity of CRISPR RNA-guided adenine base editors. Nat Biotechnol. Apr. 2019;37(4):430-435. doi: 10.1038/s41587-019-0050-1. Epub Mar. 4, 2019. |
Kim et al., An anionic human protein mediates cationic liposome delivery of genome editing proteins into mammalian cells. Nat Commun. Jul. 2, 2019;10(1):2905. doi: 10.1038/s41467-019-10828-3. |
Kim et al., Evaluating and Enhancing Target Specificity of Gene-Editing Nucleases and Deaminases. Annu Rev Biochem. Jun. 20, 2019;88:191-220. doi: 10.1146/annurev-biochem-013118-111730. Epub Mar. 18, 2019. |
Kim et al., High cleavage efficiency of a 2A peptide derived from porcine teschovirus-1 in human cell lines, zebrafish and mice. PLoS One. 2011;6(4):e18556. doi: 10.1371/journal.pone.0018556. Epub Apr. 29, 2011. |
Kim et al., In vivo high-throughput profiling of CRISPR-Cpf1 activity. Nat Methods. Feb. 2017;14(2): 153-159. doi: 10.1038/nmeth.4104. Epub Dec. 19, 2016. |
Kim et al., Mycobacteriophage Bxb1 integrates into the Mycobacterium smegmatis groEL1 gene. Mol Microbiol. Oct. 2003;50(2):463-73. doi: 10.1046/j.1365-2958.2003.03723.X. |
Kim et al., Structural and kinetic characterization of Escherichia coli TadA, the wobble-specific tRNA deaminase. Biochemistry. May 23, 2006;45(20):6407-16. doi: 10.1021/bi0522394. PMID: 16700551. |
Klapacz et al., Frameshift mutagenesis and micro satellite instability induced by human alkyladenine DNA glycosylase. Mol Cell. Mar. 26, 2010;37(6):843-53. doi: 10.1016/j.molcel.2010.01.038. |
Kleiner et al., In vitro selection of a DNA-templated small-molecule library reveals a class of macrocyclic kinase inhibitors. J Am Chem Soc. Aug. 25, 2010;132(33):11779-91. doi: 10.1021/ja104903x. |
Klement et al., Discrimination between bacteriophage T3 and T7 promoters by the T3 and T7 RNA polymerases depends primarily upon a three base-pair region located 10 to 12 base-pairs upstream from the start site. J Mol Biol. Sep. 5, 1990;215(1):21-9. |
Klompe et al., Transposon-encoded CRISPR-Cas systems direct RNA-guided DNA integration. Nature. Jul. 2019;571(7764):219-225. doi: 10.1038/s41586-019-1323-z. Epub Jun. 12, 2019. |
Knott et al., Guide-bound structures of an RNA-targeting A-cleaving CRISPR-Cas13a enzyme. Nat Struct Mol Biol. Oct. 2017;24(10):825-833. doi: 10.1038/nsmb.3466. Epub Sep. 11, 2017. |
Koblan et al., Improving cytidine and adenine base editors by expression optimization and ancestral reconstruction. Nat Biotechnol. Oct. 2018;36(9):843-846. doi: 10.1038/nbt.4172. Epub May 29, 2018. |
Kohli et al., A portable hot spot recognition loop transfers sequence preferences from APOBEC family members to activation-induced cytidine deaminase. J Biol Chem. Aug. 21, 2009;284(34):22898-904. doi: 10.1074/jbc.M109.025536. Epub Jun. 26, 2009. |
Koike-Yusa et al., Genome-wide recessive genetic screening in mammalian cells with a lentiviral CRISPR-guide RNA library. Nat Biotechnol. Mar. 2014;32(3):267-73. doi: 10.1038/nbt.2800. Epub Dec. 23, 2013. |
Kolot et al., Kolot M, Malchin N, Elias A, Gritsenko N, Yagil E. Site promiscuity of coliphage HK022 integrase as a tool for gene therapy. Gene Ther. Jul. 2015;22(7):521-7. doi: 10.1038/gt.2015.9. Epub Mar. 12, 2015. |
Kolot et al., Site-specific recombination in mammalian cells expressing the Int recombinase of bacteriophage HK022. Mol Biol Rep. Aug. 1999;26(3):207-13. doi: 10.1023/a:1007096701720. |
Komor, Editing the Genome Without Double-Stranded DNA Breaks. ACS Chem Biol. Feb. 16, 2018;13(2):383-388. doi: 10.1021/acschembio.7b00710. Epub Oct. 9, 2017. |
Konermann et al., Genome-scale transcriptional activation by an engineered CRISPR-Cas9 complex. Nature. Jan. 29, 2015;517(7536):583-8. doi: 10.1038/nature14136. Epub Dec. 10, 2014. |
Kosicki et al., Repair of double-strand breaks induced by CRISPR-Cas9 leads to large deletions and complex rearrangements. Nat Biotechnol. Sep. 2018;36(8):765-771. doi: 10.1038/nbt.4192. Epub Jul. 16, 2018. |
Kotewicz et al., Cloning and overexpression of Moloney murine leukemia virus reverse transcriptase in Escherichia coli. Gene. 1985;35(3):249-58. doi: 10.1016/0378-1119(85)90003-4. |
Kotewicz et al., Isolation of cloned Moloney murine leukemia virus reverse transcriptase lacking ribonuclease H activity. Nucleic Acids Res. Jan. 11, 1988;16(1):265-77. doi: 10.1093/nar/16.1.265. |
Kotin, Prospects for the use of adeno-associated virus as a vector for human gene therapy. Hum Gene Ther. Jul. 1994;5(7):793-801. doi: 10.1089/hum.1994.5.7-793. |
Kowalski et al., Delivering the Messenger: Advances in Technologies for Therapeutic mRNA Delivery. Mol Ther. Apr. 10, 2019;27(4):710-728. doi: 10.1016/j.ymthe.2019.02.012. Epub Feb. 19, 2019. |
Kozak, An analysis of 5′-noncoding sequences from 699 vertebrate messenger RNAs. Nucleic Acids Res. Oct. 26, 1987;15(20):8125-48. doi: 10.1093/nar/15.20.8125. |
Kraft et al., Deletions, Inversions, Duplications: Engineering of Structural Variants using CRISPR/Cas in Mice. Cell Rep. Feb. 10, 2015;10(5):833-839. doi: 10.1016/j.celrep.2015.01.016. Epub Feb. 7, 2015. |
Kremer et al., Adenovirus and adeno-associated virus mediated gene transfer. Br Med Bull. Jan. 1995;51(1):31-44. doi: 10.1093/oxfordjournals.bmb.a072951. |
Krokan et al., Uracil in DNA—occurrence, consequences and repair. Oncogene. Dec. 16, 2002;21(58):8935-48. doi: 10.1038/sj.onc.1205996. |
Krokan et al., Base excision repair. Cold Spring Harb Perspect Biol. Apr. 1, 2013;5(4):a012583. doi: 10.1101/cshperspect.a012583. |
Krzywkowski et al., Limited reverse transcriptase activity of phi29 DNA polymerase. Nucleic Acids Res. Apr.20, 2018;46(7):3625-3632. doi: 10.1093/nar/gky190. |
Kügler et al., Human synapsin 1 gene promoter confers highly neuron-specific long-term transgene expression from an adenoviral vector in the adult rat brain depending on the transduced area. Gene Ther. Feb. 2003;10(4):337-47. doi: 10.1038/sj.gt.3301905. |
Kunkel et al., Eukaryotic Mismatch Repair in Relation to DNA Replication. Annu Rev Genet. 2015;49:291-313. doi: 10.1146/annurev-genet-112414-054722. |
Kurjan et al., Structure of a yeast pheromone gene (MF alpha): a putative alpha-factor precursor contains four tandem copies of mature alpha-factor. Cell. Oct. 1982;30(3):933-43. doi: 10.1016/0092-8674(82)90298-7. |
Kuscu et al., CRISPR-Cas9-AID base editor is a powerful gain-of-function screening tool. Nat Methods. Nov. 29, 2016;13(12):983-984. doi: 10.1038/nmeth.4076. |
Kwart et al., Precise and efficient scarless genome editing in stem cells using CORRECT. Nat Protoc. Feb. 2017;12(2):329-354. doi: 10.1038/nprot.2016.171. Epub Jan. 19, 2017. |
Kweon et al., Fusion guide RNAs for orthogonal gene manipulation with Cas9 and Cpf1. Nat Commun. Nov. 23, 2017;8(1):1723. doi: 10.1038/s41467-017-01650-w. Erratum in: Nat Commun. Jan. 16, 2018;9(1):303. |
Lada et al., Mutator effects and mutation signatures of editing deaminases produced in bacteria and yeast. Biochemistry (Mosc). Jan. 2011;76(1):131-46. |
Lakich et al., Inversions disrupting the factor VIII gene are a common cause of severe haemophilia A. Nat Genet. Nov. 1993;5(3):236-41. doi: 10.1038/ng1193-236. |
Landrum et al., ClinVar: public archive of relationships among sequence variation and human phenotype. Nucleic Acids Res. Jan. 2014;42(Database issue):D980-5. doi: 10.1093/nar/gkt1113. Epub Nov. 14, 2013. |
Lauer et al., Construction, characterization, and use of two Listeria monocytogenes sitespecific phage integration vectors. J Bacteriol. Aug. 2002;184(15):4177-86. doi: 10.1128/jb.184.15.4177-4186.2002. |
Lawyer et al., High-level expression, purification, and enzymatic characterization of full-length Thermus aquaticus DNA polymerase and a truncated form deficient in 5′ to 3′ exonuclease activity. PCR Methods Appl. May 1993;2(4):275-87. doi: 10.1101/gr.2.4.275. |
Le Grice et al., Purification and characterization of recombinant equine infectious anemia virus reverse transcriptase. J Virol. Dec. 1991;65(12):7004-7. doi: 10.1128/JVI.65.12.7004-7007.1991. |
Leaver-Fay et al., ROSETTA3: an object-oriented software suite for the simulation and design of macromolecules. Methods Enzymol. 2011;487:545-74. doi: 10.1016/B978-0-12-381270-4.00019-6. |
Leconte et al., A population-based experimental model for protein evolution: effects of mutation rate and selection stringency on evolutionary outcomes. Biochemistry. Feb. 26, 2013;52(8):1490-9. doi: 10.1021/bi3016185. Epub Feb. 14, 2013. |
Lee et al., Group I Intron-Based Therapeutics Through Trans-Splicing Reaction. Prog Mol Biol Transl Sci. 2018;159:79-100. doi: 10.1016/bs.pmbts.2018.07.001. Epub Aug. 9, 2018. |
Lee et al., Simultaneous targeting of linked loci in mouse embryos using base editing. Sci Rep. Feb. 7, 2019;9(1):1662. doi: 10.1038/s41598-018-33533-5. |
Lee et al., Site-specific integration of mycobacteriophage L5: integration-proficient vectors for Mycobacterium smegmatis, Mycobacterium tuberculosis, and bacille Calmette-Guerin. Proc Natl Acad Sci U S A. Apr. 15, 1991;88(8):3111-5. doi: 10.1073/pnas.88.8.3111. |
Lee et al., Synthetically modified guide RNA and donor DNA are a versatile platform for CRISPR-Cas9 engineering. Elife. May 2, 2017;6:e25312. doi: 10.7554/eLife.25312. |
Lee et al., Targeted chromosomal deletions in human cells using zinc finger nucleases. Genome Res. Jan. 2010 20: 81-89; Published in Advance Dec. 1, 2009, doi:10.1101/gr.099747.109. |
Lee et al., Targeting fidelity of adenine and cytosine base editors in mouse embryos. Nat Commun. Nov. 15, 2018;9(1):4804. doi: 10.1038/s41467-018-07322-7. |
Lee et al., Transcriptional regulation and its misregulation in disease. Cell. Mar. 14, 2013;152(6):1237-51. doi: 10.1016/j.cell.2013.02.014. |
Lei et al., Site-specificity of serine integrase demonstrated by the attB sequence preference of ?BT1 integrase. FEBS Lett. Apr. 2018;592(8):1389-1399. doi: 10.1002/1873-3468.13023. Epub Mar. 25, 2018. |
Lemos et al., CRISPR/Cas9 cleavages in budding yeast reveal templated insertions and strand-specific insertion/deletion profiles. Proc Natl Acad Sci U SA . Feb. 27, 2018;115(9):E2040-E2047. doi: 10.1073/pnas.1716855115. Epub Feb. 13, 2018. |
Levy et al., Membrane-associated guanylate kinase dynamics reveal regional and developmental specificity of synapse stability. J Physiol. Mar. 1, 2017;595(5):1699-1709. doi: 10.1113/JP273147. Epub Jan. 18, 2017. |
Lew et al., Protein splicing in vitro with a semisynthetic two-component minimal intein. J Biol Chem. Jun. 26, 1998;273(26):15887-90. doi: 10.1074/jbc.273.26.15887. |
Lewis et al., Cytosine deamination and the precipitous decline of spontaneous mutation during Earth's history. Proc Natl Acad Sci U S A. Jul. 19, 2016;113(29):8194-9. doi: 10.1073/pnas.1607580113. Epub Jul. 5, 2016. |
Lewis et al., RNA modifications and structures cooperate to guide RNA-protein interactions. Nat Rev Mol Cell Biol. Mar. 2017;18(3):202-210. doi: 10.1038/nrm.2016.163. Epub Feb. 1, 2017. |
Li et al., A Radioactivity-Based Assay for Screening Human m6A-RNA Methyltransferase, METTL3-METTL14 Complex, and Demethylase ALKBH5. J Biomol Screen. Mar. 2016;21(3):290-7. doi: 10.1177/1087057115623264. Epub Dec. 23, 2015. |
Li et al., Fast and accurate short read alignment with Burrows-Wheeler transform. Bioinformatics. Jul. 15, 2009;25(14):1754-60. doi: 10.1093/bioinformatics/btp324. Epub May 18, 2009. |
Li et al., Lagging strand DNA synthesis at the eukaryotic replication fork involves binding and stimulation of FEN-1 by proliferating cell nuclear antigen. J Biol Chem. Sep. 22, 1995;270(38):22109-12. doi: 10.1074/jbc.270.38.22109. |
Li et al., Loss of post-translational modification sites in disease. Pac Symp Biocomput. 2010:337-47. doi: 10.1142/9789814295291_0036. |
Li et al., RSEM: accurate transcript quantification from RNA-Seq data with or without a reference genome. BMC Bioinformatics. Aug. 4, 2011;12:323. doi: 10.1186/1471-2105-12-323. |
Li, Mechanisms and functions of DNA mismatch repair. Cell Res. Jan. 2008;18(1):85-98. doi: 10.1038/cr.2007.115. |
Liang et al., Correction of ?-thalassemia mutant by base editor in human embryos. Protein Cell. Nov. 2017;8(11):811-822. doi: 10.1007/sl3238-017-0475-6. Epub Sep. 23, 2017. |
Liang et al., Homology-directed repair is a major double-strand break repair pathway in mammalian cells. Proc Natl Acad Sci U S A. Apr. 28, 1998;95(9):5172-7. doi: 10.1073/pnas.95.9.5172. |
Lim et al., Crystal structure of the moloney murine leukemia virus RNase H domain. J Virol. Sep. 2006;80(17):8379-89. doi: 10.1128/JVI.00750-06. |
Lin et al., The human REV1 gene codes for a DNA template-dependent dCMP transferase. Nucleic Acids Res. Nov. 15, 1999;27(22):4468-75. doi: 10.1093/nar/27.22.4468. |
Liu et al., Split dnaE genes encoding multiple novel inteins in Trichodesmium erythraeum. J Biol Chem. Jul. 18, 2003;278(29):26315-8. doi: 10.1074/jbc.C300202200. Epub May 24, 2003. |
Liu et al., A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation. Nat Chem Biol. Feb. 2014;10(2):93-5. doi: 10.1038/nchembio.1432. Epub Dec. 6, 2013. |
Liu et al., Adding new chemistries to the genetic code. Annu Rev Biochem. 2010;79:413-44. doi: 10.1146/annurev.biochem.052308.105824. |
Liu et al., Calcineurin is a common target of cyclophilin-cyclosporin A and FKBP-FK506 complexes. Cell. Aug. 23, 1991;66(4):807-15. doi: 10.1016/0092-8674(91)90124-h. |
Liu et al., CasX enzymes comprise a distinct family of RNA-guided genome editors. Nature. Feb. 2019;566(7743):218-223. doi: 10.1038/s41586-019-0908-x. Epub Feb. 4, 2019. Author manuscript entitled CRISPR-CasX is an RNA-dominated enzyme active for human genome editing. |
Liu et al., Editing DNA Methylation in the Mammalian Genome. Cell. Sep. 22, 2016;167(1):233-247.e17. doi: 10.1016/j.cell.2016.08.056. |
Liu et al., Flap endonuclease 1: a central component of DNA metabolism. Annu Rev Biochem. 2004;73:589-615. doi: 10.1146/annurev.biochem.73.012803.092453. |
Liu et al., Genetic incorporation of unnatural amino acids into proteins in mammalian cells. Nat Methods. Mar. 2007;4(3):239-44. Epub Feb. 25, 2007. |
Liu et al., Highly efficient RNA-guided base editing in rabbit. Nat Commun. Jul. 13, 2018;9(1):2717. doi: 10.1038/s41467-018-05232-2. |
Liu et al., N(6)-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions. Nature. Feb. 26, 2015;518(7540):560-4. doi: 10.1038/nature14234. |
Liu et al., Probing N6-methyladenosine RNA modification status at single nucleotide resolution in mRNA and long noncoding RNA. RNA. Dec. 2013;19(12): 1848-56. doi: 10.1261/rna.041178.113. Epub Oct. 18, 2013. |
Liu et al., Reverse transcriptase of foamy virus. Purification of the enzymes and immunological identification. Arch Virol. 1977;55(3):187-200. doi: 10.1007/BF01319905. |
Liu et al., Reverse transcriptase-mediated tropism switching in Bordetella bacteriophage. Science. Mar. 15, 2002;295(5562):2091-4. doi: 10.1126/science. 1067467. |
Liu et al., Saccharomyces cerevisiae flap endonuclease 1 uses flap equilibration to maintain triplet repeat stability. Mol Cell Biol. May 2004;24(9):4049-64. doi: 10.1128/MCB.24.9.4049-4064.2004. |
Liu et al., The Molecular Architecture for RNA-Guided RNA Cleavage by Cas13a. Cell. Aug. 10, 2017;170(4):714-726.el0. doi: 10.1016/j.cell.2017.06.050. Epub Jul. 27, 2017. |
Loessner et al., Complete nucleotide sequence, molecular analysis and genome structure of bacteriophage A118 of Listeria monocytogenes: implications for phage evolution. Mol Microbiol. Jan. 2000;35(2):324-40. doi: 10.1046/j.1365-2958.2000.01720.X. |
Long et al., Postnatal genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy. Science. Jan. 22, 2016;351(6271):400-3. doi: 10.1126/science.aad5725. Epub Dec. 31, 2015. |
Lopez-Girona et al., Cereblon is a direct protein target for immunomodulatory and antiproliferative activities of lenalidomide and pomalidomide. Leukemia. Nov. 2012;26(11):2326-35. doi: 10.1038/leu.2012.119. Epub May 3, 2012. |
Lorenz et al., ViennaRNA Package 2.0. Algorithms Mol Biol. Nov. 24, 2011;6:26. doi: 10.1186/1748-7188-6-26. |
Luan et al., Reverse transcription of R2Bm RNA is primed by a nick at the chromosomal target site: a mechanism for non-L'IR retrotransposition. Cell. Feb. 26, 1993;72(4):595-605. doi: 10.1016/0092-8674(93)90078-5. |
Luckow et al., High level expression of nonfused foreign genes with Autographa califomica nuclear polyhedrosis virus expression vectors. Virology. May 1989;170(1):31-9. doi: 10.1016/0042-6822(89)90348-6. |
Lukacsovich et al., Repair of a specific double-strand break generated within a mammalian chromosome by yeast endonuclease I-SceI. Nucleic Acids Res. Dec. 25, 1994;22(25):5649-57. doi: 10.1093/nar/22.25.5649. |
Lüke et al., Partial purification and characterization of the reverse transcriptase of the simian immunodeficiency virus TYO-7 isolated from an African green monkey. Biochemistry. Feb. 20, 1990;29(7):1764-9. doi: 10.1021/bi00459a015. |
Ma et al., Identification of pseudo attP sites for phage phiC31 integrase in bovine genome. Biochem Biophys Res Commun. Jul. 7, 2006;345(3):984-8. doi: 10.1016/j.bbrc.2006.04.145. Epub May 3, 2006. |
