Patent Application
20160009824
The present invention relates to tetravalent bispecific antibodies (TetBiAbs), methods of making and methods of using the same for the treatment of cancer or immune disorders and for diagnostics.
Recent technological advances in antibody engineering have focused on using bispecific approaches to (1) engage effector cells for redirected lysis of tumor cells, (2) increase binding avidity and specificity of the targeting, or to (3) combine two drug candidates in one for regulatory and commercial reasons. In the first approach, the bispecific antibody acts as a bridge between the disease-causing cell and an effector cell through engagement of CD3 (Baeuerle et al, Cancer Res. 69:4941, 2009), CD16 (Weiner et al, Cancer Immunol. Immunother. 45:190, 1997), or CD64 (Graziano et al, Cancer Immunol. Immunother. 45:124, 1997) for redirected lysis. In the second approach, the selectivity for a target or a target cell can be significantly increased by combining two antibodies with mediocre binding affinities into a biparatopic (binding to two distinct epitopes on the same target antigen) or a bispecific (binding to two different antigens on the same target cell) antibody, respectively. The third approach is exemplified by simultaneous binding of two soluble cytokines (Mabry et al, Protein Eng. Des. & Sel. 23:115, 2010; Wu et al, Nature Biotech. 25:1290, 2007), which exploits the potential synergism of dual targeting in the appropriate disease setting. In addition to providing exquisite binding specificity through the variable regions, IgG also has effector functions and a very long serum half-life, and therefore, is often the preferred backbone for designing bispecific antibodies.
Current bispecific antibody technologies mostly rely on the scFv (single-chain fragment of the variable regions) format (Coloma and Morrison, Nature Biotechnol. 15:159, 1997; Lu et al, J. Biol. Chem. 280:19665, 2005) in which each VH (variable region of the heavy chain) is covalently linked to its cognate VL (variable region of the light chain), because in a Fab format there is yet no existing technology that can direct the specific pairing of a free light chain to only its cognate heavy chain and therefore the free light chains of different antigen specificity pair randomly with the heavy chains. However, expression of single-chain antibodies is often technically challenging, due to possible loss of binding affinity, protein aggregation, poor stability, and low production level (Demarest et al, Curr. Opin. Drug Discov. Devel. 11:675, 2008; Michaelson et al, mAbs 1:2, 128-141, 2009). This is especially true if the starting antibody is from a hybridoma (as opposed to a single-chain antibody from a phage display library) that has to be reformatted into a single-chain antibody. On the other hand, scFv's isolated from phages often are expressed poorly in mammalian cells.
Several innovative technologies have enabled the almost exclusive assembly of the Fc heterodimer to provide the backbone for designing bispecificity, e.g. knob-in-hole (Ridgway et al, Protein Eng. 9:617, 1996), electrostatic steering (Gunasekaran et al, J. Biol. Chem. 285:19637, 2010) and strand-exchange engineering domain (SEED) (Davis, Protein Eng. Des. & Sel. 23:195, 2010). However, there is yet no existing technology that can direct the specific pairing of a free light chain to only its cognate heavy chain that would allow for the engineering of a bispecific antibody relying on a native heavy chain-light chain Fab format. Due to the aforementioned problems with the scFv format, some technologies screen for a common light chain for the two different Fab's (Merchant et al, Nature Biotechnol. 16:677, 1998), or use single variable domains to avoid the use of the light chain altogether (Shen et al, J. Immunol. Methods 318:65, 2007).
In the Dual Variable Domains (DVD)-Ig approach, the VL and VH of the second antibody are fused via flexible linkers to the N-termini of the light and heavy chains, respectively, of the first antibody, creating two variable domains (VD) in tandem, called the outer VD and the inner VD (Wu et al, ibid). Due to the steric hindrance caused by the proximity of the outer VD to the ligand-binding site of the inner VD, extensive optimization involving VD selection from a number of available monoclonal antibodies, orientation of VDs, and linker designs, most of which have to be empirically determined, is necessary to retain the binding affinity of the inner VD (DiGiammarino et al, Methods Mol. Biol. 899:145, 2012).
Another method takes advantage of the preferential species-restricted heavy and light chain pairing in rat/mouse quadromas (Lindhofer et al, J. Immunol. 155:219, 1995). However, the bispecific antibody generated is a rat/mouse antibody, which obviously has immunogenicity issues as a therapeutic.