Ma et al., In vitro protein engineering using synthetic tRNA(Ala) with different anticodons. Biochemistry. Aug. 10, 1993;32(31):7939-45. |
Ma et al., PhiC31 integrase induces efficient site-specific recombination in the Capra hircus genome. DNA Cell Biol. Aug. 2014;33(8):484-91. doi: 10.1089/dna.2013.2124. Epub Apr. 22, 2014. |
Maas et al., Identification and characterization of a human tRNA-specific adenosine deaminase related to the ADAR family of pre-mRNA editing enzymes. Proc Natl Acad Sci USA. Aug. 3, 1999;96(16):8895-900. doi: 10.1073/pnas.96.16.8895. |
MacBeth et al., Inositol hexakisphosphate is bound in the ADAR2 core and required for RNA editing. Science. Sep. 2, 2005;309(5740): 1534-9. doi: 10.1126/science. 1113150. |
Macrae et al., Ribonuclease revisited: structural insights into ribonuclease III family enzymes. Curr Opin Struct Biol. Feb. 2007;17(1):138-45. doi: 10.1016/j.sbi.2006.12.002. Epub Dec. 27, 2006. |
Magin et al., Corf, the Rev/Rex homologue of HTDV/HERV-K, encodes an arginine-rich nuclear localization signal that exerts a trans-dominant phenotype when mutated. Virology. Aug. 15, 2000;274(1):11-6. doi: 10.1006/viro.2000.0438. |
Maji et al., A High-Throughput Platform to Identify Small-Molecule Inhibitors of CRISPR-Cas9. Cell. May 2, 2019;177(4):1067-1079.el9. doi: 10.1016/j.cell.2019.04.009. |
Makarova et al., Classification and Nomenclature of CRISPR-Cas Systems: Where from Here? Crispr J. Oct. 2018;1(5):325-336. doi: 10.1089/crispr.2018.0033. |
Makeyev et al., Evolutionary potential of an RNA virus. J Virol. Feb. 2004;78(4):2114-20. |
Malashkevich et al., Crystal structure of tRNA adenosine deaminase TadA from Escherichia coli. Deposited: Mar. 10, 2005 Released: Feb. 21, 2006 doi:10.2210/pdb1z3a/pdb (2006). |
Malito et al., Structural basis for lack of toxicity of the diphtheria toxin mutant CRM197. Proc Natl Acad Sci U S A. Apr. 3, 2012;109(14):5229-34. doi: 10.1073/pnas.1201964109. Epub Mar. 19, 2012. |
Mandal et al., Efficient ablation of genes in human hematopoietic stem and effector cells using CRISPR/Cas9. Cell Stem Cell. Nov. 6, 2014;15(5):643-52. doi: 10.1016/j.stem.2014.10.004. Epub Nov. 6, 2014. |
Marceau, Functions of single-strand DNA-binding proteins in DNA replication, recombination, and repair. Methods Mol Biol. 2012;922:1-21. doi: 10.1007/978-1-62703-032-8_1. |
Maresca et al., Obligate ligation-gated recombination (ObLiGaRe): custom-designed nuclease-mediated targeted integration through nonhomologous end joining. Genome Res. Mar. 2013;23(3):539-46. Doi: 10.1101/gr.145441.112. Epub Nov. 14, 2012. |
Martinez et al., Hypermutagenesis of RNA using human immunodeficiency virus type 1 reverse transcriptase and biased dNTP concentrations. Proc Natl Acad Sci U S A. Dec. 6, 1994;91(25):11787-91. doi: 10.1073/pnas.91.25.11787. |
Martsolf et al., Complete trisomy 17p a relatively new syndrome. Ann Genet. 1988;31(3):172-4. |
Mascola et al., HIV-1 neutralizing antibodies: understanding nature's pathways. Immunol Rev. Jul. 2013;254(1):225-44. doi: 10.1111/imr.12075. |
Mathys et al., Characterization of a self-splicing mini-intein and its conversion into autocatalytic N- and C-terminal cleavage elements: facile production of protein building blocks for protein ligation. Gene. Apr. 29, 1999;231(1-2):1-13. doi: 10.1016/s0378-1119(99)00103-1. |
Matsuura et al., A gene essential for the site-specific excision of actinophage r4 prophage genome from the chromosome of a lysogen. J Gen Appl Microbiol. 1995;41(1):53-61. |
Matthews, Structures of human ADAR2 bound to dsRNA reveal base-flipping mechanism and basis for site selectivity. Nat Struct Mol Biol. May 2016;23(5):426-33. doi: 10.1038/nsmb.3203. Epub Apr. 11, 2016. |
May et al., Emergent lineages of mumps virus suggest the need for a polyvalent vaccine. Int J Infect Dis. Jan. 2018;66:1-4. doi: 10.1016/j.ijid.2017.09.024. Epub Oct. 4, 2017. |
McCarroll et al., Copy-number variation and association studies of human disease. Nat Genet. Jul. 2007;39(7 Suppl):S37-42. doi: 10.1038/ng2080. |
McDonald et al., Characterization of mutations at the mouse phenylalanine hydroxylase locus. Genomics. Feb. 1, 1997;39(3):402-5. doi: 10.1006/geno.1996.4508. |
McKenna et al., Recording development with single cell dynamic lineage tracing. Development. Jun. 27, 2019;146(12):dev169730. doi: 10.1242/dev.169730. |
McKenna et al., Whole-organism lineage tracing by combinatorial and cumulative genome editing. Science. Jul. 29, 2016;353(6298):aaf7907. doi: 10.1126/science.aaf7907. Epub May 26, 2016. |
McNaughton et al., Mammalian cell penetration, siRNA transfection, and DNA transfection by supercharged proteins. Proc Natl Acad Sci U S A. Apr. 14, 2009;106(15):6111-6. doi: 10.1073/pnas.0807883106. Epub Mar. 23, 2009. |
McVey et al., MMEJ repair of double-strand breaks (director's cut): deleted sequences and alternative endings. Trends Genet. Nov. 2008;24(11):529-38. doi: 10.1016/j.tig.2008.08.007. Epub Sep. 21, 2008. |
Mead et al., A novel protective prion protein variant that colocalizes with kuru exposure. N Engl J Med. Nov. 19, 2009;361(21):2056-65. doi: 10.1056/NEJMoa0809716. |
Meinke et al., Cre Recombinase and Other Tyrosine Recombinases. Chem Rev. Oct. 26, 2016;116(20):12785-12820. doi: 10.1021/acs.chemrev.6b00077. Epub May 10, 2016. |
Meyer et al., Comprehensive analysis of mRNA methylation reveals enrichment in 3′ U TRs and near stop codons. Cell. Jun. 22, 2012;149(7):1635-46. doi: 10.1016/j.cell.2012.05.003. Epub May 17, 2012. |
Meyer et al., Library generation by gene shuffling. Curr Protoc Mol Biol. Jan. 6, 2014;105:Unit 15.12.. doi: 10.1002/0471142727.mb1512s105. |
Meyer et al., The dynamic epitranscriptome: N6-methyladenosine and gene expression control. Nat Rev Mol Cell Biol. May 2014;15(5):313-26. doi: 10.1038/nrm3785. Epub Apr. 9, 2014. |
Michel et al., Mitochondrial class II introns encode proteins related to the reverse transcriptases of retroviruses. Nature. Aug. 15-21, 1985;316(6029):641-3. doi: 10.1038/316641a0. |
Mihai et al., PTEN inhibition improves wound healing in lung epithelia through changes in cellular mechanics that enhance migration. Am J Physiol Lung Cell Mol Physiol. 2012;302(3):L287-L299. |
Mijakovic et al., Bacterial single-stranded DNA-binding proteins are phosphorylated on tyrosine. Nucleic Acids Res. Mar. 20, 2006;34(5):1588-96. doi: 10.1093/nar/gkj514. |
Miller et al., Construction and properties of retrovirus packaging cells based on gibbon ape leukemia virus. J Virol. May 1991;65(5):2220-4. doi: 10.1128/JVI.65.5.2220-2224.1991. |
Miller, Human gene therapy comes of age. Nature. Jun. 11, 1992;357(6378):455-60. doi: 10.1038/357455a0. |
Mills et al., Protein splicing in trans by purified N- and C-terminal fragments of the Mycobacterium tuberculosis RecA intein. Proc Natl Acad Sci U S A. Mar. 31, 1998;95(7):3543-8. doi: 10.1073/pnas.95.7.3543. |
Mitani et al., Delivering therapeutic genes—matching approach and application. Trends Biotechnol. May 1993;11(5):162-6. doi: 10.1016/0167-7799(93)90108-L. |
Mitton-Fry et al., Poly(A) tail recognition by a viral RNA element through assembly of a triple helix. Science. Nov. 26, 2010;330(6008):1244-7. doi: 10.1126/science. 1195858. |
Miyaoka et al., Systematic quantification of HDR and NHEJ reveals effects of locus, nuclease, and cell type on genome-editing. Sci Rep. Mar. 31, 2016;6:23549. doi: 10.1038/srep23549. |
Mohr et al., A Reverse Transcriptase-Cas1 Fusion Protein Contains a Cas6 Domain Required for Both CRISPR RNA Biogenesis and RNA Spacer Acquisition. Mol Cell. Nov. 15, 2018;72(4):700-714.e8. doi: 10.1016/j.molcel.2018.09.013. Epub Oct. 18, 2018. Including Supplemental Information. |
Mohr et al., Thermostable group II intron reverse transcriptase fusion proteins and their use in cDNA synthesis and next-generation RNA sequencing. RNA. Jul. 2013;19(7):958-70. doi: 10.1261/ma.039743.113. Epub May 22, 2013. |
Mol et al., Crystal structure and mutational analysis of human uracil-DNA glycosylase: structural basis for specificity and catalysis. Cell. Mar. 24, 1995;80(6):869-78. doi: 10.1016/0092-8674(95)90290-2. |
Molla et al., CRISPR/Cas-Mediated Base Editing: Technical Considerations and Practical Applications. Trends Biotechnol. Oct. 2019;37(10):1121-1142. doi: 10.1016/j.tibtech.2019.03.008. Epub Apr. 14, 2019. |
Monot et al., The specificity and flexibility of 11 reverse transcription priming at imperfect T-tracts. PLoS Genet. May 2013;9(5):e1003499. doi: 10.1371/journal.pgen.1003499. Epub May 9, 2013. |
Morita et al., The site-specific recombination system of actinophage TG1. FEMS Microbiol Lett. Aug. 2009;297(2):234-40. doi: 10.1111/j.1574-6968.2009.01683.x. |
Muir et al., Expressed protein ligation: a general method for protein engineering. Proc Natl Acad Sci U S A. Jun. 9, 1998;95(12):6705-10. doi: 10.1073/pnas.95.12.6705. |
Muller et al., Nucleotide exchange and excision technology (NExT) DNA shuffling: a robust method for DNA fragmentation and directed evolution. Nucleic Acids Res. Aug. 1, 2005;33(13):e117. doi: 10.1093/nar/gni116. PMID: 16061932; PMCID: PMC1182171. |
Mumtsidu et al., Structural features of the single-stranded DNA-binding protein of Epstein-Barr virus. J Struct Biol. Feb. 2008;161(2):172-87. doi: 10.1016/j.jsb.2007.10.014. Epub Nov. 1, 2007. |
Muzyczka et al., Adeno-associated virus (AAV) vectors: will they work? J Clin Invest. Oct. 1994;94(4):1351. doi: 10.1172/JCI117468. |
Myerowitz et al., The major defect in Ashkenazi Jews with Tay-Sachs disease is an insertion in the gene for the alpha-chain of beta-hexosaminidase. J Biol Chem. Dec. 15, 1988;263(35):18587-9. |
Myers et al., Insulin signal transduction and the IRS proteins. Annu Rev Pharmacol Toxicol. 1996;36:615-58. doi: 10.1146/annurev.pa.36.040196.003151. |
Nabel et al., Direct gene transfer for immunotherapy and immunization. Trends Biotechnol. May 1993;11(5):211-5. doi: 10.1016/0167-7799(93)90117-R. |
Nahar et al., A G-quadruplex motif at the 3' end of sgRNAs improves CRISPR-Cas9 based genome 40editing efficiency. Chem Commun (Camb). Mar. 7, 2018;54(19):2377-2380. doi: 10.1039/c7cc08893k. Epub Feb. 16, 2018. |
Nakade et al., Microhomology-mediated end-joining-dependent integration of donor DNA in cells and animals using TALENs and CRISPR/Cas9. Nat Commun. Nov. 20, 2014;5:5560. doi: 10.1038/ncomms6560. |
Nakamura et al., Codon usage tabulated from international DNA sequence databases: status for the year 2000. Nucleic Acids Res. Jan. 1, 2000;28(1):292. doi: 10.1093/nar/28.1.292. |
Naorem et al., DGR mutagenic transposition occurs via hypermutagenic reverse transcription primed by nicked template RNA. Proc Natl Acad Sci U S A. Nov. 21, 2017;114(47):E10187-E10195. doi: 10.1073/pnas.1715952114. Epub Nov. 6, 2017. |
Nern et al., Multiple new site-specific recombinases for use in manipulating animal genomes. Proc Natl Acad Sci U SA . Aug. 23, 2011;108(34):14198-203. doi: 10.1073/pnas.1111704108. Epub Aug. 9, 2011. |
Nguyen et al., Evolutionary drivers of thermoadaptation in enzyme catalysis. Science. Jan. 20, 2017;355(6322):289-294. doi: 10.1126/science.aah3717. Epub Dec. 22, 2016. |
Nguyen et al., IQ-TREE: a fast and effective stochastic algorithm for estimating maximumlikelihood phylogenies. Mol Biol Evol. Jan. 2015;32(1):268-74. doi: 10.1093/molbev/msu300. Epub Nov. 3, 2014. |
Nishimasu et al., Engineered CRISPR-Cas9 nuclease with expanded targeting space. Science. Sep. 21, 2018;361(6408):1259-1262. doi: 10.1126/science.aas9129. Epub Aug. 30, 2018. |
Nottingham et al., RNA-seq of human reference RNA samples using a thermostable group II intron reverse transcriptase. RNA. Apr. 2016;22(4):597-613. doi: 10.1261/ma.055558.115. Epub Jan. 29, 2016. |
Nowak et al., Characterization of single-stranded DNA-binding proteins from the psychrophilic bacteria Desulfotalea psychrophila, Flavobacterium psychrophilum, Psychrobacter arcticus, Psychrobacter cryohalolentis, Psychromonas ingrahamii, Psychroflexus torquis, and Photobacterium profundum. BMC Microbiol. Apr. 14, 2014;14:91. doi: 10.1186/1471-2180-14-91. |
Nowak et al., Structural analysis of monomeric retroviral reverse transcriptase in complex with an RNA/DNA hybrid. Nucleic Acids Res. Apr. 1, 2013 ;41(6):3874-87. doi: 10.1093/nar/gkt053. Epub Feb. 4, 2013. |
Nyerges et al., A highly precise and portable genome engineering method allows comparison of mutational effects across bacterial species. Proc Natl Acad Sci U S A. Mar. 1, 2016;113(9):2502-7. doi: 10.1073/pnas.l520040113. Epub Feb. 16, 2016. |
Oakes et al., CRISPR-Cas9 Circular Permutants as Programmable Scaffolds for Genome Modification. Cell. Jan. 10, 2019;176(1-2):254-267.e1l6. doi: 10.1016/j.cell.2018.11.052. |
Oakes et al., Profiling of engineering hotspots identifies an allosteric CRISPR-Cas9 switch. Nat Biotechnol. Jun. 2016;34(6):646-51. doi: 10.1038/nbt.3528. Epub May 2, 2016. |
Odsbu et al., Specific N-terminal interactions of the Escherichia coli SeqA protein are required to form multimers that restrain negative supercoils and form foci. Genes Cells. Nov. 2005;10(11):1039-49. |
Oeemig et al., Solution structure of DnaE intein from Nostoc punctiforme: structural basis for the design of a new split intein suitable for site-specific chemical modification. FEBS Lett. May 6, 2009;583(9):1451-6. |
Oh et al., Positional cloning of a gene for Hermansky-Pudlak syndrome, a disorder of cytoplasmic organelles. Nat Genet. Nov. 1996;14(3):300-6. doi: 10.1038/ng1196-300. |
Ohe et al., Purification and properties of xanthine dehydrogenase from Streptomyces cyanogenus. J Biochem. Jul. 1979;86(1):45-53. |
Olorunniji et al., Purification and In Vitro Characterization of Zinc Finger Recombinases. Methods Mol Biol. 2017;1642:229-245. doi: 10.1007/978-1-4939-7169-5_15. |
Olorunniji et al., Site-specific recombinases: molecular machines for the Genetic Revolution. Biochem J. Mar. 15, 2016;473(6):673-84. doi: 10.1042/BJ20151112. |
O'Maille et al., Structure-based combinatorial protein engineering (Scope). J Mol Biol. Aug. 23, 2002;321(4):677-91. |
Orlando et al., Zinc-finger nuclease-driven targeted integration into mammalian genomes using donors with limited chromosomal homology. Nucleic Acids Res. Aug. 2010;38(15):e152. doi: 10.1093/nar/gkq512. Epub Jun. 8, 2010. |
Orthwein et al., A mechanism for the suppression of homologous recombination in G1 cells. Nature. Dec. 17, 2015;528(7582):422-6. doi: 10.1038/nature16142. Epub Dec. 9, 2015. |
Ortiz-Urda et al., Stable nonviral genetic correction of inherited human skin disease. Nat Med. Oct. 2002;8(10):1166-70. doi: 10.1038/nm766. Epub Sep. 16, 2002. Erratum in: Nat Med. Feb. 2003;9(2):237. |
Osborn et al., Base Editor Correction of COL7A1 in Recessive Dystrophic Epidermolysis Bullosa Patient-Derived Fibroblasts and iPSCs. J Invest Dermatol. Feb. 2020;140(2):338-347.e5. doi: 10.1016/j.jid.2019.07.701. Epub Aug. 19, 2019. |
Ostermeier et al., A combinatorial approach to hybrid enzymes independent of DNA homology. Nat Biotechnol. Dec. 1999;17(12):1205-9. |
Ostertag et al., Biology of mammalian L1 retrotransposons. Annu Rev Genet. 2001;35:501-38. doi: 10.1146/annurev.genet.35.102401.091032. |
Otomo et al., Improved segmental isotope labeling of proteins and application to a larger protein. J Biomol NMR. Jun. 1999;14(2):105-14. doi: 10.1023/a:1008308128050. |
Otomo et al., NMR observation of selected segments in a larger protein: central-segment isotope labeling through intein-mediated ligation. Biochemistry. Dec. 7, 1999;38(49):16040-4. doi: 10.1021/bi991902j. |
Otto et al., The probability of fixation in populations of changing size. Genetics. Jun. 1997;146(2):723-33. |
Packer et al., Methods for the directed evolution of proteins. Nat Rev Genet. Jul. 2015;16(7):379-94. doi: 10.1038/nrg3927. Epub Jun. 9, 2015. |
Packer et al., Phage-assisted continuous evolution of proteases with altered substrate specificity. Nat Commun. Oct. 16, 2017;8(1):956. doi: 10.1038/s41467-017-01055-9. |
Paige et al., RNA mimics of green fluorescent protein. Science. Jul. 29, 2011;333(6042):642-6. doi: 10.1126/science.1207339. |
Paiva et al., Targeted protein degradation: elements of PROTAC design. Curr Opin Chem Biol. Jun. 2019;50:111-119. doi: 10.1016/j.cbpa.2019.02.022. Epub Apr. 17, 2019. |
Paquet et al., Efficient introduction of specific homozygous and heterozygous mutations using CRISPR/Cas9. Nature. May 5, 2016;533(7601):125-9. doi: 10.1038/nature17664. Epub Apr. 27, 2016. |
Park et al., Digenome-seq web tool for profiling CRISPR specificity. Nat Methods. May 30, 2017;14(6):548-549. doi: 10.1038/nmeth.4262. |
Park et al., Sendai virus, an RNA virus with No. risk of genomic integration, delivers CRISPR/Cas9 for efficient gene editing. Mol Ther Methods Clin Dev. Aug. 24, 2016;3:16057. doi: 10.1038/mtm.2016.57. |
Patel et al., Flap endonucleases pass 5′-flaps through a flexible arch using a disorder-thread-order mechanism to confer specificity for free 5′-ends. Nucleic Acids Res. May 2012;40(10):4507-19. doi: 10.1093/nar/gks051. Epub Feb. 8, 2012. |
Pawson et al., Protein phosphorylation in signaling—50 years and counting. Trends Biochem Sci. Jun. 2005;30(6):286-90. doi: 10.1016/j.tibs.2005.04.013. |
Pellenz et al., New human chromosomal safe harbor sites for genome engineering with CRISPR/Cas9, TAL effector and homing endonucleases. Aug. 20, 2018. bioRxiv doi: https://doi.org/10.1101/396390. |
Perach et al., Catalytic features of the recombinant reverse transcriptase of bovine leukemia virus expressed in bacteria. Virology. Jun. 20, 1999;259(1):176-89. doi: 10.1006/viro.1999.9761. |
Perler et al., Protein splicing and autoproteolysis mechanisms. Curr Opin Chem Biol. Oct. 1997;1(3):292-9. doi: 10.1016/s1367-5931(97)80065-8. |
Perler et al., Protein splicing elements: inteins and exteins—a definition of terms and recommended nomenclature. Nucleic Acids Res. Apr. 11, 1994;22(7):1125-7. doi: 10.1093/nar/22.7.1125. |
Perler, InBase, the New England Biolabs Intein Database. Nucleic Acids Res. Jan. 1, 1999;27(1):346-7. doi: 10.1093/nar/27.1.346. |
Perler, Protein splicing of inteins and hedgehog autoproteolysis: structure, function, and evolution. Cell. Jan. 9, 1998;92(1):1-4. doi: 10.1016/s0092-8674(00)80892-2. |
Petersen-Mahrt et al., AID mutates E. coli suggesting a DNA deamination mechanism for antibody diversification. Nature. Jul. 4, 2002;418(6893):99-103. |
Peyrottes et al., Oligodeoxynucleoside phosphoramidates (P-NH2): synthesis and thermal stability of duplexes with DNA and RNA targets. Nucleic Acids Res. May 15, 1996;24(10):1841-8. |
Pfeiffer et al., Mechanisms of DNA double-strand break repair and their potential to induce chromosomal aberrations. Mutagenesis. Jul. 2000;15(4):289-302. doi: 10.1093/mutage/15.4.289. |
Pickart et al., Ubiquitin: structures, functions, mechanisms. Biochim Biophys Acta. Nov. 29, 2004;1695(1-3):55-72. doi: 10.1016/j.bbamcr.2004.09.019. |
Pinkert et al., An albumin enhancer located 10 kb upstream functions along with its promoter to direct efficient, liver-specific expression in transgenic mice. Genes Dev. May 1987;1(3):268-76. doi: 10.1101/gad.1.3.268. |
Pirakitikulr et al., PCRless library mutagenesis via oligonucleotide recombination in yeast. Protein Sci. Dec. 2010;19(12):2336-46. doi: 10.1002/pro.513. |
Popp et al., Sortagging: a versatile method for protein labeling. Nat Chem Biol. Nov. 2007;3(11):707-8. doi: 10.1038/nchembio.2007.31. Epub Sep. 23, 2007. |
Posnick et al., Imbalanced base excision repair increases spontaneous mutation and alkylation sensitivity in Escherichia coli. J Bacteriol. Nov. 1999;181(21):6763-71. |
Prasad et al., Rev1 is a base excision repair enzyme with 5′-deoxyribose phosphate lyase activity. Nucleic Acids Res. Dec. 15, 2016;44(22):10824-10833. doi: 10.1093/nar/gkw869. Epub Sep. 28, 2016. |
Pruschy et al., Mechanistic studies of a signaling pathway activated by the organic dimerizer FK1012. Chem Biol. Nov. 1994;1(3):163-72. doi: 10.1016/1074-5521(94)90006-x. |
Pu et al., Evolution of a split RNA polymerase as a versatile biosensor platform. Nat Chem Biol. Apr. 2017;13(4):432-438. doi: 10.1038/nchembio.2299. Epub Feb. 13, 2017. |
Qu et al., Global mapping of binding sites for phic31 integrase in transgenic maden-darby bovine kidney cells using ChIP-seq. Hereditas. Jan. 14, 2019;156:3. doi: 10.1186/s41065-018-0079-z. |
Queen et al., Immunoglobulin gene transcription is activated by downstream sequence elements. Cell. Jul. 1983;33(3):741-8. doi: 10.1016/0092-8674(83)90016-8. |
Radany et al., Increased spontaneous mutation frequency in human cells expressing the phage PBS2-encoded inhibitor of uracil-DNA glycosylase. Mutat Res. Sep. 15, 2000;461(1):41-5 8. doi: 10.1016/s0921-8777(00)00040-9. |
Raina et al., PROTAC-induced BET protein degradation as a therapy for castration-resistant prostate cancer. Proc Natl Acad Sci U S A. Jun. 28, 2016;113(26):7124-9. doi: 10.1073/pnas.1521738113. Epub Jun. 6, 2016. |
Ramamurthy et al., Identification of immunogenic B-cell epitope peptides of rubella virus E1 glycoprotein towards development of highly specific immunoassays and/or vaccine. Conference Abstract. 2019. |
Ranzau et al., Genome, Epigenome, and Transcriptome Editing via Chemical Modification of Nucleobases in Living Cells. Biochemistry. Feb. 5, 2019;58(5):330-335. doi: 10.1021/acs.biochem.8b00958. Epub Dec. 12, 2018. |
Rashel et al., A novel site-specific recombination system derived from bacteriophage phiMR11. Biochem Biophys Res Commun. Apr. 4, 2008;368(2):192-8. doi: 10.1016/j.bbrc.2008.01.045. Epub Jan. 22, 2008. |
Rasila et al., Critical evaluation of random mutagenesis by error-prone polymerase chain reaction protocols, Escherichia coli mutator strain, and hydroxylamine treatment. Anal Biochem. May 1, 2009;388(1):71-80. doi: 10.1016/j.ab.2009.02.008. Epub Feb. 10, 2009. |
Raskin et al., Substitution of a single bacteriophage T3 residue in bacteriophage T7 RNA polymerase at position 748 results in a switch in promoter specificity. J Mol Biol. Nov. 20, 1992;228(2):506-15. |
Raskin et al., T7 RNA polymerase mutants with altered promoter specificities. Proc Natl Acad Sci U S A. Apr. 15, 1993;90(8):3147-51. |
Rauch et al., Programmable RNA Binding Proteins for Imaging and Therapeutics. Biochemistry. Jan. 30, 2018;57(4):363-364. doi: 10.1021/acs.biochem.7b01101. Epub Nov. 17, 2017. |
Ray et al., A compendium of RNA-binding motifs for decoding gene regulation. Nature. Jul. 11, 2013;499(7457):172-7. doi: 10.1038/nature12311. |
Rebar et al., Phage display methods for selecting zinc finger proteins with novel DNA-binding specificities. Methods Enzymol. 1996;267:129-49. |
Rees et al., Analysis and minimization of cellular RNA editing by DNA adenine base editors. Sci Adv. May 8, 2019;5(5):eaax5717. doi: 10.1126/sciadv.aax5717. |
Rees et al., Base editing: precision chemistry on the genome and transcriptome of living cells. Nat Rev Genet. Dec. 2018;19(12):770-788. doi: 10.1038/s41576-018-0059-1. |
Rees et al., Development of hRad51-Cas9 nickase fusions that mediate HDR without double-stranded breaks. Nat Commun. May 17, 2019;10(1):2212. doi: 10.1038/s41467-019-09983-4. |
Remy et al., Gene transfer with a series of lipophilic DNA-binding molecules. Bioconjug Chem. Nov.-Dec. 1994;5(6):647-54. doi: 10.1021/bc00030a021. |
Ribeiro et al., Protein Engineering Strategies to Expand CRISPR-Cas9 Applications. Int J Genomics. Aug. 2, 2018;2018:1652567. doi: 10.1155/2018/1652567. |
Ringrose et al., The Kw recombinase, an integrase from Kluyveromyces waltii. Eur J Biochem. Sep. 15, 1997;248(3):903-12. doi: 10.1111/j.1432-1033.1997.00903.x. |
Risso et al., Hyperstability and substrate promiscuity in laboratory resurrections of Precambrian ?-lactamases. J Am Chem Soc. Feb. 27, 2013;135(8):2899-902. doi: 10.1021/ja311630a. Epub Feb. 14, 2013. |
Ritchie et al., limma powers differential expression analyses for RNA-sequencing and microarray studies. Nucleic Acids Res. Apr. 20, 2015;43(7):e47. doi: 10.1093/nar/gkv007. Epub Jan. 20, 2015. |
Robertson et al.,DNA repair in mammalian cells: Base excision repair: the long and short of it. Cell Mol Life Sci. Mar. 2009;66(6):981-93. doi: 10.1007/s00018-009-8736-z. |
Robinson et al., The protein tyrosine kinase family of the human genome. Oncogene. Nov. 20, 2000;19(49):5548-57. doi: 10.1038/sj.onc.1203957. |
Roth et al., A widespread self-cleaving ribozyme class is revealed by bioinformatics. Nat Chem Biol. Jan. 2014;10(1):56-60. doi: 10.1038/nchembio.l386. Epub Nov. 17, 2013. |
Roth et al., Purification and characterization of murine retroviral reverse transcriptase expressed in Escherichia coli. J Biol Chem. Aug. 5, 1985;260(16):9326-35. |
Rouet et al., Expression of a site-specific endonuclease stimulates homologous recombination in mammalian cells. Proc Natl Acad Sci U S A. Jun. 21, 1994;91(13):6064-8. doi: 10.1073/pnas.91.13.6064. |
Rouet et al., Introduction of double-strand breaks into the genome of mouse cells by expression of a rare-cutting endonuclease. Mol Cell Biol. Dec. 1994;14(12):8096-106. doi: 10.1128/mcb. 14.12.8096. |
Rouet et al., Receptor-Mediated Delivery of CRISPR-Cas9 Endonuclease for Cell-Type-Specific Gene Editing. J Am Chem Soc. May 30, 2018;140(21):6596-6603. doi: 10.1021/jacs.8b01551. Epub May 18, 2018. |
Roundtree et al.,YTHDCl mediates nuclear export of N6-methyladenosine methylated mRNAs. Elife. Oct. 6, 2017;6:e31311. doi: 10.7554/eLife.31311. |
Rowland et al., Sin recombinase from Staphylococcus aureus: synaptic complex architecture and transposon targeting. Mol Microbiol. May 2002;44(3):607-19. doi: 10.1046/j.1365-2958.2002.02897.x. |
Rowley, Chromosome translocations: dangerous liaisons revisited. Nat Rev Cancer. Dec. 2001;1(3):245-50. doi: 10.1038/35106108. |
Rubio et al., An adenosine-to-inosine tRNA-editing enzyme that can perform C-to-U deamination of DNA. Proc Natl Acad Sci U S A. May 8, 2007;104(19):7821-6. doi: 10.1073/pnas.0702394104. Epub May 1, 2007. PMID: 17483465; PMCID: PMC1876531. |
Rubio et al., Transfer RNA travels from the cytoplasm to organelles. Wiley Interdiscip Rev RNA. Nov.-Dec. 2011;2(6):802-17. doi: 10.1002/wrna.93. Epub Jul. 11, 2011. |
Rüfer et al., Non-contact positions impose site selectivity on Cre recombinase. Nucleic Acids Res. Jul. 1, 2002;30(13):2764-71. doi: 10.1093/nar/gkf399. |
Rutherford et al., Attachment site recognition and regulation of directionality by the serine integrases. Nucleic Acids Res. Sep. 2013;41(17):8341-56. doi: 10.1093/nar/gkt580. Epub Jul. 2, 2013. |
Ryu et al., Adenine base editing in mouse embryos and an adult mouse model of Duchenne muscular dystrophy. Nat Biotechnol. Jul. 2018;36(6):536-539. doi: 10.1038/nbt.4148. Epub Apr. 27, 2018. |
Sadowski, The Flp recombinase of the 2-microns plasmid of Saccharomyces cerevisiae. Prog Nucleic Acid Res Mol Biol. 1995;51:53-91. |
Sakuma et al., MMEJ-assisted gene knock-in using TALENs and CRISPR-Cas9 with the PITCh systems. Nat Protoc. Jan. 2016;11(1):118-33. doi: 10.1038/nprot.2015.140. Epub Dec. 17, 2015. |
Sale et al., Y-family DNA polymerases and their role in tolerance of cellular DNA damage. Nat Rev Mol Cell Biol. Feb. 23, 2012;13(3):141-52. doi: 10.1038/nrm3289. |
Samulski et al., Helper-free stocks of recombinant adeno-associated viruses: normal integration does not require viral gene expression. J Virol. Sep. 1989;63(9):3822-8. doi: 10.1128/JVI.63.9.3822-3828.1989. |
Sang et al., A unique uracil-DNA binding protein of the uracil DNA glycosylase superfamily. Nucleic Acids Res. Sep. 30, 2015;43(17):8452-63. doi: 10.1093/nar/gkv854. Epub Aug. 24, 2015. |
Santoro et al., Directed evolution of the site specificity of Cre recombinase. Proc Natl Acad Sci U S A. Apr. 2, 2002;99(7):4185-90. Epub Mar. 19, 2002. |
Saparbaev et al., Excision of hypoxanthine from DNA containing dIMP residues by the Escherichia coli, yeast, rat, and human alkylpurine DNA glycosylases. Proc Natl Acad Sci U S A. Jun. 21, 1994;91(13):5873-7. doi: 10.1073/pnas.91.13.5873. |
Sarkar et al., HIV-1 pro viral DNA excision using an evolved recombinase. Science. Jun. 29, 2007;316(5833):1912-5. doi: 10.1126/science. 1141453. |
Satomura et al., Precise genome-wide base editing by the CRISPR Nickase system in yeast. Sci Rep. May 18, 2017;7(1):2095. doi: 10.1038/s41598-017-02013-7. |
Sauer et al., DNA recombination with a heterospecific Cre homolog identified from comparison of the pac-c1 regions of P1-related phages. Nucleic Acids Res. Nov. 18, 2004;32(20):6086-95. doi: 10.1093/nar/gkh941. |
Savic et al., Covalent linkage of the DNA repair template to the CRISPR-Cas9 nuclease enhances homology-directed repair. Elife. May 29, 2018;7:e33761. doi: 10.7554/eLife.33761. |
Saville et al., A site-specific self-cleavage reaction performed by a novel RNA in Neurospora mitochondria. Cell. May 18, 1990;61(4):685-96. doi: 10.1016/0092-8674(90)90480-3. |
Savva et al., The structural basis of specific base-excision repair by uracil-DNA glycosylase. Nature. Feb. 9, 1995;373(6514):487-93. doi: 10.1038/373487a0. |
Schaaper et al., Base selection, proofreading, and mismatch repair during DNA replication in Escherichia coli. J Biol Chem. Nov. 15, 1993;268(32):23762-5. |
Schaaper et al., Spectra of spontaneous mutations in Escherichia coli strains defective in mismatch correction: the nature of in vivo DNA replication errors. Proc Natl Acad Sci U S A. Sep. 1987;84(17):6220-4. |
Schaefer et al., Understanding RNA modifications: the promises and technological bottlenecks of the ‘epitranscriptome’. Open Biol. May 2017;7(5):170077. doi: 10.1098/rsob. 170077. |
Schechner et al., Multiplexable, locus-specific targeting of long RNAs with CRISPR-Display. Nat Methods. Jul. 2015;12(7):664-70. doi: 10.1038/nmeth.3433. Epub Jun. 1, 2015. Author manuscript entitled CRISPR Display: A modular method for locus-specific targeting of long noncoding RNAs and synthetic RNA devices in vivo. |
Schek et al., Definition of the upstream efficiency element of the simian virus 40 late polyadenylation signal by using in vitro analyses. Mol Cell Biol. Dec. 1992;12(12):5386-93. doi: 10.1128/mcb.12.12.5386. |
Schenk et al., MPDU1 mutations underlie a novel human congenital disorder of glycosylation, designated type If. J Clin Invest. Dec. 2001;108(11):1687-95. doi: 10.1172/JCI13419. |
Schmitz et al., Behavioral abnormalities in prion protein knockout mice and the potential relevance of PrP(C) for the cytoskeleton. Prion. 2014;8(6):381-6. doi: 10.4161/19336896.2014.983746. |
Schöller et al., Interactions, localization, and phosphorylation of the m6A generating METTL3-METTL14-WTAP complex. RNA. Apr. 2018;24(4):499-512. doi: 10.1261/rna.064063.117. Epub Jan. 18, 2018. |
Schultz et al., Expression and secretion in yeast of a 400-kDa envelope glycoprotein derived from Epstein-Barr virus. Gene. 1987;54(1):113-23. doi: 10.1016/0378-1119(87)90353-2. |
Schultz et al., Oligoo-2′-fluoro-2′-deoxynucleotide N3′—>P5′ phosphoramidates: synthesis and properties. Nucleic Acids Res. Aug. 1, 1996;24(15):2966-73. |
Scott et al., Production of cyclic peptides and proteins in vivo. Proc Natl Acad Sci U S A. Nov. 23, 1999;96(24):13638-43. doi: 10.1073/pnas.96.24.13638. |
Sebastín-Martín et al., Transcriptional inaccuracy threshold attenuates differences in RNA-dependent DNA synthesis fidelity between retroviral reverse transcriptases. Sci Rep. Jan. 12, 2018;8(1):627. doi: 10.1038/s41598-017-18974-8. |
Seed, An LFA-3 cDNA encodes a phospholipid-linked membrane protein homologous to its receptor CD2. Nature. Oct. 29-Nov 4, 1987;329(6142):840-2. doi: 10.1038/329840a0. |
Serrano-Heras et al., Protein p56 from the Bacillus subtilis phage phi29 inhibits DNA-binding ability of uracil-DNA glycosylase. Nucleic Acids Res. 2007;35(16):5393-401. Epub Aug. 13, 2007. |
Setten et al., The current state and future directions of RNAi-based therapeutics. Nat Rev Drug Discov. Jun. 2019;18(6):421-446. doi: 10.1038/s41573-019-0017-4. |
Severinov et al., Expressed protein ligation, a novel method for studying protein-protein interactions in transcription. J Biol Chem. Jun. 26, 1998;273(26):16205-9. doi: 10.1074/jbc.273.26.16205. |
Sha et al., Monobodies and other synthetic binding proteins for expanding protein science. Protein Sci. May 2017;26(5):910-924. doi: 10.1002/pro.3148. Epub Mar. 24, 2017. |
Shah et al., Protospacer recognition motifs: mixed identities and functional diversity. RNA Biol. May 2013;10(5):891-9. doi: 10.4161/rna.23764. Epub Feb. 12, 2013. |
Shalem et al., High-throughput functional genomics using CRISPR-Cas9. Nat Rev Genet. May 2015;16(5):299-311. doi: 10.1038/nrg3899. Epub Apr. 9, 2015. |
Sharer et al., The ARF-like 2 (ARL2)-binding protein, BART. Purification, cloning, and initial characterization. J Biol Chem. Sep. 24, 1999;274(39):27553-61. doi: 10.1074/jbc.274.39.27553. |
Sharon et al., Functional Genetic Variants Revealed by Massively Parallel Precise Genome Editing. Cell. Oct. 4, 2018;175(2):544-557.el6. doi: 10.1016/j.cell.2018.08.057. Epub Sep. 20, 2018. |
Shaw et al., Implications of human genome architecture for rearrangement-based disorders: the genomic basis of disease. Hum Mol Genet. Apr. 1, 2004 ;13 Spec No. 1:R57-64. doi: 10.1093/hmg/ddh073. Epub Feb. 5, 2004. |
Shen et al., Predictable and precise template-free CRISPR editing of pathogenic variants. Nature. Nov. 2018;563(7733):646-651. doi: 10.1038/s41586-018-0686-x. Epub Nov. 7, 2018. |
Shen, Data processing, Modeling and Analysis scripts for CRISPR-inDelphi. GitHub—maxwshen/indelphi-dataprocessinganalysis at 6b68e3cec73c9358fef6e5f178a935f3c2a4118f. Apr. 10, 2018. Retrieved online via https://github.com/maxwshen/indelphi-sataprocessinganalysis/tree/6b68e3cec73c9358fef6e5f178a935f3c2a4118f Last retrieved on Jul. 26, 2021. 2 pages. |
Sherwood et al., Discovery of directional and nondirectional pioneer transcription factors by modeling DNase profile magnitude and shape. Nat Biotechnol. Feb. 2014;32(2):171-178. doi: 10.1038/nbt.2798. Epub Jan. 19, 2014. |
Shi et al., Structural basis for targeted DNA cytosine deamination and mutagenesis by APOBEC3A and APOBEC3B. Nat Struct Mol Biol. Feb. 2017;24(2):131-139. doi: 10.1038/nsmb.3344. Epub Dec. 19, 2016. |