The Crossmab approach, based on the knob-into-hole heterodimerized heavy chains, in addition uses immunoglobulin domain crossover as a generic approach for the production of bispecific IgG antibodies (Schaefer et al, Proc. Natl. Acad. Sci. USA, 108:11187, 2011). Nevertheless, the correct pairings of the H chain heterodimer and the cognate Fv's are not exclusive, and the unwanted side products have to be removed during purification.
An extension of the Crossmab approach was used to generate a tetravalent bispecific antibody by tagging an extra set of Fab and Crossmab Fab fragments to the C-termini of Crossmab (Regula et al, US Patent Application No: 2010/0322,934), and the challenges of obtaining exclusively correct pairings of the H chain heterodimer and the cognate Fv's remain.
A further approach to bispecificity is to use a single binding site to target two different antigens was demonstrated by a “two-in-one” antibody. One such “two-in-one” antibody is a variant of the antibody Herceptin, which interacts with both Her2 and VEGF (Bostrom et al, Science 323:1610, 2009). This approach is attractive for clinical applications because it provides a bispecific antibody that has an identical format as a normal IgG. However, screening for such a variant is very labor intensive and there is no guarantee that a single binding site which can bind both antigens of interest can be obtained.
A stable multivalent antibody with only monospecificity based on a single set of Fab fragments was described in US published patent application US2011/0076722. Another technology uses Dock-and-Lock domains to link preformed Fab fragments of a different specificity to an antibody to form a hexavalent bispecific antibody (Rossi et al, Cancer Res. 68:8384, 2008).
Since the vast majority of antibodies (i.e. those generated from hybridomas, Fab libraries and B-cell cloning, regardless of whether the origin is from normal mice, rats, and rabbits, or transgenic (humanized) mice or rats, or patients) have a free light chain paired with its cognate heavy chain, a Fab-based technology for bispecific antibodies that circumvents the problem of random light chain pairing is urgently needed. Such a technology would facilitate straightforward and efficient production of a bispecific antibody from two existing antibodies, which can be used first as a versatile tool molecule to probe the potential synergism of dual targeting, and secondly as a therapeutic to exploit the dual targeting in the context of a complete antibody in the disease setting to be treated.
The present invention features tetravalent bispecific antibodies (TetBiAb). In a general embodiment of the invention, the antibody contains an antibody Fc region linked at its C-terminus by means of Fab light chains to a Fab. In one embodiment of a TetBiAb, an antibody is covalently linked at its C-terminus by means of Fab light chains to a second pair of Fabs with a second binding specificity, wherein the linked Fab light chain is paired with a free cognate Fab heavy chain. Conversely, the Fab heavy chain at the N-terminus of the antibody pairs as usual with its cognate free light chain. The resulting antibody is bivalent for each of its binding specificities. The arrangement of the polypeptide chains in a TetBiAb is schematically depicted in
In an alternate embodiment of a TetBiAb, an antibody Fc region is linked at its N-terminus by means of Fab light chains to a Fab of a first specificity, wherein the linked Fab light chain is paired with a free cognate Fab heavy chain, and additionally, the antibody Fc region is linked at its C-terminus by means of Fab heavy chains to a Fab of a second specificity. The linked Fab heavy chain at the C-terminus of the antibody pairs as usual with its cognate free light chain. Again, the resulting antibody is bivalent for each of its binding specificities. The arrangement of the polypeptide chains in this alternate TetBiAb is schematically depicted in
Thus, in one embodiment of the invention, a TetBiAb comprises (i) a first polypeptide, comprising an antibody heavy chain of a first antibody, wherein the heavy chain contains a variable domain and constant domains of the first antibody (VH(1)-CH1-hinge-CH2-CH3), where the heavy chain is linked at its C-terminus, either directly or indirectly, by a peptide bond to the N-terminus of an antibody light chain of a second antibody, wherein the light chain contains a variable and a constant domain of the second antibody (VL(2)-CL); (ii) a second polypeptide comprising the antibody light chain of the first antibody, wherein the light chain of the first antibody contains a variable and a constant domain (VL(1)-CL); and (iii) a third polypeptide comprising the Fab heavy chain of the second antibody and lacking CH2 and CH3 constant domains (VH(2)-CH1). It is understood that the first and second antibodies have different binding specificities, i.e., the antibodies specifically bind to distinct epitopes. These polypeptides assemble into a complete tetravalent bispecific antibody In a further embodiment of the invention, the first polypeptide of the TetBiAb (VH(1)-CH1-hinge-CH2-CH3-(L)-VL(2)-CL) further comprises a linker operably linking the C-terminus of the heavy chain constant domains to the N-terminus of the light chain variable domain. In ine embodiment, the linker has the amino acid sequence (GGGGS)n (SEQ ID NO:6), wherein n is an integer between 1 and 10. In yet a further embodiment the linker is a (GGGGS)n where n is 4.