Shi et al., YTHDF3 facilitates translation and decay of N6-methyladenosine-modified RNA. Cell Res. Mar. 2017;27(3):315-328. doi: 10.1038/cr.2017.15. Epub Jan. 20, 2017. |
Shin et al., CRISPR/Cas9 targeting events cause complex deletions and insertions at 17 sites in the mouse genome. Nat Commun. May 31, 2017;8:15464. doi: 10.1038/ncomms15464. |
Shindo et al., A Comparison of Two Single-Stranded DNA Binding Models by Mutational Analysis of APOBEC3G. Biology (Basel). Aug. 2, 2012;1(2):260-76. doi: 10.3390/biology1020260. |
Shingledecker et al., Molecular dissection of the Mycobacterium tuberculosis RecA intein: design of a minimal intein and of a trans-splicing system involving two intein fragments. Gene. Jan. 30, 1998;207(2):187-95. doi: 10.1016/s0378-1119(97)00624-0. |
Shmakov et al., Diversity and evolution of class 2 CRISPR-Cas systems. Nat Rev Microbiol. Mar. 2017;15(3):169-182. doi: 10.1038/nrmicro.2016.184. Epub Jan. 23, 2017. |
Shultz et al., A genome-wide analysis of FRT-like sequences in the human genome. PLoS One. Mar. 23, 2011;6(3):e18077. doi: 10.1371/journal.pone.0018077. |
Silas et al., Direct CRISPR spacer acquisition from RNA by a natural reverse transcriptase-Cas1 fusion protein. Science. Feb. 26, 2016;351(6276):aad4234. doi: 10.1126/science.aad4234. |
Silva et al., Selective disruption of the DNA polymerase III α-β complex by the umuD gene products. Nucleic Acids Res. Jul. 2012;40(12):5511-22. doi: 10.1093/nar/gks229. Epub Mar. 9, 2012. |
Singh et al., Cross-talk between diverse serine integrases. J Mol Biol. Jan. 23, 2014;426(2):318-31. doi: 10.1016/j.jmb.2013.10.013. Epub Oct. 22, 2013. |
Singh et al., Real-time observation of DNA recognition and rejection by the RNA-guided endonuclease Cas9. Nat Commun. Sep. 14, 2016;7:12778. doi: 10.1038/ncomms12778. |
Sivalingam et al., Biosafety assessment of site-directed transgene integration in human umbilical cord-lining cells. Mol Ther. Jul. 2010;18(7):1346-56. doi: 10.1038/mt.2010.61. Epub Apr. 27, 2010. |
Sledz et al., Structural insights into the molecular mechanism of the m(6)A writer complex. Elife. Sep. 14, 2016;5:e18434. doi: 10.7554/eLife.18434. |
Slupphaug et al., A nucleotide-flipping mechanism from the structure of human uracil-DNA glycosylase bound to DNA. Nature. Nov. 7, 1996;384(6604):87-92. doi: 10.1038/384087a0. |
Smargon et al., Cas 13b is a Type VLB CRISPR-Associated RNA-Guided RNase Differentially Regulated by Accessory Proteins Csx27 and Csx28. Mol Cell. Feb. 16, 2017;65(4):618-630.e7. doi: 10.1016/j.molcel.2016.12.023. Epub Jan. 5, 2017. |
Smith et al., Production of human beta interferon in insect cells infected with a baculovirus expression vector. Mol Cell Biol. Dec. 1983;3(12):2156-65. doi: 10.1128/mcb.3.12.2156. |
Smith et al., Single-step purification of polypeptides expressed in Escherichia coli as fusions with glutathione S-transferase. Gene. Jul. 15, 1988;67(1):31-40. doi: 10.1016/0378-1119(88)90005-4. |
Smith, Phage-encoded Serine Integrases and Other Large Serine Recombinases. Microbiol Spectr. Aug. 2015;3(4). doi: 10.1128/microbiolspec.MDNA3-0059-2014. |
Sommerfelt et al., Receptor interference groups of 20 retroviruses plating on human cells. Virology. May 1990;176(1):58-69. doi: 10.1016/0042-6822(90)90230-o. |
Song et al., Adenine base editing in an adult mouse model of tyrosinaemia. Nat Biomed Eng. Jan. 2020;4(1):125-130. doi: 10.1038/s41551-019-0357-8. Epub Feb. 25, 2019. |
Southworth et al., Control of protein splicing by intein fragment reassembly. EMBO J. Feb. 16, 1998;17(4):918-26. doi: 10.1093/emboj/17.4.918. |
Southworth et al., Purification of proteins fused to either the amino or carboxy terminus of the Mycobacterium xenopi gyrase A intein. Biotechniques. Jul. 1999;27(1):110-4, 116, 118-20. doi: 10.2144/99271st04. |
Spencer et al., A general strategy for producing conditional alleles of Src-like tyrosine kinases. Proc Natl Acad Sci U S A. Oct. 10, 1995;92(21):9805-9. doi: 10.1073/pnas.92.21.9805. |
Spencer et al., Controlling signal transduction with synthetic ligands. Science. Nov. 12, 1993;262(5136):1019-24. doi: 10.1126/science.7694365. |
Spencer et al., Functional analysis of Fas signaling in vivo using synthetic inducers of dimerization. Curr Biol. Jul. 1, 1996;6(7):839-47. doi: 10.1016/s0960-9822(02)00607-3. |
Srivastava et al., An inhibitor of nonhomologous end-joining abrogates double-strand break repair and impedes cancer progression. Cell. Dec. 21, 2012;151(7):1474-87. doi: 10.1016/j.cell.2012.1 1.054. |
Stadtman, Selenocysteine. Annu Rev Biochem. 1996;65:83-100. |
Stamos et al., Structure of a Thermostable Group II Intron Reverse Transcriptase with Template-Primer and Its Functional and Evolutionary Implications. Mol Cell. Dec. 7, 2017;68(5):926-939.e4. doi: 10.1016/j.molcel.2017.10.024. Epub Nov. 16, 2017. |
Steele et al., The prion protein knockout mouse: a phenotype under challenge. Prion. Apr.-Jun. 2007;1(2):83-93. doi: 10.4161/pri.1.2.4346. Epub Apr. 25, 2007. |
Stella et al., Structure of the Cpf1 endonuclease R-loop complex after target DNA cleavage. Nature. Jun. 22, 2017;546(7659):559-563. doi: 10.1038/nature22398. Epub May 31, 2017. |
Stenson et al., The Human Gene Mutation Database: towards a comprehensive repository of inherited mutation data for medical research, genetic diagnosis and next-generation sequencing studies. Hum Genet. Jun. 2017;136(6):665-677. doi: 10.1007/s00439-017-1779-6. Epub Mar. 27, 2017. |
Sternberg et al., Conformational control of DNA target cleavage by CRISPR-Cas9. Nature. Nov. 5, 2015;527(7576):110-3. doi: 10.1038/nature15544. Epub Oct. 28, 2015. |
Sterne-Weiler et al., Exon identity crisis: disease-causing mutations that disrupt the splicing code. Genome Biol. Jan. 23, 2014;15(1):201. doi: 10.1186/gb4150. |
Stevens et al., A promiscuous split intein with expanded protein engineering applications. Proc Natl Acad Sci U S A. Aug. 8, 2017;114(32):8538-8543. doi: 10.1073/pnas.1701083114. Epub Jul. 24, 2017. |
Stockwell et al., Probing the role of homomeric and heteromeric receptor interactions in TGF-beta signaling using small molecule dimerizers. Curr Biol. Jun. 18, 1998;8(13):761-70. doi: 10.1016/s0960-9822(98)70299-4. |
Strecker et al., RNA-guided DNA insertion with CRISPR-associated transposases. Science. 2019 Jul5;365(6448):48-53. doi: 10.1126/science.aax9181. Epub Jun. 6, 2019. |
Strutt et al., RNA-dependent RNA targeting by CRISPR-Cas9. Elife. Jan. 5, 2018;7:e32724. doi: 10.7554/eLife.32724. |
Su et al., Human DNA polymerase ? has reverse transcriptase activity in cellular environments. J Biol Chem. Apr. 12, 2019;294(15):6073-6081. doi: 10.1074/jbc.RAl 19.007925. Epub Mar. 6, 2019. |
Sudarsan et al., Riboswitches in eubacteria sense the second messenger cyclic di-GMP. Science. Jul. 18, 2008;321(5887):411-3. doi: 10.1126/science.1159519. |
Surun et al., High Efficiency Gene Correction in Hematopoietic Cells by Donor-Template-Free CRISPR/Cas9 Genome Editing. Mol Ther Nucleic Acids. Mar. 2, 2018;10:1-8. doi: 10.1016/j.omtn.2017.11.001. Epub Nov. 10, 2017. |
Suzuki et al., In vivo genome editing via CRISPR/Cas9 mediated homology-independent targeted integration. Nature. Dec. 1, 2016;540(7631):144-149. doi: 10.1038/nature20565. Epub Nov. 16, 2016. |
Suzuki et al., VCre/VloxP and SCre/SloxP: new site-specific recombination systems for genome engineering. Nucleic Acids Res. Apr. 2011;39(8):e49. doi: 10.1093/nar/gkq1280. Epub Feb. 1, 2011. |
Tabebordbar et al., In vivo gene editing in dystrophic mouse muscle and muscle stem cells. Science. Jan. 22, 2016;351(6271):407-411. doi: 10.1126/science.aad5177. Epub Dec. 31, 2015. |
Tahara et al., Potent and Selective Inhibitors of 8-Oxoguanine DNA Glycosylase. J Am Chem Soc. Feb. 14, 2018;140(6):2105-2114. doi: 10.1021/jacs.7b09316. Epub Feb. 5, 2018. |
Tajiri et al., Functional cooperation of MutT, MutM and MutY proteins in preventing mutations caused by spontaneous oxidation of guanine nucleotide in Escherichia coli. Mutat Res. May 1995;336(3):257-67. doi: 10.1016/0921-8777(94)00062-b. |
Takimoto et al., Stereochemical basis for engineered pyrrolysyl-tRNA synthetase and the efficient in vivo incorporation of structurally divergent non-native amino acids. ACS Chem Biol. Jul. 15, 2011;6(7):733-43. doi: 10.1021/cb200057a. Epub May 5, 2011. |
Tanenbaum et al., A protein-tagging system for signal amplification in gene expression and fluorescence imaging. Cell. Oct. 23, 2014;159(3):635-46. doi: 10.1016/j.cell.2014.09.039. Epub Oct. 9, 2014. |
Tanese et al., Expression of enzymatically active reverse transcriptase in Escherichia coli. Proc Natl Acad Sci U S A. Aug. 1985;82(15):4944-8. doi: 10.1073/pnas.82.15.4944. |
Tang et al., Evaluation of Bioinformatic Programmes for the Analysis of Variants within Splice Site Consensus Regions. Adv Bioinformatics. 2016;2016:5614058. doi: 10.1155/2016/5614058. Epub May 24, 2016. |
Tang et al., Rewritable multi-event analog recording in bacterial and mammalian cells. Science. Apr. 13, 2018;360(6385):eaap8992. doi: 10.1126/science.aap8992. Epub Feb. 15, 2018. |
Tassabehji, Williams-Beuren syndrome: a challenge for genotype-phenotype correlations. Hum Mol Genet. Oct. 15, 2003;12 Spec No. 2:R229-37. doi: 10.1093/hmg/ddg299. Epub Sep. 2, 2003. |
Taube et al., Reverse transcriptase of mouse mammary tumour virus: expression in bacteria, purification and biochemical characterization. Biochem J. Feb. 1, 1998;329 ( Pt 3)(Pt 3):579-87. doi: 10.1042/bj3290579. Erratum in: Biochem J Jun. 15, 1998;332(Pt 3):808. |
Tee et al., Polishing the craft of genetic diversity creation in directed evolution. Biotechnol Adv. Dec. 2013;31(8):1707-21. doi: 10.1016/j.biotechadv.2013.08.021. Epub Sep. 6, 2013. |
Telenti et al., The Mycobacterium xenopi GyrA protein splicing element: characterization of a minimal intein. J Bacteriol. Oct. 1997;179(20):6378-82. doi: 10.1128/jb.179.20.6378-6382.1997. |
Telesnitsky et al., RNase H domain mutations affect the interaction between Moloney murine leukemia virus reverse transcriptase and its primer-template. Proc Natl Acad Sci U S A. Feb. 15, 1993;90(4):1276-80. doi: 10.1073/pnas.90.4.1276. |
Thomson et al., Mutational analysis of loxP sites for efficient Cre-mediated insertion into genomic DNA. Genesis. Jul. 2003;36(3):162-7. doi: 10.1002/gene.10211. |
Thuronyi et al., Continuous evolution of base editors with expanded target compatibility and improved activity. Nat Biotechnol. Sep. 2019;37(9):1070-1079. doi: 10.1038/s41587-019-0193-0. Epub Jul. 22, 2019. |
Thyagarajan et al., Creation of engineered human embryonic stem cell lines using phiC31 integrase. Stem Cells. Jan. 2008;26(1):119-26. doi: 10.1634/stemcells.2007-0283. Epub Oct. 25, 2007. |
Tinland et al., The T-DNA-linked VirD2 protein contains two distinct functional nuclear localization signals. Proc Natl Acad Sci U S A. Aug. 15, 1992;89(16):7442-6. doi: 10.1073/pnas.89.16.7442. |
Tom et al., Mechanism whereby proliferating cell nuclear antigen stimulates flap endonuclease 1. J Biol Chem. Apr. 7, 2000;275(14):10498-505. doi: 10.1074/jbc.275.14.10498. |
Toor et al., Crystal structure of a self-spliced group II intron. Science. Apr. 4, 2008;320(5872):77-82. doi: 10.1126/science.1153803. |
Toro et al., On the Origin and Evolutionary Relationships of the Reverse Transcriptases Associated With Type III CRISPR-Cas Systems. Front Microbiol. Jun. 15, 2018;9:1317. doi: 10.3389/fmicb.2018.01317. |
Toro et al., The Reverse Transcriptases Associated with CRISPR-Cas Systems. Sci Rep. Aug. 2, 2017;7(1):7089. doi: 10.1038/s41598-017-07828-y. |
Torres et al., Non-integrative lentivirus drives high-frequency cre-mediated cassette exchange in human cells. PLoS One. 2011;6(5):el9794. doi: 10.1371/journal.pone.0019794. Epub May 23, 2011. |
Townsend et al., Role of HFE in iron metabolism, hereditary haemochromatosis, anaemia of chronic disease, and secondary iron overload. Lancet. Mar. 2, 2002;359(9308):786-90. doi: 10.1016/S0140-6736(02)07885-6. |
Tracewell et al., Directed enzyme evolution: climbing fitness peaks one amino acid at a time. Curr Opin Chem Biol. Feb. 2009;13(1):3-9. doi: 10.1016/j.cbpa.2009.01.017. Epub Feb. 25, 2009. |
Tratschin et al., A human parvovirus, adeno-associated virus, as a eucaryotic vector: transient expression and encapsidation of the procaryotic gene for chloramphenicol acetyltransferase. Mol Cell Biol. Oct. 1984;4(10):2072-81. doi: 10.1128/mcb.4.10.2072. |
Tratschin et al., Adeno-associated virus vector for high-frequency integration, expression, and rescue of genes in mammalian cells. Mol Cell Biol. Nov. 1985;5(11):3251-60. doi: 10.1128/mcb.5.11.3251. |
Traxler et al., A genome-editing strategy to treat ?-hemoglobinopathies that recapitulates a mutation associated with a benign genetic condition. Nat Med. Sep. 2016;22(9):987-90. doi: 10.1038/nm.4170. Epub Aug. 15, 2016. |
Trudeau et al., On the Potential Origins of the High Stability of Reconstructed Ancestral Proteins. Mol Biol Evol. Oct. 2016;33(10):2633-41. doi: 10.1093/molbev/msw138. Epub Jul. 12, 2016. |
Tsai et al., CIRCLE-seq: a highly sensitive in vitro screen for genome-wide CRISPR-Cas9 nuclease off-targets. Nat Methods. Jun. 2017;14(6):607-614. doi: 10.1038/nmeth.4278. Epub May 1, 2017. |
Tsang et al., Specialization of the DNA-cleaving activity of a group I ribozyme through in vitro evolution. J Mol Biol. Sep. 13, 1996;262(1):31-42. doi: 10.1006/jmbi.1996.0496. |
Tsutakawa et al., Human flap endonuclease structures, DNA double-base flipping, and a unified understanding of the FEN1 superfamily. Cell. Apr. 15, 2011;145(2):198-211. doi: 10.1016/j.cell.2011 .03.004. |
Tycko et al., Pairwise library screen systematically interrogates Staphylococcus aureus Cas9 specificity in human cells. bioRxiv. doi: https://doi.org/10.1101/269399 Posted Feb. 22, 2018. |
Uniprot Consortium, UniProt: the universal protein knowledgebase. Nucleic Acids Res. Mar. 16, 2018;46(5):2699. doi: 10.1093/nar/gky092. |
UNIPROTKB Submission; Accession No. F0NH53. May 3, 2011. 4 pages. |
UNIPROTKB Submission; Accession No. P0DOC6. No Author Listed., Oct. 5, 2016. 5 pages. |
UNIPROTKB Submission; Accession No. T0D7A2. Oct. 16, 2013. 10 pages. |
Urasaki et al., Functional dissection of the To12 transposable element identified the minimal cis-sequence and a highly repetitive sequence in the subterminal region essential for transposition. Genetics. Oct. 2006;174(2):639-49. doi: 10.1534/genetics.106.060244. Epub Sep. 7, 2006. |
Van Brunt et al., Genetically Encoded Azide Containing Amino Acid in Mammalian Cells Enables Site-Specific Antibody-Drug Conjugates Using Click Cycloaddition Chemistry. Bioconjug Chem. Nov. 18, 2015;26(11):2249-60. doi: 10.1021/acs.bioconjchem.5b00359. Epub Sep. 11, 2015. |
Van Brunt et al., Molecular Farming: Transgenic Animals as Bioreactors. Biotechnology (N Y). 1988;6(10):1149-1154. doi: 10.1038/nbt1088-1149. |
Van Overbeek et al., DNA Repair Profiling Reveals Nonrandom Outcomes at Cas9-Mediated Breaks. Mol Cell. Aug. 18, 2016;63(4):633-646. doi: 10.1016/j.molcel.2016.06.037. Epub Aug. 4, 2016. |
Van Wijk et al., Identification of 51 novel exons of the Usher syndrome type 2A (USH2A) gene that encode multiple conserved functional domains and that are mutated in patients with Usher syndrome type II. Am J Hum Genet. Apr. 2004;74(4):738-44. doi: 10.1086/383096. Epub Mar. 10, 2004. |
Varga et al., Progressive vascular smooth muscle cell defects in a mouse model of Hutchinson-Gilford progeria syndrome. Proc Natl Acad Sci U S A. Feb. 28, 2006;103(9):3250-5. doi: 10.1073/pnas.0600012103. Epub Feb. 21, 2006. |
Vellore et al., A group II intron-type open reading frame from the thermophile Bacillus (Geobacillus) stearothermophilus encodes a heat-stable reverse transcriptase. Appl Environ Microbiol. Dec. 2004;70(12):7140-7. doi: 10.1128/AEM.70.12.7140-7147.2004. |
Verma, The reverse transcriptase. Biochim Biophys Acta. Mar. 21, 1977;473(1):1-38. doi: 10.1016/0304-419x(77)90005-1. |
Vigne et al., Third-generation adenovectors for gene therapy. Restor Neurol Neurosci. Jan. 1, 1995;8(1):35-6. doi: 10.3233/RNN-1995-81208. |
Vik et al., Endonuclease V cleaves at inosines in RNA. Nat Commun. 2013;4:2271. doi: 10.1038/ncomms3271. |
Vilenchik et al., Endogenous DNA double-strand breaks: production, fidelity of repair, and induction of cancer. Proc Natl Acad Sci U S A. Oct. 28, 2003;100(22):12871-6. doi: 10.1073/pnas.2135498100. Epub Oct. 17, 2003. |
Voigt et al., Rational evolutionary design: the theory of in vitro protein evolution. Adv Protein Chem. 2000;55:79-160. |
Vriend et al., Nick-initiated homologous recombination: Protecting the genome, one strand at a time. DNA Repair (Amst). Feb. 2017;50:1-13. doi: 10.1016/j.dnarep.2016.12.005. Epub Dec. 29, 2016. |
Wang et al., AID upmutants isolated using a high-throughput screen highlight the immunity/cancer balance limiting DNA deaminase activity. Nat Struct Mol Biol. Jul. 2009;16(7):769-76. doi: 10.1038/nsmb.1623. Epub Jun. 21, 2009. |