In a further embodiment of the invention, the heavy chain constant domains of said first polypeptide of the TetBiAb are IgG constant domains.
In a further embodiment of the invention, said first polypeptide of the TetBiAb lacks a CH2 domain.
In a further embodiment of the invention, the third polypeptide, (VH(2)-CH1), includes an upper hinge region at its C-terminus, having the sequence EPKSC (SEQ ID NO:10).
In another aspect of the invention, DNA molecules are provided encoding the polypeptide chains forming the TetBiAb. In one embodiment, a DNA molecule comprising a first DNA sequence is provided, wherein the DNA sequence encodes a heavy chain of the first antibody (VH(1)-CH1-hinge-CH2-CH3) genetically fused via an optional linker to a light chain of a second antibody (VL(2)-CL), to give a sequence encoding VH(1)-CH1-hinge-CH2-CH3-(optional linker)-VL(2)-CL. In a further embodiment, a second DNA sequence is additionally provided to the first DNA sequence, wherein the second sequence encodes a light chain of the first antibody (VL(1)-CL). In a further embodiment, a third DNA sequence is additionally provided, wherein the third sequence encodes a Fab heavy chain of the second antibody (VH(2)-CH1), optionally linked to an additional sequence encoding a hinge region having the amino acid sequence EPKSC (SEQ ID NO:10). In a further embodiment, at least one of the first, second or third DNA sequences are contained on a separate DNA molecule.
In another embodiment of the invention, a DNA molecule containing a first, second and third gene construct is provided, wherein the first construct encodes the heavy chain of the first antibody (VH(1)-CH1-hinge-CH2-CH3) genetically fused via an optional linker to the light chain of a second antibody (VL(2)-CL) to give a sequence encoding VH(1)-CH1-hinge-CH2-CH3-optional linker-VL(2)-CL; the second construct encodes the light chain of the first antibody (VL(1)-CL); and the third construct encodes the Fab heavy chain of the second antibody (VH(2)-CH1), optionally linked to an additional sequence encoding a hinge region (amino acid sequence EPKSC, SEQ ID NO:10; see
The invention further provides for host cells carrying the DNA molecules of the invention.
The invention further provides for methods of producing the TetBiAbs of the invention.
In another aspect of the invention, methods to select appropriate target binding specificities for the TetBiAbs of the invention are provided.
Also provided are specific TetBiAbs. In one embodiment, the TetBiAb targets CD20 and CD16.
In another embodiment the TetBiAb targets EGFR and CD16. In a further embodiment the TetBiAb targets CD20 and CD47. In yet a further embodiment the TetBiAb targets CD20 and CD52. In yet a further embodiment, the TetBiAb targets EpCam and CD47.
One aspect of the invention provides methods of treating an individual having cancer or an immune related condition, with a TetBiAb of the invention, comprising administering to the individual a therapeutically effective amount of the TetBiAb, for example, TetBiAbs of the embodiments listed above, to treat the condition.
The present invention overcomes a fundamental problem in the cellular expression, assembly and purification of a bispecific antibody comprising two Fab fragments with different binding specificities: the two species of free light chains randomly pair with Fab heavy chains, resulting in the production of multiple aberrant antibody species. These aberrant antibodies may be difficult to purify away from the desired product and affect product yield. In the technology of the present invention, only one species of free light chain is present and the desired bispecific antibody product is readily obtained.
In a general embodiment of the invention, the antibody contains an antibody Fc region, wherein the Fc heavy chains are linked at their C-termini by means of a Fab light chain to a Fab.