Wang et al., Continuous directed evolutions of proteins with improved soluble expression. Nature Chemical Biology. Nat Publishing Group. Aug. 20, 2018; 14(10):972-980. |
Wang et al., Evolution of new nonantibody proteins via iterative somatic hypermutation. Proc Natl Acad Sci U S A. Nov. 30, 2004;101(48):16745-9. Epub Nov. 19, 2004. |
Wang et al., Expanding the genetic code. Annu Rev Biophys Biomol Struct. 2006;35:225-49. Review. |
Wang et al., Highly efficient CRISPR/HDR-mediated knock-in for mouse embryonic stem cells and zygotes. Biotechniques. 2015:59,201-2;204;206-8. |
Wang et al., N(6)-methyladenosine Modulates Messenger RNA Translation Efficiency. Cell. Jun. 4, 2015;161(6):1388-99. doi: 10.1016/j.cell.2015.05.014. |
Wang et al., N6-methyladenosine-dependent regulation of messenger RNA stability. Nature. Jan. 2, 2014;505(7481):117-20. doi: 10.1038/nature12730. Epub Nov. 27, 2013. |
Wang et al., Programming cells by multiplex genome engineering and accelerated evolution. Nature. Aug. 13, 2009;460(7257):894-8. Epub Jul. 26, 2009. |
Wang et al., Reading RNA methylation codes through methyl-specific binding proteins. RNA Biol. 2014;ll(6):669-72. doi: 10.4161/rna.28829. Epub Apr. 24, 2014. |
Wang et al., Staphylococcus aureus protein SAUGI acts as a uracil-DNA glycosylase inhibitor. Nucleic Acids Res. Jan. 2014;42(2):1354-64. doi: 10.1093/nar/gkt964. Epub Oct. 22, 2013. |
Wang et al., Structural basis of N(6)-adenosine methylation by the METTL3-METTL14 complex. Nature. Jun. 23, 2016;534(7608):575-8. doi: 10.1038/nature18298. Epub May 25, 2016. |
Watowich, The erythropoietin receptor: molecular structure and hematopoietic signaling pathways. J Investig Med. Oct. 2011;59(7):1067-72. doi: 10.2310/JIM.0b013e31820fb28c. |
Waxman et al., Regulating excitability of peripheral afferents: emerging ion channel targets. Nat Neurosci. Feb. 2014;17(2):153-63. doi: 10.1038/nn.3602. Epub Jan. 28, 2014. |
Weill et al., DNA polymerases in adaptive immunity. Nat Rev Immunol. Apr. 2008;8(4):302-12. doi: 10.1038/nri2281. Epub Mar. 14, 2008. |
Weinert et al., Unbiased detection of CRISPR off-targets in vivo using DISCOVER-Seq. Science. Apr. 19, 2019;364(6437):286-289. doi: 10.1126/science.aav9023. Epub Apr. 18, 2019. |
Wen et al., Inclusion of a universal tetanus toxoid CD4(+) T cell epitope P2 significantly enhanced the immunogenicity of recombinant rotavirus ?VP8* subunit parenteral vaccines. Vaccine. Jul. 31, 2014;32(35):4420-4427. doi: 10.1016/j.vaccine.2014.06.060. Epub Jun. 21, 2014. |
West et al., Gene expression in adeno-associated virus vectors: the effects of chimeric mRNA structure, helper virus, and adenovirus VA1 RNA. Virology. Sep. 1987;160(1):38-47. doi: 10.1016/0042-6822(87)90041-9. |
Wharton et al., A new-specificity mutant of 434 repressor that defines an amino acid-base pair contact. Nature. Apr. 30-May 6, 1987;326(6116):888-91. |
Wharton et al., Changing the binding specificity of a repressor by redesigning an alpha-helix. Nature. Aug. 15-21, 1985;316(6029):601-5. |
Wheeler et al., The thermostability and specificity of ancient proteins. Curr Opin Struct Biol. Jun. 2016;38:37-43. doi: 10.1016/j.sbi.2016.05.015. Epub Jun. 9, 2016. |
Wienert et al., KLF1 drives the expression of fetal hemoglobin in British HPFH. Blood. Aug. 10, 2017;130(6):803-807. doi: 10.1182/blood-2017-02-767400. Epub Jun. 28, 2017. |
Williams et al., Assessing the accuracy of ancestral protein reconstruction methods. PLoS Comput Biol. Jun. 23, 2006;2(6):e69. doi: 10.1371/journal.pcbi.0020069. Epub Jun. 23, 2006. |
Wilson et al., Formation of infectious hybrid virions with gibbon ape leukemia virus and human T-cell leukemia virus retroviral envelope glycoproteins and the gag and pol proteins of Moloney murine leukemia vims. J Virol. May 1989;63(5):2374-8. doi: 10.1128/JVI.63.5.2374-2378.1989. |
Wilson et al., Kinase dynamics. Using ancient protein kinases to unravel a modern cancer drug's mechanism. Science. Feb. 20, 2015;347(6224):882-6. doi: 10.1126/science.aaa1823. |
Winoto et al., A novel, inducible and T cell-specific enhancer located at the 3′ end of the T cell receptor alpha locus. EMBO J. Mar. 1989;8(3):729-33. |
Winter et al., Drug Development. Phthalimide conjugation as a strategy for in vivo target protein degradation. Science. Jun. 19, 2015;348(6241):1376-81. doi:; 10.1126/science.aab1433. Epub May 21, 2015. |
Winter et al., Targeted exon skipping with AAV-mediated split adenine base editors. Cell Discov. Aug. 20, 2019;5:41. doi: 10.1038/s41421-019-0109-7. |
Wold, Replication protein A: a heterotrimeric, single-stranded DNA-binding protein required for eukaryotic DNA metabolism. Annu Rev Biochem. 1997;66:61-92. doi: 10.1146/annurev.biochem.66.1.61. |
Wong et al., A statistical analysis of random mutagenesis methods used for directed protein evolution. J Mol Biol. Jan. 27, 2006;355(4):858-71. Epub Nov. 17, 2005. |
Wong et al., The Diversity Challenge in Directed Protein Evolution. Comb Chem High Throughput Screen. May 2006;9(4):271-88. |
Wood et al., A genetic system yields self-cleaving inteins for bioseparations. Nat Biotechnol. Sep. 1999;17(9):889-92. doi: 10.1038/12879. |
Wright et al., Continuous in vitro evolution of catalytic function. Science. Apr. 25, 1997;276(5312):614-7. |
Wu et al., Human single-stranded DNA binding proteins: guardians of genome stability. Acta Biochim Biophys Sin (Shanghai). Jul. 2016;48(7):671-7. doi: 10.1093/abbs/gmw044. Epub May 23, 2016. |
Wu et al., Protein trans-splicing and functional mini-inteins of a cyanobacterial dnaB intein. Biochim Biophys Acta. Sep. 8, 1998;1387(1-2):422-32. doi: 10.1016/s0167-4838(98)00157-5. |
Wu et al., Protein trans-splicing by a split intein encoded in a split DnaE gene of Synechocystis sp. PCC6803. Proc Natl Acad Sci U S A. Aug. 4, 1998;95(16):9226-31. doi: 10.1073/pnas.95.16.9226. |
Wu et al., Readers, writers and erasers of N6-methylated adenosine modification. Curr Opin Struct Biol. Dec. 2017;47:67-76. doi: 10.1016/j.sbi.2017.05.011. Epub Jun. 16, 2017. |
Xiang et al., RNA m6A methylation regulates the ultraviolet-induced DNA damage response. Nature. Mar. 23, 2017;543(7646):573-576. doi: 10.1038/nature21671. Epub Mar. 15, 2017. |
Xiao et al., Genetic incorporation of multiple unnatural amino acids into proteins in mammalian cells. Angew Chem Int Ed Engl. Dec. 23, 2013;52(52):14080-3. doi: 10.1002/anie.201308137. Epub Nov. 8, 2013. |
Xiao et al., Nuclear m(6)A Reader YTHDC1 Regulates mRNA Splicing. Mol Cell. Feb. 18, 2016;61(4):507-519. doi: 10.1016/j.molcel.2016.01.012. Epub Feb. 11, 2016. |
Xie et al., Adjusting the attB site in donor plasmid improves the efficiency of ?C31 integrase system. DNA Cell Biol. Jul. 2012;31(7):1335-40. doi: 10.1089/dna.2011.1590. Epub Apr. 10, 2012. |
Xiong et al., Origin and evolution of retroelements based upon their reverse transcriptase sequences. EMBO J. Oct. 1990;9(10):3353-62. |
Xu et al., Chemical ligation of folded recombinant proteins: segmental isotopic labeling of domains for NMR studies. Proc Natl Acad Sci U S A. Jan. 19, 1999;96(2):388-93. doi: 10.1073/pnas.96.2.388. |
Xu et al., Accuracy and efficiency define Bxb1 integrase as the best of fifteen candidate serine recombinases for the integration of DNA into the human genome. BMC Biotechnol. Oct. 20, 2013;13:87. doi: 10.1186/1472-6750-13-87. |
Xu et al., Protein splicing: an analysis of the branched intermediate and its resolution by succinimide formation. EMBO J. Dec. 1, 1994;13(23):5517-22. |
Xu et al., PTMD: A Database of Human Disease-associated Post-translational Modifications. Genomics Proteomics Bioinformatics. Aug. 2018;16(4):244-251. doi: 10.1016/j.gpb.2018.06.004. Epub Sep. 21, 2018. |
Xu et al., Structures of human ALKBH5 demethylase reveal a unique binding mode for specific single-stranded N6-methyladenosine RNA demethylation. J Biol Chem. Jun. 20, 2014;289(25):17299-311. doi: 10.1074/jbc.M114.550350. Epub Apr. 28, 2014. |
Xu et al., The mechanism of protein splicing and its modulation by mutation. EMBO J. Oct. 1, 1996;15(19):5146-53. |
Yamamoto et al., The ons and offs of inducible transgenic technology: a review. Neurobiol Dis. Dec. 2001;8(6):923-32. |
Yamazaki et al., Segmental Isotope Labeling for Protein NMR Using Peptide Splicing. J. Am. Chem. Soc. May 22, 1998; 120(22):5591-2. https://doi.org/10.1021/ja980776o. |
Yan et al., Cas13d is a Compact RNA-Targeting Type VI CRISPR Effector Positively Modulated by a WYL-Domain-Containing Accessory Protein. Mol Cell. Apr. 19, 2018;70(2):327-339.e5. doi: 10.1016/j.molcel.2018.02.028. Epub Mar. 15, 2018. |
Yang et al., Construction of an integration-proficient vector based on the site-specific recombination mechanism of enterococcal temperate phage phiFC1. J Bacteriol. Apr. 2002;184(7):1859-64. doi: 10.1128/jb.184.7.1859-1864.2002. |
Yang et al., Increasing targeting scope of adenosine base editors in mouse and rat embryos through fusion of TadA deaminase with Cas9 variants. Protein Cell. Sep. 2018;9(9):814-819. doi: 10.1007/s13238-018-0568-x. |
Yang et al., One-step generation of mice carrying reporter and conditional alleles by CRISPR/Cas-mediated genome engineering. Cell. Sep. 12, 2013;154(6):1370-9. doi: 10.1016/j.cell.2013.08.022. Epub Aug. 29, 2013. |
Yang et al., Permanent genetic memory with >1-byte capacity. Nat Methods. Dec. 2014;11(12):1261-6. doi: 10.1038/nmeth.3147. Epub Oct. 26, 2014. |
Yang et al., Preparation of RNA-directed DNA polymerase from spleens of Balb-c mice infected with Rauscher leukemia virus. Biochem Biophys Res Commun. Apr. 28, 1972;47(2):505-11. doi: 10.1016/0006-291x(72)90743-7. |
Yang et al., Small-molecule control of insulin and PDGF receptor signaling and the role of membrane attachment. Curr Biol. Jan. 1, 1998;8(1):11-8. doi: 10.1016/s0960-9822(98)70015-6. |
Yang, Nucleases: diversity of structure, function and mechanism. Q Rev Biophys. Feb. 2011;44(1):1-93. doi: 10.1017/S0033583510000181. Epub Sep. 21, 2010. |
Yang, PAML 4: phylogenetic analysis by maximum likelihood. Mol Biol Evol. Aug. 2007;24(8):1586-91. doi: 10.1093/molbev/msm088. Epub May 4, 2007. |
Yasui et al., Miscoding Properties of 2′-Deoxyinosine, a Nitric Oxide-Derived DNA Adduct, during Translesion Synthesis Catalyzed by Human DNA Polymerases. J Molec Biol. Apr. 4, 2008;377(4):1015-23. |
Yasui, Alternative excision repair pathways. Cold Spring Harb Perspect Biol. Jun. 1, 2013;5(6):a012617. doi: 10.1101/cshperspect.a012617. |
Yasukawa et al., Characterization of Moloney murine leukaemia virus/avian myeloblastosis virus chimeric reverse transcriptases. J Biochem. Mar. 2009;145(3):315-24. doi: 10.1093/jb/mvn166. Epub Dec. 6, 2008. |
Yeh et al., In vivo base editing of post-mitotic sensory cells. Nat Commun. Jun. 5, 2018;9(1):2184. doi: 10.1038/s41467-018-04580-3. |
Yu et al., Circular permutation: a different way to engineer enzyme structure and function. Trends Biotechnol. Jan. 2011;29(1):18-25. doi: 10.1016/j.tibtech.2010.10.004. Epub Nov. 17, 2010. |
Yu et al., Progress towards gene therapy for HIV infection. Gene Ther. Jan. 1994;1(1):13-26. |
Yu et al., Small molecules enhance CRISPR genome editing in pluripotent stem cells. Cell Stem Cell. Feb. 5, 2015;16(2):142-7. doi: 10.1016/j.stem.2015.01.003. |
Yu et al., Synthesis-dependent microhomology-mediated end joining accounts for multiple types of repair junctions. Nucleic Acids Res. Sep. 2010;38(17):5706-17. doi: 10.1093/nar/gkq379. Epub May 11, 2010. |
Zakas et al., Enhancing the pharmaceutical properties of protein drugs by ancestral sequence reconstruction. Nat Biotechnol. Jan. 2017;35(1):35-37. doi: 10.1038/nbt.3677. Epub Sep. 26, 2016. |
Zalatan et al., Engineering complex synthetic transcriptional programs with CRISPR RNA scaffolds. Cell. Jan. 15, 2015;160(1-2):339-50. doi: 10.1016/j.cell.2014.11.052. Epub Dec. 18, 2014. |
Zettler et al., The naturally split Npu DnaE intein exhibits an extraordinarily high rate in the protein trans-splicing reaction. FEBS Lett. Mar. 4, 2009;583(5):909-14. doi: 10.1016/j.febslet.2009.02.003. Epub Feb. 10, 2009. |
Zhang et al., II-Clamp-mediated cysteine conjugation. Nat Chem. Feb. 2016;8(2):120-8. doi: 10.1038/nchem.2413. Epub Dec. 21, 2015. |
Zhang et al., A new strategy for the site-specific modification of proteins in vivo. Biochemistry. Jun. 10, 2003;42(22):6735-46. |
Zhang et al., Circular intronic long noncoding RNAs. Mol Cell. Sep. 26, 2013;51(6):792-806. doi: 10.1016/j.molcel.2013.08.017. Epub Sep. 12, 2013. |
Zhang et al., Copy number variation in human health, disease, and evolution. Annu Rev Genomics Hum Genet. 2009;10:451-81. doi: 10.1146/annurev.genom.9.081307.164217. |
Zhang et al., Myoediting: Toward Prevention of Muscular Dystrophy by Therapeutic Genome Editing. Physiol Rev. Jul. 1, 2018;98(3):1205-1240. doi: 10.1152/physrev.00046.2017. |
Zhao et al., An ultraprocessive, accurate reverse transcriptase encoded by a metazoan group II intron. RNA. Feb. 2018;24(2):183-195. doi: 10.1261/ma.063479.117. Epub Nov. 6, 2017. |
Zhao et al., Post-transcriptional gene regulation by mRNA modifications. Nat Rev Mol Cell Biol. Jan. 2017;18(1):31-42. doi: 10.1038/nrm.2016.132. Epub Nov. 3, 2016. |
Zheng et al., ALKBH5 is a mammalian RNA demethylase that impacts RNA metabolism and mouse fertility. Mol Cell. Jan. 10, 2013;49(1):18-29. doi: 10.1016/j.molcel.2012.10.015. Epub Nov. 21, 2012. |
Zheng et al., Highly efficient base editing in bacteria using a Cas9-cytidine deaminase fusion. Commun Biol. Apr. 19, 2018;1:32. doi: 10.1038/s42003-018-0035-5. |
Zheng et al., Structural basis for the complete resistance of the human prion protein mutant G127V to prion disease. Sci Rep. Sep. 4, 2018;8(1):13211. doi: 10.1038/s41598-018-31394-6. |
Zhou et al., Dynamic m(6)A mRNA methylation directs translational control of heat shock response. Nature. Oct. 22, 2015;526(7574):591-4. doi: 10.1038/nature15377. Epub Oct. 12, 2015. |
Zhou et al., Off-target RNA mutation induced by DNA base editing and its elimination by mutagenesis. Nature. Jul. 2019;571(7764):275-278. doi: 10.1038/s41586-019-1314-0. Epub Jun. 10, 2019. |
Zhou et al., Seamless Genetic Conversion of SMN2 to SMN1 via CRISPR/Cpf1 and Single-Stranded Oligodeoxynucleotides in Spinal Muscular Atrophy Patient-Specific Induced Pluripotent Stem Cells. Hum Gene Ther. Nov. 2018;29(11):1252-1263. doi: 10.1089/hum.2017.255. Epub May 9, 2018. |
Zielenski, Genotype and phenotype in cystic fibrosis. Respiration. 2000;67(2):117-33. doi: 10.1159/000029497. |
Zimmerly et al., An Unexplored Diversity of Reverse Transcriptases in Bacteria. Microbiol Spectr. Apr. 2015;3(2):MDNA3-0058-2014. doi: 10.1128/microbiolspec.MDNA3-0058-2014. |
Zimmerly et al., Group II intron mobility occurs by target DNA-primed reverse transcription. Cell. Aug. 25, 1995;82(4):545-54. doi: 10.1016/0092-8674(95)90027-6. |
Zufferey et al., Woodchuck hepatitis virus posttranscriptional regulatory element enhances expression of transgenes delivered by retroviral vectors. J Virol. Apr. 1999;73(4):2886-92. doi: 10.1128/JVI.73.4.2886-2892.1999. |
Zuker et al., Optimal computer folding of large RNA sequences using thermodynamics and auxiliary information. Nucleic Acids Res. Jan. 10, 1981;9(1):133-48. doi: 10.1093/nar/9.1.133. |
Zuo et al., Cytosine base editor generates substantial off-target single-nucleotide variants in mouse embryos. Science. Apr. 19, 2019;364(6437):289-292. doi: 10.1126/science.aav9973. Epub Feb. 28, 2019. |
[No Author Listed] “Human genome.” Encyclopedia Britannica. Encyclopedia Britannica, Inc. Published Feb. 15, 2019. Last accessed online via https://www.britannica.com/science/human-genome on Mar. 19, 2021. 2 pages. |
Akopian et al., Chimeric recombinases with designed DNA sequence recognition. Proc Natl Acad Sci U S A. Jul. 22, 2003;100(15):8688-91. Epub Jul. 1, 2003. |
Amato et al., Interpreting elevated fetal hemoglobin in pathology and health at the basic laboratory level: new and known γ-gene mutations associated with hereditary persistence of fetal hemoglobin. Int J Lab Hematol. Feb. 2014;36(1):13-9. doi: 10.1111/ijlh.12094. Epub Apr. 29, 2013. |
André et al., Axotomy-induced expression of calcium-activated chloride current in subpopulations of mouse dorsal root ganglion neurons. J Neurophysiol. Dec. 2003;90(6):3764-73. doi: 10.1152/jn.00449.2003. Epub Aug. 27, 2003. |
Atkins et al., Ribosomal frameshifting and transcriptional slippage: From genetic steganography and cryptography to adventitious use. Nucleic Acids Res. Sep. 6, 2016;44(15):7007-78. doi: 10.1093/nar/gkw530. Epub Jul. 19, 2016. |
Benarroch, HCN channels: function and clinical implications. Neurology. Jan. 15, 2013;80(3):304-10. doi: 10.1212/WNL.0b013e31827dec42. |
Berges et al., Transduction of brain by herpes simplex virus vectors. Mol Ther. Jan. 2007;15(1):20-9. doi: 10.1038/sj.mt.6300018. |
Bhagwat, DNA-cytosine deaminases: from antibody maturation to antiviral defense. DNA Repair (Amst). Jan. 5, 2004;3(1):85-9. |
Bourinet et al., Silencing of the Cav3.2 T-type calcium channel gene in sensory neurons demonstrates its major role in nociception. EMBO J. Jan. 26, 2005;24(2):315-24. doi: 10.1038/sj.emboj.7600515. Epub Dec. 16, 2004. |
Burke et al., Activating mutations of Tn3 resolvase marking interfaces important in recombination catalysis and its regulation. Mol Microbiol. Feb. 2004;51(4):937-48. |
Cai et al., Reconstruction of ancestral protein sequences and its applications. BMC Evol Biol. Sep. 17, 2004;4:33. doi: 10.1186/1471-2148-4-33. |
Canver et al., Customizing the genome as therapy for the β-hemoglobinopathies. Blood. May 26, 2016;127(21):2536-45. doi: 10.1182/blood-2016-01-678128. Epub Apr. 6, 2016. |
Caspi et al., Distribution of split DnaE inteins in cyanobacteria. Mol Microbiol. Dec. 2003;50(5):1569-77. doi: 10.1046/j.1365-2958.2003.03825.x. |
Chan et al., Molecular recording of mammalian embryogenesis. Nature. Jun. 2019;570(7759):77-82. doi: 10.1038/s41586-019-1184-5. Epub May 13, 2019. |
Chari et al., Unraveling CRISPR-Cas9 genome engineering parameters via a library-on-library approach. Nat Methods. Sep. 2015;12(9):823-6. doi: 10.1038/nmeth.3473. Epub Jul. 13, 2015. |
Chavez et al., Therapeutic applications of the ?C31 integrase system. Curr Gene Ther. Oct. 2011;11(5):375-81. Review. |
Chen et al., Genome-wide CRISPR screen in a mouse model of tumor growth and metastasis. Cell. Mar. 12, 2015;160(6): 1246-60. doi: 10.1016/j.cell.2015.02.038. Epub Mar. 5, 2015. |
Cheng et al., Multiplexed activation of endogenous genes by CRISPR-on, an RNA-guided transcriptional activator system. Cell Res. Oct. 2013;23(10):1163-71. doi: 10.1038/cr.2013.122. Epub Aug. 27, 2013. |
Chester et al., The apolipoprotein B mRNA editing complex performs a multifunctional cycle and suppresses nonsense-mediated decay. EMBO J. Aug. 1, 2003;22(15):3971-82. doi: 10.1093/emboj/cdg369. |
Cho et al., The calcium-activated chloride channel anoctamin 1 acts as a heat sensor in nociceptive neurons. Nat Neurosci. May 27, 2012;15(7):1015-21. doi: 10.1038/nn.3111. |
Chong et al., Protein splicing of the Saccharomyces cerevisiae VMA intein without the endonuclease motifs. J Biol Chem. Jun. 20, 1997;272(25):15587-90. doi: 10.1074/jbc.272.25.15587. |
Costa et al., Frequent use of the same tertiary motif by self-folding RNAs. EMBO J. Mar. 15, 1995;14(6):1276-85. |
Cox et al., An SCN9A channelopathy causes congenital inability to experience pain. Nature. Dec. 14, 2006;444(7121):894-8. doi: 10.1038/nature05413. |
Cox et al., Congenital insensitivity to pain: novel SCN9A missense and in-frame deletion mutations. Hum Mutat. Sep. 2010;31(9):E1670-86. doi: 10.1002/humu.21325. |
Cronican et al., A class of human proteins that deliver functional proteins into mammalian cells in vitro and in vivo. Chem Biol. Jul. 29, 2011;18(7):833-8. doi: 10.1016/j.chembiol.2011.07.003. |
Cronican et al., Potent delivery of functional proteins into Mammalian cells in vitro and in vivo using a supercharged protein. ACS Chem Biol. Aug. 20, 2010;5(8):747-52. doi:10.1021/cb1001153. |
Database EBI Accession No. ADE34233 Jan. 29, 2004. |
Database EBI Accession No. BFF09785. May 31, 2018. 2 pages. |
Database EBI Accession No. BGE38086. Jul. 25, 2019. 2 pages. |
Database UniProt Accession No. G8I3E0. Jan. 14, 2012. |
Davidson et al., Viral vectors for gene delivery to the nervous system. Nat Rev Neurosci. May 2003;4(5):353-64. doi: 10.1038/nrn1104. |
Deverman et al., Cre-dependent selection yields AAV variants for widespread gene transfer to the adult brain. Nat Biotechnol. Feb. 2016;34(2):204-9. doi: 10.1038/nbt.3440. Epub Feb. 1, 2016. |
Devigili et al., Paroxysmal itch caused by gain-of-function Nav1.7 mutation. Pain. Sep. 2014;155(9):1702-1707. doi: 10.1016/j.pain.2014.05.006. Epub May 10, 2014. |
Doench et al., Rational design of highly active sgRNAs for CRISPR-Cas9-mediated gene inactivation. Nat Biotechnol. Dec. 2014;32(12):1262-7. doi: 10.1038/nbt.3026. Epub Sep. 3, 2014. |
Emery et al., HCN2 ion channels play a central role in inflammatory and neuropathic pain. Science. Sep. 9, 2011;333(6048):1462-6. doi: 10.1126/science.1206243. |
Epstein, HSV-1-based amplicon vectors: design and applications. Gene Ther. Oct. 2005;12 Suppl 1:S154-8. doi: 10.1038/sj.gt.3302617. |
Estacion et al., A sodium channel gene SCN9A polymorphism that increases nociceptor excitability. Ann Neurol. Dec. 2009;66(6):862-6. doi: 10.1002/ana.21895. |
Evans et al., Protein trans-splicing and cyclization by a naturally split intein from the dnaE gene of Synechocystis species PCC6803. J Biol Chem. Mar. 31, 2000;275(13):9091-4. doi: 10.1074/jbc.275.13.9091. |
Farboud et al., Dramatic enhancement of genome editing by CRISPR/Cas9 through improved guide RNA design. Genetics. Apr. 2015;199(4):959-71. doi: 10.1534/genetics.115.175166. Epub Feb. 18, 2015. |
Fawcett et al., Transposable elements controlling I-R hybrid dysgenesis in D. melanogaster are similar to mammalian LINEs. Cell. Dec. 2, 1986;47(6):1007-15. doi: 10.1016/0092-8674(86)90815-9.6 |
Fire et al., Potent and specific genetic interference by double-stranded RNA in Caenorhabditis elegans. Nature. Feb. 19, 1998;391(6669):806-11. doi: 10.1038/35888. |
Flaman et al., A rapid PCR fidelity assay. Nucleic Acids Res. Aug. 11, 1994;22(15):3259-60. doi: 10.1093/nar/22.15.3259. |
Fusi et al., In Silico Predictive Modeling of CRISPR/Cas9 guide efficiency. Jun. 26, 2015; bioRxiv. http://dx.doi.org/10.1101/021568. |
Gaj et al., Structure-guided reprogramming of serine recombinase DNA sequence specificity. Proc Natl Acad Sci U S A. Jan. 11, 2011;108(2):498-503. doi: 10.1073/pnas.1014214108. Epub Dec. 27, 2010. |
Gao et al., Self-processing of ribozyme-flanked RNAs into guide RNAs in vitro and in vivo for CRISPR-mediated genome editing. J Integr Plant Biol. Apr. 2014;56(4):343-9. doi: 10.1111/jipb.12152. Epub Mar. 6, 2014. |
Garcia et al., Transglycosylation: a mechanism for RNA modification (and editing?). Bioorg Chem. Jun. 2005;33(3):229-51. doi: 10.1016/j.bioorg.2005.01.001. Epub Feb. 23, 2005. |
Gearing, Addgene blog. CRISPR 101: Cas9 nickase design and homology directed repair. 2018. pp. 1-12. https://blog.addgene.org/crispr-101-cas9-nickase-design-and-homlogy-directed-repair. Last retrieved online Jun. 25, 2021. |
GENBANK Submission; NIH/NCBI, Accession No. BDB43378. Zhang et al., Aug. 11, 2016. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. KR710351.1. Sahni et al., Jun. 1, 2015. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NM_002945.3. Weiser et al., Sep. 3, 2017. 5 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NM 002947.4. Xiao et al., May 1, 2019. 4 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NP_358988.1. Hoskins et al., Jan. 11, 2017. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NP_628093.1. Hsiao et al., Aug. 3, 2016. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. YP_009137104.1. Davison, Aug. 13, 2018. 2 pages. |
Gibson et al., Enzymatic assembly of DNA molecules up to several hundred kilobases. Nat Methods. May 2009;6(5):343-5. doi: 10.1038/nmeth.l318. Epub Apr. 12, 2009. |
Goldberg et al., Loss-of-function mutations in the Nav1.7 gene underlie congenital indifference to pain in multiple human populations. Clin Genet. Apr. 2007;71(4):311-9. doi: 10.1111/j.1399-0004.2007.00790.X. |
Gordley et al., Evolution of programmable zinc finger-recombinases with activity in human cells. J Mol Biol. Mar. 30, 2007;367(3):802-13. Epub Jan. 12, 2007. |
Gordley et al., Synthesis of programmable integrases. Proc Natl Acad Sci U S A. Mar. 31, 2009;106(13):5053-8. doi: 10.1073/pnas.0812502106. Epub Mar. 12, 2009. |
Groth et al., Phage integrases: biology and applications. J Mol Biol. Jan. 16, 2004;335(3):667-78. |
Gruber et al., The Vienna RNA websuite. Nucleic Acids Res. Jul. 1, 2008;36(Web Server issue):W70-4. doi: 10.1093/nar/gkn188. Epub Apr. 19, 2008. |
Gumulya et al., Exploring the past and the future of protein evolution with ancestral sequence reconstruction: the ‘retro’ approach to protein engineering. Biochem J. Jan. 1, 2017;474(1):1-19. doi: 10.1042/BCJ20160507. |
Guo et al., Structure of Cre recombinase complexed with DNA in a site-specific recombination synapse. Nature. Sep. 4, 1997;389(6646):40-6. |
Halperin et al., CRISPR-guided DNA polymerases enable diversification of all nucleotides in a tunable window. Nature. Aug. 2018;560(7717):248-252. doi: 10.1038/s41586-018-0384-8. Epub Aug. 1, 2018. |
Hartung et al., Cre mutants with altered DNA binding properties. J Biol Chem. Sep. 4, 1998;273(36):22884-91. |
Hirano et al., Site-specific recombinases as tools for heterologous gene integration. Appl Microbiol Biotechnol. Oct. 2011;92(2):227-39. doi: 10.1007/s00253-011-3519-5. Epub Aug. 7, 2011. Review. |
Holt et al., Human hematopoietic stem/progenitor cells modified by zinc-finger nucleases targeted to CCR5 control HIV-1 in vivo. Nat Biotechnol. Aug. 2010;28(8):839-47. doi: 10.1038/nbt.1663. Epub Jul. 2, 2010. |
Hoogenboom et al., Natural and designer binding sites made by phage display technology. Immunol Today. Aug. 2000;21(8):371-8. |
Hotta et al., [Neurotropic viruses—classification, structure and characteristics]. Nihon Rinsho. Apr. 1997;55(4):777-82. Japanese. |
Housden et al., Identification of potential drug targets for tuberous sclerosis complex by synthetic screens combining CRISPR-based knockouts with RNAi. Sci Signal. Sep. 8, 2015;8(393):rs9. doi: 10.1126/scisignal.aab3729. |
Hu et al., Evolved Cas9 variants with broad PAM compatibility and high DNA specificity. Nature. Apr. 5, 2018;556(7699):57-63 and Extended/Supplementary Data, doi: 10.1038/nature26155. Epub Feb. 28, 2018. 21 pages. |
Ibba et al., Relaxing the substrate specificity of an aminoacyl-tRNA synthetase allows in vitro and in vivo synthesis of proteins containing unnatural amino acids. FEBS Lett. May 15, 1995;364(3):272-5. |
Irion et al., Identification and targeting of the ROSA26 locus in human embryonic stem cells. Nat Biotechnol. Dec. 2007;25(12):1477-82. doi: 10.1038/nbt1362. Epub Nov. 25, 2007. |
Jemiflity et al., Novel “anti-reverse” cap analogs with superior translational properties. RNA. Sep. 2003;9(9):1108-22. doi: 10.1261/rna.5430403. |
Kay et al., Viral vectors for gene therapy: the art of turning infectious agents into vehicles of therapeutics. Nat Med. Jan. 2001;7(1):33-40. |
Keravala et al., A diversity of serine phage integrases mediate site-specific recombination in mammalian cells. Mol Genet Genomics. Aug. 2006;276(2): 135-46. doi: 10.1007/s00438-006-0129-5. Epub May 13, 2006. |
Kilbride et al., Determinants of product topology in a hybrid Cre-Tn3 resolvase site-specific recombination system. J Mol Biol. Jan. 13, 2006;355(2):185-95. Epub Nov. 9, 2005. |
Kim et al., In vivo genome editing with a small Cas9 orthologue derived from Campylobacter jejuni. Nat Commun. Feb. 21, 2017;8:14500. doi: 10.1038/ncomms 14500. PMID: 28220790; PMCID: PMC5473640. |
Kim et al., Rescue of high-specificity Cas9 variants using sgRNAs with matched 5′ nucleotides. Genome Biol. Nov. 15, 2017;18(1):218. doi: 10.1186/s13059-017-1355-3. |
Kleinstiver et al., Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature. Jul. 23, 2015;523(7561):481-5 and Supplementary Materials, doi: 10.1038/nature14592. Epub Jun. 22, 2015. 27 pages. |
Kolot et al., Site promiscuity of coliphage HK022 integrase as a tool for gene therapy. Gene Ther. Jul. 2015;22(7):521-7. doi: 10.1038/gt.2015.9. Epub Mar. 12, 2015. |
Lancaster et al., Limited trafficking of a neurotropic virus through inefficient retrograde axonal transport and the type I interferon response. PLoS Pathog. Mar. 5, 2010;6(3):e1000791. doi: 10.1371/journal.ppat.1000791. |
Lazarevic et al., Nucleotide sequence of the Bacillus subtilis temperate bacteriophage SPbetac2. Microbiology (Reading). May 1999;145 ( Pt 5):1055-1067. doi: 10.1099/13500872-145-5-1055. |
Leipold et al., A de novo gain-of-function mutation in SCN11A causes loss of pain perception. Nat Genet. Nov. 2013;45(11):1399-404. doi: 10.1038/ng.2767. Epub Sep. 15, 2013. |
Lim et al., Viral vectors for neurotrophic factor delivery: a gene therapy approach for neurodegenerative diseases of the CNS. Pharmacol Res. Jan. 2010;61(1):14-26. doi: 10.1016/j.phrs.2009.10.002. Epub Oct. 17, 2009. |
Liu et al., Direct Promoter Repression by BCL11A Controls the Fetal to Adult Hemoglobin Switch. Cell. Apr. 5, 2018;173(2):430-442.e17. doi: 10.1016/j.cell.2018.03.016. Epub Mar. 29, 2018. |
Lynch, Evolution of the mutation rate. Trends Genet. Aug. 2010;26(8):345-52. doi: 10.1016/j.tig.2010.05.003. Epub Jun. 30, 2010. |
Maizels et al., Initiation of homologous recombination at DNA nicks. Nucleic Acids Res. Aug. 21, 2018;46(14):6962-6973. doi: 10.1093/nar/gky588. |
McInerney et al., Error Rate Comparison during Polymerase Chain Reaction by DNA Polymerase. Mol Biol Int. 2014;2014:287430. doi: 10.1155/2014/287430. Epub Aug. 17, 2014. |
Menéndez-Arias, Mutation rates and intrinsic fidelity of retroviral reverse transcriptases. Viruses. Dec. 1, 2009;(3):1137-65. doi: 10.3390/vl031137. Epub Dec. 4, 2009. |
Mir et al., Type II-C CRISPR-Cas9 Biology, Mechanism, and Application. ACS Chem Biol. Feb. 16, 2018;13(2):357-365. doi: 10.1021/acschembio.7b00855. Epub Dec. 20, 2017. |
Moede et al., Identification of a nuclear localization signal, RRMKWKK, in the homeodomain transcription factor PDX-1. FEBS Lett. Nov. 19, 1999;461(3):229-34. doi: 10.1016/s0014-5793(99)01446-5. |
Moreno-Mateos et al., CRISPRscan: designing highly efficient sgRNAs for CRISPR-Cas9 targeting in vivo. Nat Methods. Oct. 2015;12(10):982-8. doi: 10.1038/nmeth.3543. Epub Aug. 31, 2015. |
Mougiakos et al., Characterizing a thermostable Cas9 for bacterial genome editing and silencing. Nat Commun. Nov. 21, 2017;8(1):1647. doi: 10.1038/s41467-017-01591-4. |
Murphy, Phage recombinases and their applications. Adv Virus Res. 2012;83:367-414. doi: 10.1016/B978-0-12-394438-2.00008-6. Review. |
Olivares et al., Site-specific genomic integration produces therapeutic Factor IX levels in mice. Nat Biotechnol. Nov. 2002;20(11):1124-8. doi: 10.1038/nbt753. Epub Oct. 15, 2002. |
Olorunniji et al., Synapsis and catalysis by activated Tn3 resolvase mutants. Nucleic Acids Res. Dec. 2008;36(22):7181-91. doi: 10.1093/nar/gkn885. Epub Nov. 10, 2008. |
Raghavan et al., Abstract 27: Therapeutic Targeting of Human Lipid Genes with in vivo CRISPR-Cas9 Genome Editing. Oral Abstract Presentations: Lipoprotein Metabolism and Therapeutic Targets. Arterioscler THromb Vase Biol. 2015;35(Suppl. 1):Abstract 27. 5 pages. |
Relph et al., Recent developments and current status of gene therapy using viral vectors in the United Kingdom. BMJ. 2004;329(7470):839-842. doi:10.1136/bmj.329.7470.839. |
Reynaud et al., What role for AID: mutator, or assembler of the immunoglobulin mutasome? Nat Immunol. Jul. 2003;4(7):631-8. |
Rongrong et al., Effect of deletion mutation on the recombination activity of Cre recombinase. Acta Biochim Pol. 2005;52(2):541-4. Epub May 15, 2005. |
Sapunar et al., Dorsal root ganglion—a potential new therapeutic target for neuropathic pain. J Pain Res. 2012;5:31-8. doi: 10.2147/JPR.S26603. Epub Feb. 16, 2012. |
Score Results for Luetticken et al., Complete genome sequence of a Streptococcus dysgalactiae subsp. RT equisimilis strain possessing Lancefield's group A antigen. RL Submitted to the EMBL/GenBank/DDBJ databases. May 2012. 3 pages. |
Score Results for Okumura et al., Evolutionary paths of streptococcal and staphylococcal superantigens. RL BMC Genomics. 2012;13:404-404. 3 pages. |
Score Results for Shimomura et al., Complete Genome Sequencing and Analysis of a Lancefield Group G RT Streptococcus dysagalactiae Subsp. Equisimilis Strain Causing Streptococcal RT Toxic Shock Syndrome (STSS). RL BMC Genomics. 2011;12:17-17. 3 pages. |
Shaikh et al., Chimeras of the Flp and Cre recombinases: tests of the mode of cleavage by Flp and Cre. J Mol Biol. Sep. 8, 2000;302(1):27-48. |
Shen et al., Herpes simplex virus 1 (HSV-1) for cancer treatment. Cancer Gene Ther. Nov. 2006;13(11):975-92. doi: 10.1038/sj.cgt.7700946. Epub Apr. 7, 2006. |
Singh et al., Real-time observation of DNA target interrogation and product release by the RNA-guided endonuclease CRISPR Cpf1 (Cas12a). Proc Natl Acad Sci U S A. May 22, 2018;115(21):5444-5449. doi: 10.1073/pnas.1718686115. Epub May 7, 2018. |
Siu et al., Riboregulated toehold-gated gRNA for programmable CRISPR-Cas9 function. Nat Chem Biol. Mar. 2019;15(3):217-220. doi: 10.1038/s41589-018-01861. Epub Dec. 10, 2018. |
Smith et al., Diversity in the serine recombinases. Mol Microbiol. Apr. 2002;44(2):299-307. Review. |
Smith et al., Herpesvirus transport to the nervous system and back again. Annu Rev Microbiol. 2012;66:153-76. doi: 10.1146/annurev-micro-092611-150051. Epub Jun. 15, 2012. |
Somanathan et al., AAV vectors expressing LDLR gain-of-function variants demonstrate increased efficacy in mouse models of familial hypercholesterolemia. Circ Res. Aug. 29, 2014;115(6):591-9. doi: 10.1161/CIRCRESAHA.115.304008. Epub Jul. 14, 2014. |
Steiner et al., The neurotropic herpes viruses: herpes simplex and varicella-zoster. Lancet Neurol. Nov. 2007;6(11):1015-28. doi: 10.1016/S1474-4422(07)70267-3. |
Strecker et al., Engineering of CRISPR-Cas12b for human genome editing. Nat Commun. Jan. 22, 2019;10(1):212. doi: 10.1038/s41467-018-08224-4. |
Su et al., Human DNA polymerase η has reverse transcriptase activity in cellular environments. J Biol Chem. Apr. 12, 2019;294(15):6073-6081. doi: 10.1074/jbc.RA119.007925. Epub Mar. 6, 2019. |
Tambunan et al., Vaccine Design for H5N1 Based on B- and T-cell Epitope Predictions. Bioinform Biol Insights. Apr. 28, 2016;10:27-35. doi: 10.4137/BBI.S38378. |
Teng et al., Mutational analysis of apolipoprotein B mRNA editing enzyme (APOBEC1). structure-function relationships of RNA editing and dimerization. J Lipid Res. Apr. 1999;40(4):623-35. |
Tone et al., Single-stranded DNA binding protein Gp5 of Bacillus subtilis phage ?29 is required for viral DNA replication in growth-temperature dependent fashion. Biosci Biotechnol Biochem. 2012;76(12):2351-3. doi: 10.1271/bbb.120587. Epub Dec. 7, 2012. |
UNIPROTKB Submission; Accession No. F0NN87. May 3, 2011. 4 pages. |
Venken et al., Genome-wide manipulations of Drosophila melanogaster with transposons, Flp recombinase, and ΦC31 integrase. Methods Mol Biol. 2012;859:203-28. doi: 10.1007/978-1-61779-603-6_12. |
Wang et al., Optimized paired-sgRNA/Cas9 cloning and expression cassette triggers high-efficiency multiplex genome editing in kiwifruit. Plant Biotechnol J. Aug. 2018;16(8):1424-1433. doi: 10.1111/pbi.12884. Epub Feb. 6, 2018. |
Weiss et al., Loss-of-function mutations in sodium channel Nav1.7 cause anosmia. Nature. Apr. 14, 2011;472(7342):186-90. doi: 10.1038/nature09975. Epub Mar. 23, 2011. |
Woods et al., The phenotype of congenital insensitivity to pain due to the NaV1.9 variant p.L811P. Eur J Hum Genet. May 2015;23(5):561-3. doi: 10.1038/ejhg.2014.166. Epub Aug. 13, 2014. |
Yamada et al., Crystal Structure of the Minimal Cas9 from Campylobacter jejuni Reveals the Molecular Diversity in the CRISPR-Cas9 Systems. Mol Cell. Mar. 16, 2017;65(6):P1109-1121./doi.org/10.1016/j .molcel.2017.02.007. |
Yan et al., Functionally diverse type V CRISPR-Cas systems. Science. Jan. 4, 2019;363(6422):88-91. doi: 10.1126/science.aav7271. Epub Dec. 6, 2018. |
Yang et al., Mutations in SCN9A, encoding a sodium channel alpha subunit, in patients with primary erythermalgia. J Med Genet. Mar. 2004;41(3):171-4. doi: 10.1136/jmg.2003.012153. |
Yang, Development of Human Genome Editing Tools for the Study of Genetic Variations and Gene Therapies. Doctoral Dissertation. Harvard University. 2013. Accessible via nrs.harvard.edu/urn-3:HUL.InstRepos:11181072. 277 pages. |
Yokoe et al., Spatial dynamics of GFP-tagged proteins investigated by local fluorescence enhancement. Nat Biotechnol. Oct. 1996;14(10):1252-6. doi: 10.1038/nbt1096-1252. |
Zhao et al., Crystal structures of a group II intron maturase reveal a missing link in spliceosome evolution. Nat Struct Mol Biol. Jun. 2016;23(6):558-65. doi: 10.1038/nsmb.3224. Epub May 2, 2016. |
Zhou et al., Protective V127 prion variant prevents prion disease by interrupting the formation of dimer and fibril from molecular dynamics simulations. Sci Rep. Feb. 24, 2016;6:21804. doi: 10.1038/srep21804. |
[No Author Listed], “Lambda DNA” from Catalog & Technical Reference. New England Biolabs Inc. 2002/2003. pp. 133 and 270-273. |
[No Author Listed], Mus musculus (Mouse). UniProtKB Accession No. P51908 (ABEC1_MOUSE). Oct. 1, 1996. 10pages. |
Asokan et al., The AAV vector toolkit: poised at the clinical crossroads. Mol Ther. Apr. 2012;20(4):699-708. doi: 10.1038/mt.2011.287. Epub Jan. 24, 2012. |
Auricchio et al., Exchange of surface proteins impacts on viral vector cellular specificity and transduction characteristics: the retina as a model. Hum Mol Genet. Dec. 15, 2001;10(26):3075-81. doi: 10.1093/hmg/10.26.3075. |
Baba et al., Construction of Escherichia coli K-12 in-frame, single-gene knockout mutants: the Keio collection. Mol Syst Biol. 2006;2:2006.0008. doi: 10.1038/msb4100050. Epub Feb. 21, 2006. |
Badran et al., In vivo continuous directed evolution. Curr Opin Chem Biol. Feb. 2015;24:1-10. doi: 10.1016/j.cbpa.2014.09.040. Epub Nov. 7, 2014. |
Bae et al., Cas-OFFinder: a fast and versatile algorithm that searches for potential off-target sites of Cas9 RNA-guided endonucleases. Bioinformatics. May 15, 2014;30(10):1473-5. doi: 10.1093/bioinformatics/btu048. Epub Jan. 24, 2014. |
Bagal et al., Recent progress in sodium channel modulators for pain. Bioorg Med Chem Lett. Aug. 15, 2014;24(16):3690-9. doi: 10.1016/j.bmcl.2014.06.038. Epub Jun. 21, 2014. |
Banno et al., Deaminase-mediated multiplex genome editing in Escherichia coli. Nat Microbiol. Apr. 2018;3(4):423-429. doi: 10.1038/s41564-017-0102-6. Epub Feb. 5, 2018. |
Barmania et al., C-C chemokine receptor type five (CCR5): An emerging target for the control of HIV infection. Appl Transl Genom. May 26, 2013;2:3-16. doi: 10.1016/j.atg.2013.05.004. |
Bass, B.L., RNA editing by adenosine deaminases that act on RNA. Annu Rev Biochem. 2002;71:817-46. doi: 10.1146/annurev.biochem.71.110601.135501. Epub Nov. 9, 2001. |
Beaudry et al., Directed evolution of an RNA enzyme. Science. Jul. 31, 1992;257(5070):635-41. doi: 10.1126/science.1496376. |
Bell et al., Ribozyme-catalyzed excision of targeted sequences from within RNAs. Biochemistry. Dec. 24, 2002;41(51):15327-33. doi: 10.1021/bi0267386. |
Bentin, T., A ribozyme transcribed by a ribozyme. Artif DNA PNA XNA. Apr. 2011;2(2):40-42. doi: 10.4161/adna.2.2.16852. |
Blauw et al., SMN1 gene duplications are associated with sporadic ALS. Neurology. Mar. 13, 2012;78(11):776-80. doi: 10.1212/WNL.0b013e318249f697. Epub Feb. 8, 2012. |
Bothmer et al., Characterization of the interplay between DNA repair and CRISPR/Cas9-induced DNA lesions at an endogenous locus. Nat Commun. Jan. 9, 2017;8:13905. doi: 10.1038/ncomms13905. |
Brierley et al., Viral RNA pseudoknots: versatile motifs in gene expression and replication. Nat Rev Microbiol. Aug. 2007;5(8):598-610. doi: 10.1038/nrmicro1704. |
Butt et al., Efficient CRISPR/Cas9-Mediated Genome Editing Using a Chimeric Single-Guide RNA Molecule. Front Plant Sci. Aug. 24, 2017;8:1441(1-8). doi: 10.3389/fpls.2017.01441. |
Canny et al., Inhibition of 53BP1 Favors Homology-Dependent DNA Repair and Increases CRISPR-Cas9 Genome-Editing Efficiency. Nat Biotechnol. Jan. 2018;36(1):95-102. doi: 10.1038/nbt.4021. Epub Nov. 27, 2017. |
Cao et al., Rapamycin reverses cellular phenotypes and enhances mutant protein clearance in Hutchinson-Gilford progeria syndrome cells. Sci Transl Med. Jun. 29, 2011;3(89):89ra58. doi: 10.1126/scitranslmed.3002346. |
Cartegni et al., Determinants of exon 7 splicing in the spinal muscular atrophy genes, SMN1 and SMN2. Am J Hum Genet. Jan. 2006;78(1):63-77. doi: 10.1086/498853. Epub Nov. 16, 2005. |
Chang et al., Degradation of survival motor neuron (SMN) protein is mediated via the ubiquitin/proteasome pathway. Neurochem Int. Dec. 2004;45(7):1107-12. doi: 10.1016/j.neuint.2004.04.005. |
Chatterjee et al., Robust Genome Editing of Single-Base PAM Targets; with Engineered ScCas9 Variants. bioRxiv. doi: 10.1101/620351. Posted Apr. 26, 2019. |
Chawla et al., An atlas of RNA base pairs involving modified nucleobases with optimal geometries and accurate energies. Nucleic Acids Res. Aug. 18, 2015;43(14):6714-29. doi: 10.1093/nar/gkv606. Epub Jun. 27, 2015. |
Chen et al., Alterations in PMS2, MSH2 and MLH1 expression in human prostate cancer. Int J Oncol. May 2003;22(5):1033-43. |
Chen et al., Targeting genomic rearrangements in tumor cells through Cas9-mediated insertion of a suicide gene. Nat Biotechnol. Jun. 2017;35(6):543-550. doi: 10.1038/nbt.3843. Epub May 1, 2017. |
Cho et al., A degron created by SMN2 exon 7 skipping is a principal contributor to spinal muscular atrophy severity. Genes Dev. Mar. 1, 2010;24(5):438-42. doi: 10.1101/gad.1884910. |
Choudhury et al., CRISPR-dCas9 mediated TET1 targeting for selective DNA demethylation at BRCA1 promoter. Oncotarget. Jul. 19, 2016;7(29):46545-46556. doi: 10.18632/oncotarget.10234. |
Corcia et al., The importance of the SMN genes in the genetics of sporadic ALS. Amyotroph Lateral Scler. Oct.-Dec. 2009;10(5-6):436-40. doi: 10.3109/17482960902759162. |
Corti et al., Genetic correction of human induced pluripotent stem cells from patients with spinal muscular atrophy. Sci Transl Med. Dec. 19, 2012;4(165):165ra162. doi: 10.1126/scitranslmed.3004108. |
Cucchiarini et al., Enhanced expression of the central survival of motor neuron (SMN) protein during the pathogenesis of osteoarthritis. J Cell Mol Med. Jan. 2014;18(1):115-24. doi: 10.1111/jcmm. 12170. Epub Nov. 17, 2013. |
D'Ydewalle et al., The Antisense Transcript SMN-AS1 Regulates SMN Expression and is a Novel Therapeutic Target for Spinal Muscular Atrophy. Neuron. Jan. 4, 2017;93(1):66-79 and Supplemental Information, doi: 10.1016/j.neuron.2016.11.033. Epub Dec. 22, 2016. |
Davis et al., Assaying Repair at DNA Nicks. Methods Enzymol. 2018;601:71-89. doi: 10.1016/bs.mie.2017.12.001. Epub Feb. 1, 2018. |
Davis et al., Homology-directed repair of DNA nicks via pathways distinct from canonical double-strand break repair. Proc Natl Acad Sci U S A. Mar. 11, 2014;111(10):E924-32. doi: 10.1073/pnas.1400236111. Epub Feb. 20, 2014. |
Davis et al., Two Distinct Pathways Support Gene Correction by Single-Stranded Donors at DNA Nicks. Cell Rep. Nov. 8, 2016;17(7):1872-1881. doi: 10.1016/j.celrep.2016.10.049. |
De La Peña et al., The Hammerhead Ribozyme: A Long History for a Short RNA. Molecules. Jan. 4, 2017;22(1):78. doi: 10.3390/molecules22010078. |
De Sandre-Giovannoli et al., Lamin a truncation in Hutchinson-Gilford progeria. Science. Jun. 27, 2003;300(5628):2055. doi: 10.1126/science.1084125. Epub Apr. 17, 2003. |
Denizio et al., Harnessing natural DNA modifying activities for editing of the genome and epigenome. Curr Opin Chem Biol. Aug. 2018;45:10-17. doi: 10.1016/j.cbpa.2018.01.016. Epub Feb. 13, 2018. |
Dolan et al., Trans-splicing with the group I intron ribozyme from Azoarcus. RNA. Feb. 2014;20(2):202-13. doi: 10.1261/rna.041012.113. Epub Dec. 16, 2013. |
Drost et al., Inactivation of DNA mismatch repair by variants of uncertain significance in the PMS2 gene. Hum Mutat. Nov. 2013;34(11):1477-80. doi: 10.1002/humu.22426. Epub Sep. 11, 2013. |
Duan et al., Enhancement of muscle gene delivery with pseudotyped adeno-associated virus type 5 correlates with myoblast differentiation. J Virol. Aug. 2001;75(16):7662-71. doi: 10.1128/JVI.75.16.7662-7671.2001. |
Dugar et al., CRISPR RNA-Dependent Binding and Cleavage of Endogenous RNAs by the Campylobacter jejuni Cas9. Mol Cell. Mar. 1, 2018;69(5):893-905.e7. doi: 10.1016/j.molcel.2018.01.032. |
Eisenberg et al., A-to-I RNA editing—immune protector and transcriptome diversifier. Nat Rev Genet. Aug. 2018;19(8):473-490. doi: 10.1038/s41576-018-0006-1. |
Friedman, J. H., Greedy function approximation: A gradient boosting machine. Ann. Statist. Oct. 2001;29(5):1189-232. doi: 10.1214/aos/1013203451. |
Gangopadhyay et al., Precision Control of CRISPR-Cas9 Using Small Molecules and Light. Biochemistry. Jan. 29, 2019;58(4):234-244. doi: 10.1021/acs.biochem.8b01202. Epub Jan. 22, 2019. |
GENBANK Submission; NIH/NCBI Accession No. 4UN5_B. Anders et al., Jul. 23, 2014. 5 pages. |
GENBANK Submission; NIH/NCBI, Accession No. AIT42264.1. Hyun et al., Oct. 15, 2014. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. AKA60242.1. Tong et al., Apr. 5, 2015. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. AKQ21048.1. Gilles et al., Jul. 19, 2015. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. AKS40380.1. Nodvig et al., Aug. 2, 2015. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. NG_008692.2. McClintock et al., Aug. 27, 2018. 33 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NP_001075493.1. Schiaffella et al., Jun. 24, 2018. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NP_001157741.1. Zeng et al., Sep. 17, 2018. 3 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NP_001157742.1. Zeng et al., Oct. 21, 2018. 3 pages. |
GENBANK Submission; NIH/NCBI, Accession No. NP_033040.2. Liu et al., Jun. 23, 2018. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. WP_002989955.1. No Author Listed, May 6, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_010922251.1. No Author Listed, May 15, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_011054416.1. No Author Listed, May 15, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_011284745.1. No Author Listed, May 16, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_011285506.1. No Author Listed, May 16, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_011527619.1. No Author Listed, May 16, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_012560673.1. No Author Listed, May 17, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_014407541.1. No Author Listed, May 18, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_020905136.1. No Author Listed, Jul. 25, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_023080005.1. No Author Listed, Oct. 27, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_023610282.1. No Author Listed, Nov. 27, 2013. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_030125963.1. No Author Listed, Jul. 9, 2014. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_030126706.1. No Author Listed, Jul. 9, 2014. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_031488318.1. No Author Listed., Aug. 5, 2014. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_032460140.1. No Author Listed, Oct. 4, 2014. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_032461047.1. No Author Listed, Oct. 4, 2014. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_032462016.1. Haft et al., Oct. 4, 2014. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_032462936.1. No Author Listed, Oct. 4, 2014. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_032464890.1. No Author Listed, Oct. 4, 2014. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_038431314.1. No Author Listed, Dec. 26, 2014. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_038432938.1. No Author Listed, Dec. 26, 2014. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_038434062.1. No Author Listed, Dec. 26, 2014. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_048327215.1. No Author Listed, Jun. 26, 2015. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. WP_049519324.1. No Author Listed, Jul. 20, 2015. 1 page. |
GENBANK Submission; NIH/NCBI, Accession No. XP_003314669.1. No Author Listed, Mar. 20, 2018. 2 pages. |
GENBANK Submission; NIH/NCBI, Accession No. XP_026671085.1. No Author Listed, Oct. 17, 2018. 1 page. |
Guedon et al., Current gene therapy using viral vectors for chronic pain. Mol Pain. May 13, 2015;11:27. doi: 10.1186/s12990-015-0018-1. |
Guo et al., Evolution of Tetrahymenaribozyme mutants with increased structural stability. Nat Struct Biol. Nov. 2002;9(11):855-61. doi: 10.1038/nsb850. |
Gutschner et al., Post-translational Regulation of Cas9 during G1 Enhances Homology-Directed Repair. Cell Rep. Feb. 16, 2016;14(6):1555-1566. doi: 10.1016/j.celrep.2016.01.019. Epub Feb. 4, 2016. |
Halbert et al., Repeat transduction in the mouse lung by using adeno-associated virus vectors with different serotypes. J Virol. Feb. 2000;74(3):1524-32. doi: 10.1128/jvi.74.3.1524-1532.2000. |
Hardt et al.,Missense variants in hMLH1 identified in patients from the German HNPCC consortium and functional studies. Fam Cancer. Jun. 2011;10(2):273-84. doi: 10.1007/s10689-011-9431-4. |
Harmsen et al., DNA mismatch repair and oligonucleotide end-protection promote base-pair substitution distal from a CRISPR/Cas9-induced DNA break. Nucleic Acids Res. Apr. 6, 2018;46(6):2945-2955. doi: 10.1093/nar/gky076. |
Harrington et al., Programmed DNA destruction by miniature CRISPR-Cas14 enzymes. Science. Nov. 16, 2018;362(6416):839-842. doi: 10.1126/science.aav4294. Epub Oct. 18, 2018. |
Hart et al., High-Resolution CRISPR Screens Reveal Fitness Genes and Genotype-Specific Cancer Liabilities. Cell. Dec. 3, 2015;163(6):1515-26. doi: 10.1016/j.cell.2015.11.015. Epub Nov. 25, 2015. |
Hilbers et al., New developments in structure determination of pseudoknots. Biopolymers. 1998;48(2-3):137-53. doi: 10.1002/(SICI)1097-0282(1998)48:2<137::AID-BIP4>3.0.CO;2-H. |
Hua et al., Expanding the base editing scope in rice by using Cas9 variants. Plant Biotechnol J. Feb. 2019;17(2):499-504. doi: 10.1111/pbi.12993. Epub Oct. 5, 2018. |
Hua et al., Precise A⋅T to G⋅C Base Editing in the Rice Genome. Mol Plant. Apr. 2, 2018;11(4):627-630. doi: 10.1016/j.molp.2018.02.007. Epub Feb. 21, 2018. |
Isaacs et al., Engineered riboregulators enable post-transcriptional control of gene expression. Nat Biotechnol. Jul. 2004;22(7):841-7. doi: 10.1038/nbt986. Epub Jun. 20, 2004. |
Ishizuka et al., Loss of ADAR1 in tumours overcomes resistance to immune checkpoint blockade. Nature. Jan. 2019;565(7737):43-48. doi: 10.1038/s41586-018-0768-9. Epub Dec. 17, 2018. |
Iyama et al., DNA repair mechanisms in dividing and non-dividing cells. DNA Repair (Amst). Aug. 2013;12(8):620-36. doi: 10.1016/j.dnarep.2013.04.015. Epub May 16, 2013. |
Jia et al., The MLH1 A'lPase domain is needed for suppressing aberrant formation of interstitial telomeric sequences. DNA Repair (Amst). May 2018;65:20-25. doi: 10.1016/j.dnarep.2018.03.002. Epub Mar. 7, 2018. |
Johnson et al., Trans insertion-splicing: ribozyme-catalyzed insertion of targeted sequences into RNAs. Biochemistry. Aug. 9, 2005;44(31):10702-10. doi: 10.1021/bi0504815. |
Kan et al., Mechanisms of precise genome editing using oligonucleotide donors. Genome Res. Jul. 2017;27(7):1099-1111. doi: 10.110l/gr.214775.116. Epub Mar. 29, 2017. |
Kang et al., Precision genome engineering through adenine base editing in plants. Nat Plants. Jul. 2018;4(7):427-431. doi: 10.1038/s41477-018-0178-x. Epub Jun. 4, 2018. Erratum in: Nat Plants. Sep. 2018;4(9):730. |
Kim et al., RAD51 mutants cause replication defects and chromosomal instability. Mol Cell Biol. Sep. 2012;32(18):3663-80. doi: 10.1128/MCB.00406-12. Epub Jul. 9, 2012. |
King et al., No gain, no pain: NaV1.7 as an analgesic target. ACS Chem Neurosci. Sep. 17, 2014;5(9):749-51. doi: 10.1021/cn500171p. Epub Aug. 1, 2014. |
Knott et al., CRISPR-Cas guides the future of genetic engineering. Science. Aug. 31, 2018;361(6405):866-869. doi: 10.1126/science.aat5011. |
Kumar et al., Gene therapy for chronic neuropathic pain: how does it work and where do we stand today? Pain Med. May 2011;12(5):808-22. doi: 10.1111/j.1526-4637.2011.01120.x. |
Le et al., SMNDelta7, the major product of the centromeric survival motor neuron (SMN2) gene, extends survival in mice with spinal muscular atrophy and associates with full-length SMN. Hum Mol Genet. Mar. 15, 2005;14(6):845-57. doi: 10.1093/hmg/ddi078. Epub Feb. 9, 2005. |
Lee et al., A monoclonal antibody that targets a NaV1.7 channel voltage sensor for pain and itch relief. Cell. Jun. 5, 2014;157(6):1393-1404. doi: 10.1016/j.cell.2014.03.064. Epub May 22, 2014. Retraction in: Cell. Jun. 25, 2020;181(7):1695. |
Lefebvre et al., Identification and characterization of a spinal muscular atrophy-determining gene. Cell. Jan. 13, 1995;80(1):155-65. doi: 10.1016/0092-8674(95)90460-3. |
Li et al., Programmable Single and Multiplex Base-Editing in Bombyx mori Using RNA-Guided Cytidine Deaminases. G3 (Bethesda). May 4, 2018;8(5):1701-1709. doi: 10.1534/g3.118.200134. |
Liao et al., One-step assembly of large CRISPR arrays enables multi-functional targeting and reveals constraints on array design. bioRxiv. May 2, 2018. doi: 10.1101/312421. 45 pages. |
Liefke et al., The oxidative demethylase ALKBH3 marks hyperactive gene promoters in human cancer cells. Genome Med. Jun. 30, 2015;7(1):66. doi: 10.1186/s13073-015-0180-0. |
Lin et al., [Construction and evaluation of DnaB split intein high expression vector and a six amino acids cyclic peptide library]. Sheng Wu Gong Cheng Xue Bao. Nov. 2008;24(11):1924-30. Chinese. |
Lindahl, T., Instability and decay of the primary structure of DNA. Nature. Apr. 22, 1993;362(6422):709-15. doi: 10.1038/362709a0. |
Liu et al., Human BRCA2 protein promotes RAD51 filament formation on RPA-covered single-stranded DNA. Nat Struct Mol Biol. Oct. 2010;17(10):1260-2. doi: 10.1038/nsmb.l904. Epub Aug. 22, 2010. |
Liu et al., Intrinsic Nucleotide Preference of Diversifying Base Editors Guides Antibody Ex Vivo Affinity Maturation. Cell Rep. Oct. 23, 2018;25(4):884-892.e3. doi: 10.1016/j.celrep.2018.09.090. |
Lorson et al., A single nucleotide in the SMN gene regulates splicing and is responsible for spinal muscular atrophy. Proc Natl Acad Sci U S A. May 25, 1999;96(11):6307-11. doi: 10.1073/pnas.96.11.6307. |
Lutz et al., Postsymptomatic restoration of SMN rescues the disease phenotype in a mouse model of severe spinal muscular atrophy. J Clin Invest. Aug. 2011;121(8):3029-41. doi: 10.1172/JCI57291. Epub Jul. 25, 2011. |
Ma et al., Human RAD52 interactions with replication protein A and the RAD51 presynaptic complex. J Biol Chem. Jul. 14, 2017;292(28):11702-11713. doi: 10.1074/jbc.M117.794545. Epub May 27, 2017. |
Madura et al., Structural basis for ineffective T-cell responses to MHC anchor residue-improved “heteroclitic” peptides. Eur J Immunol. Feb. 2015;45(2):584-91. doi: 10.1002/eji.201445114. Epub Dec. 28, 2014. |
Marsden et al., The Tumor-Associated Variant RAD51 G151D Induces a HyperRecombination Phenotype. PLoS Genet. Aug. 11, 2016;12(8):e1006208. doi: 10.1371/journal.pgen.1006208. |
Martz, L., Nav-i-gating antibodies for pain. Science-Business exchange. Jun. 12, 2014;7(662):1-2. doi: 10.1038/scibx.2014.662. |
Mason et al., Non-enzymatic roles of human RAD51 at stalled replication forks. bioRxiv. Jul. 31, 2019; doi.org/10.1101/359380. 36 pages. bioRxiv preprint first posted online Jul. 31, 2019. |
Mendell et al., Single-Dose Gene-Replacement Therapy for Spinal Muscular Atrophy. N Engl J Med. Nov. 2, 2017;377(18):1713-1722. doi: 10.1056/NEJMoa1706198. |
Meyer et al., Ribosome biogenesis factor Tsr3 is the aminocarboxypropyl transferase responsible for 18S rRNA hypermodification in yeast and humans. Nucleic Acids Res. May 19, 2016;44(9):4304-16. doi: 10.1093/nar/gkw244. Epub Apr. 15, 2016. |
Monani et al., A single nucleotide difference that alters splicing patterns distinguishes the SMA gene SMN1 from the copy gene SMN2. Hum Mol Genet. Jul. 1999;8(7): 1177-83. doi: 10.1093/hmg/8.7.1177. |
Mootz et al., Protein splicing triggered by a small molecule. J Am Chem Soc. Aug. 7, 2002;124(31):9044-5 and Supporting Information, doi: 10.1021/ja026769o. 4 pages. |
Muller, U.F., Design and Experimental Evolution of trans-Splicing Group I Intron Ribozymes. Molecules. Jan. 2, 2017;22(1):75. doi: 10.3390/molecules22010075. |
Murray et al., Selective vulnerability of motor neurons and dissociation of pre- and post-synaptic pathology at the neuromuscular junction in mouse models of spinal muscular atrophy. Hum Mol Genet. Apr. 1, 2008;17(7):949-62. doi: 10.1093/hmg/ddm367. Epub Dec. 8, 2007. |
Murugan et al., The Revolution Continues: Newly Discovered Systems Expand the CRISPR-Cas Toolkit. Mol Cell. Oct. 5, 2017;68(1):15-25. doi: 10.1016/j.molcel.2017.09.007. |
Nelson et al., In vivo genome editing improves muscle function in a mouse model of Duchenne muscular dystrophy. Science. Jan. 22, 2016;351(6271):403-7. doi: 10.1126/science.aad5143. Epub Dec. 31, 2015. |
Nelson et al., The unstable repeats—three evolving faces of neurological disease. Neuron. Mar. 6, 2013;77(5):825-43. doi: 10.1016/j.neuron.2013.02.022. |
Noack et al., Epitranscriptomics: A New Regulatory Mechanism of Brain Development and Function. Front Neurosci. Feb. 20, 2018;12:85. doi: 10.3389/fnins.2018.00085. 9 pages. |
Ottesen, ISS-N1 makes the First FDA-approved Drug for Spinal Muscular Atrophy. Transl Neurosci. Jan. 26, 2017;8:1-6. doi: 10.1515/tnsci-2017-0001. |
Parente et al., Advances in spinal muscular atrophy therapeutics. Ther Adv Neurol Disord. Feb. 5, 2018;11:1756285618754501. doi: 10.1177/1756285618754501. 13 pages. |
Passini et al., Antisense oligonucleotides delivered to the mouse CNS ameliorate symptoms of severe spinal muscular atrophy. Sci Transl Med. Mar. 2, 2011;3(72):72ra18. doi: 10.1126/scitranslmed.3001777. |
Pellegrini et al., Insights into DNA recombination from the structure of a RAD51-BRCA2 complex. Nature. Nov. 21, 2002;420(6913):287-93. doi: 10.1038/nature01230. Epub Nov. 10, 2002. |
Perez-Palma et al., Simple ClinVar: an interactive web server to explore and retrieve gene and disease variants aggregated in ClinVar database. Nucleic Acids Res. Jul. 2, 2019;47(W1):W99-W105. doi: 10.1093/nar/gkz411. |
Perreault et al., Mixed deoxyribo- and ribo-oligonucleotides with catalytic activity. Nature. Apr. 5, 1990;344(6266):565-7. doi: 10.1038/344565a0. |
Pieken et al., Kinetic characterization of ribonuclease-resistant 2′-modified hammerhead ribozymes. Science. Jul. 19, 1991;253(5017):314-7. doi: 10.1126/science.1857967. |
Porensky et al., A single administration of morpholino antisense oligomer rescues spinal muscular atrophy in mouse. Hum Mol Genet. Apr. 1, 2012;21(7):1625-38. doi: 10.1093/hmg/ddr600. Epub Dec. 2, 2011. |
Prasad et al., Visualizing the assembly of human Rad51 filaments on double-stranded DNA. J Mol Biol. Oct. 27, 2006;363(3):713-28. doi: 10.1016/j.jmb.2006.08.046. Epub Aug. 22, 2006. |
Raillard et al., Targeting sites within HIV-1 cDNA with a DNA-cleaving ribozyme. Biochemistry. Sep. 10, 1996;35(36):11693-701. doi: 10.1021/bi960845g. |
Rajagopal et al., High-throughput mapping of regulatory DNA. Nat Biotechnol. Feb. 2016;34(2):167-74. doi: 10.1038/nbt.3468. Epub Jan. 25, 2016. |
Richardson et al., CRISPR-Cas9 genome editing in human cells occurs via the Fanconi anemia pathway. Nat Genet. Aug. 2018;50(8):1132-1139. doi: 10.1038/s41588-018-0174-0. Epub Jul. 27, 2018. |
Richardson et al., Frequent chromosomal translocations induced by DNA double-strand breaks. Nature. Jun. 8, 2000;405(6787):697-700. doi: 10.1038/35015097. |
Robertson et al., Selection in vitro of an RNA enzyme that specifically cleaves single-stranded DNA. Nature. Mar. 29, 1990;344(6265):467-8. doi: 10.1038/344467a0. |
Rodriguez-Muela et al., Single-Cell Analysis of SMN Reveals Its Broader Role in Neuromuscular Disease. Cell Rep. Feb. 7, 2017;18(6):1484-1498 and Supplemental Information. doi: 10.1016/j.celrep.2017.01.035. |
Safari et al., CRISPR Cpf1 proteins: structure, function and implications for genome editing. Cell Biosci. May 9, 2019;9:36. doi: 10.1186/s13578-019-0298-7. |
Samanta et al., A reverse transcriptase ribozyme. Elife. Sep. 26, 2017;6:e31153. doi: 10.7554/eLife.31153. |
San Filippo et al., Mechanism of eukaryotic homologous recombination. Annu Rev Biochem. 2008;77:229-57. doi: 10.1146/annurev.biochem.77.061306.125255. |
Schlacher et al., Double-strand break repair-independent role for BRCA2 in blocking stalled replication fork degradation by MRE11. Cell. May 13, 2011;145(4):529-42. doi: 10.1016/j.cell.2011.03.041. Erratum in: Cell. Jun. 10, 2011;145(6):993. |
Schrank et al., Inactivation of the survival motor neuron gene, a candidate gene for human spinal muscular atrophy, leads to massive cell death in early mouse embryos. Proc Natl Acad Sci U S A. Sep. 2, 1997;94(18):9920-5. doi: 10.1073/pnas.94.18.9920. |
Sharma et al., Identification of novel methyltransferases, Bmt5 and Bmt6, responsible for the m3U methylations of 25S rRNA in Saccharomyces cerevisiae. Nucleic Acids Res. Mar. 2014;42(5):3246-60. doi: 10.1093/nar/gkt1281. Epub Dec. 11, 2013. |
Shechner et al., Multiplexable, locus-specific targeting of long RNAs with CRISPR-Display. Nat Methods. Jul. 2015;12(7):664-70. doi: 10.1038/nmeth.3433. Epub Jun. 1, 2015. |
Shen et al., Efficient genome modification by CRISPR-Cas9 nickase with minimal off-target effects. Nat Methods. Apr. 2014;11(4):399-402. doi: 10.1038/nmeth.2857. Epub Mar. 2, 2014. |
Singh et al., Splicing of a critical exon of human Survival Motor Neuron is regulated by a unique silencer element located in the last intron. Mol Cell Biol. Feb. 2006;26(4):1333-46. doi: 10.1128/MCB.26.4.1333-1346.2006. |
Song et al., RS-1 enhances CRISPR/Cas9- and TALEN-mediated knock-in efficiency. Nat Commun. Jan. 28, 2016;7:10548. doi: 10.1038/ncomms10548. |
Stark et al., ATP hydrolysis by mammalian RAD51 has a key role during homology-directed DNA repair. J Biol Chem. Jun. 7, 2002;277(23):20185-94. doi: 10.1074/jbc.M112132200. Epub Mar. 28, 2002. |
Sullenger et al., Ribozyme-mediated repair of defective mRNA by targeted, trans-splicing. Nature. Oct. 13, 1994;371(6498):619-22. doi: 10.1038/371619a0. |
Sumner et al., Two breakthrough gene-targeted treatments for spinal muscular atrophy: challenges remain. J Clin Invest. Aug. 1, 2018;128(8):3219-3227. doi: 10.1172/JCI121658. Epub Jul. 9, 2018. |
Suzuki et al., Crystal structures reveal an elusive functional domain of pyrrolysyl-tRNA synthetase. Nat Chem Biol. Dec. 2017;13(12):1261-1266. doi: 10.1038/nchembio.2497. Epub Oct. 16, 2017. |
Talbot et al., Spinal muscular atrophy. Semin Neurol. Jun. 2001;21(2):189-97. doi: 10.1055/s-2001-15264. |
Tan et al., Engineering of high-precision base editors for site-specific single nucleotide replacement. Nat Commun. Jan. 25, 2019;10(1):439. doi: 10.1038/s41467-018-08034-8. Erratum in: Nat Commun. May 1, 2019;10(1):2019. |
Thompson et al., The Future of Multiplexed Eukaryotic Genome Engineering. ACS Chem Biol. Feb. 16, 2018;13(2):313-325. doi: 10.1021/acschembio.7b00842. Epub Dec. 28, 2017. |
Trojan et al., Functional analysis of hMLH1 variants and HNPCC-related mutations using a human expression system. Gastroenterology. Jan. 2002;122(1):211-9. doi: 10.1053/gast.2002.30296. |
Usman et al., Exploiting the chemical synthesis of RNA. Trends Biochem Sci. Sep. 1992;17(9):334-9. doi: 10.1016/0968-0004(92)90306-t. |
Vakulskas et al., A high-fidelity Cas9 mutant delivered as a ribonucleoprotein complex enables efficient gene editing in human hematopoietic stem and progenitor cells. Nat Med. Aug. 2018;24(8):1216-1224. doi: 10.1038/s41591-018-0137-0. Epub Aug. 6, 2018. |
Van Den Oord et al., Pixel Recurrent Neural Networks. Proceedings of the 33rd International Conference on Machine Learning. Journal of Machine Learning Research. Aug. 19, 2016. vol. 48. 11 pages. |
Villiger et al., Treatment of a metabolic liver disease by in vivo genome base editing in adult mice. Nat Med. Oct. 2018;24(10):1519-1525. doi: 10.1038/s41591-018-02091. Epub Oct. 8, 2018. |
Wan et al., Material solutions for delivery of CRISPR/Cas-based genome editing tools: Current status and future outlook. Materials Today. Jun. 2019;26:40-66. doi: 10.1016/j.mattod.2018.12.003. |
Wills et al., Pseudoknot-dependent read-through of retroviral gag termination codons: importance of sequences in the spacer and loop 2. EMBO J. Sep. 1, 1994;13(17):4137-44. doi: 10.1002/j.1460-2075.1994.tb06731.x. |
Wirth et al., Mildly affected patients with spinal muscular atrophy are partially protected by an increased SMN2 copy number. Hum Genet. May 2006;119(4):422-8. doi: 10.1007/s00439-006-0156-7. Epub Mar. 1, 2006. |
Woo et al., Gene activation of SMN by selective disruption of IncRNA-mediated recruitment of PRC2 for the treatment of spinal muscular atrophy. Proc Natl Acad Sci U S A. Feb. 21, 2017;114(8):E1509-E1518 .doi:10.1073/pnas.1616521114. Epub Feb. 13, 2017. |
Yamane et al., Deep-sequencing identification of the genomic targets of the cytidine deaminase AID and its cofactor RPA in B lymphocytes. Nat Immunol. Jan. 2011;12(1):62-9. doi: 10.1038/ni.1964. Epub Nov. 28, 2010. |
Yan et al., Highly Efficient A⋅T to G⋅C Base Editing by Cas9n-Guided tRNA Adenosine Deaminase in Rice. Mol Plant. Apr. 2, 2018;11(4):631-634. doi: 10.1016/j.molp.2018.02.008. Epub Feb. 22, 2018. |
Yang et al., BRCA2 function in DNA binding and recombination from a BRCA2-DSS1-ssDNA structure. Science. Sep. 13, 2002;297(5588):1837-48. doi: 10.1126/science.297.5588.1837. |
Yang et al., Genome-wide inactivation of porcine endogenous retroviruses (PERVs). Science. Nov. 27, 2015;350(6264):1101-4. doi: 10.1126/science.aad1191. Epub Oct. 11, 2015. |
Yang et al., The BRCA2 homologue Brh2 nucleates RAD51 filament formation at a dsDNA-ssDNA junction. Nature. Feb. 10, 2005;433(7026):653-7. doi: 10.1038/nature03234. |
Yu et al., Dynamic control of Rad51 recombinase by self-association and interaction with BRCA2. Mol Cell. Oct. 2003;12(4):1029-41. doi: 10.1016/s1097-2765(03)00394-0. |
Zeng et al., Correction of the Marfan Syndrome Pathogenic FBN1 Mutation by Base Editing in Human Cells and Heterozygous Embryos. Mol Ther. Nov. 7, 2018;26(11):2631-2637. doi: 10.1016/j.ymthe.2018.08.007. Epub Aug. 14, 2018. |
Zhang et al., Efficient precise knockin with a double cut HDR donor after CRISPR/Cas9-mediated double-stranded DNA cleavage. Genome Biol. Feb. 20, 2017;18(1):35. doi: 10.1186/s13059-017-1164-8. |
Zhang et al., Global analysis of small RNA and mRNA targets of Hfq. Mol Microbiol. Nov. 2003;50(4):1111-24. doi: 10.1046/j.1365-2958.2003.03734.x. |
Zhang et al., Large genomic fragment deletions and insertions in mouse using CRISPR/Cas9. PLoS One. Mar. 24, 2015;10(3):e0120396. doi: 10.1371/journal.pone.0120396. 14 pages. |
Zhang et al., Reversible RNA Modification N1-methyladenosine (m1A) in mRNA and tRNA. Genomics Proteomics Bioinformatics. Jun. 2018;16(3):155-161. doi: 10.1016/j.gpb.2018.03.003. Epub Jun. 14, 2018. |
Zhou et al., GISSD: Group I Intron Sequence and Structure Database. Nucleic Acids Res. Jan. 2008;36(Database issue):D31-7. doi: 10.1093/nar/gkm766. Epub Oct. 16, 2007. |
Zolotukhin et al., Production and purification of serotype 1, 2, and 5 recombinant adeno-associated viral vectors. Methods. Oct. 2002;28(2):158-67. doi: 10.1016/s1046-2023(02)00220-7. |
Number | Date | Country | |
---|---|---|---|
20190367891 A1 | Dec 2019 | US |
Number | Date | Country | |
---|---|---|---|
62456048 | Feb 2017 | US | |
62372755 | Aug 2016 | US |