More specifically, the invention provides for tetravalent bispecific antibodies (TetBiAbs), in which a second Fab fragment with a second binding specificity is linked to the C-terminal ends of an antibody by means of the Fab light chains. These linked Fab light chains can then pair with free cognate Fab heavy chains. Conversely, the Fab heavy chain region normally residing at the N-terminus of the antibody can pair with its cognate free light chain. The resulting antibody is bivalent for each of its binding specificities. The arrangement of the polypeptide chains in a TetBiAb is schematically depicted in
A variation of the TetBiAb results in an inverted arrangement of the TetBiAb: the light chains are linked N-terminal the Fc polypeptide chains and the second set of Fabs with a second binding specificity are linked to the C-terminal ends of an Fc region by means of the Fab heavy chains. This arrangement of the polypeptide chains in a TetBiAb is schematically depicted in
The terms “Fab fragment” or simply “Fab” are used interchangeably, and are used herein to describe the antigen-binding portion of the antibody, essentially as obtained by papain digestion of an IgG antibody. The Fab fragment is heterodimeric, composed of two polypeptides, a light chain having a variable (VL) and constant (CL) domain, and a heavy chain having a variable (VH) and a first constant domain (CH1) and may also include the upper hinge region, particularly if the Fab is of a IgG1 subclass. The polypeptide chains are not linked to one another by a peptide bond but associate with one another by non-covalent interactions and by a disulfide bond if the upper hinge region of the heavy chain is present.
As used herein, the term “Fab heavy chain” denotes a polypeptide composed of a VH domain and a CH1 domain but does not contain a CH2 domain or a CH3 domain. The polypeptide may contain in addition the upper hinge region of the antibody hinge, particularly if the Fab is of a IgG1 subclass.
As used herein, the term “light chain” (LC) or “Fab light chain” denotes a polypeptide composed of a VL domain and a CL domain. Antibody light chains are classified as either kappa or lambda light chains or kappa.
As used herein, the term “free light chain” or “free Fab heavy chain” describes a polypeptide component of the antibody of the invention that is not linked to the Fc polypeptide chain by a peptide bond.
As used herein, the term “Fc region” describes the portion of the antibody which binds to Fc receptors and certain complement proteins, and essentially corresponds to the fragment traditionally obtained by papain digestion but including the upper hinge region. The Fc region is typically homodimeric, composed of two identical polypeptide chains derived from the antibody heavy chain, typically containing the hinge, a CH2 and a CH3 domain, but not a CH1 domain (“Fc heavy chain”; in a IgG1 polypeptide, the Fc heavy chain hinge begins at residue 216 as defined by the EU numbering system, corresponding to the amino acid glutamate). In certain embodiments the CH2 domain may be lacking. In other embodiments, the Fc region may contain mutations that affect, for example, effector function engagement or antibody half-life. The polypeptide chains associate with one another by non-covalent interactions in the CH3 domain and disulfide bonds in the hinge domain.
As used herein, the term “domain” describes a structurally or functionally defined element or constituent part of, for example, a protein or polypeptide chain. An example of a Fc heavy chain constant domain is a CH2 domain or a CH3 domain. An example of a Fab domain is a light chain variable domain (VL) or a Fab heavy chain constant domain (CH1).
As used herein, the terms “monovalent”, “bivalent”, “tetravalent” refer to the number (one, two or four, respectively) of antigen binding elements in a protein.
As used herein, a specific TetBiAb is designated as “anti-Target(1)/“anti-Target(2)”, wherein the order of the targets in the designation reflects the order of the Fab fragments relative to the Fc region. Anti-Target(1)/Anti-Target(2) has the order Fab(anti-Target(1))-Fc-Fab(anti-Target(2)).
In a general embodiment of the invention, a TetBiAb comprises (i) a first polypeptide, comprising an antibody heavy chain of a first antibody, wherein the heavy chain contains a variable domain and constant domains of the first antibody (VH(1)-CH1-hinge-CH2-CH3), where the heavy chain is linked at its C-terminus, either directly or indirectly, by a peptide bond, to the N-terminus of an antibody light chain of a second antibody, wherein the light chain contains a variable and constant domain of the second antibody (VL(2)-CL); (ii) a second polypeptide comprising the antibody light chain of the first antibody, wherein the light chain of the first antibody contains variable and constant domains (VL(1)-CL); and (iii) a third polypeptide comprising the Fab heavy chain of the second antibody and lacking the CH2 and CH3 constant domains (VH(2)-CH1). It is understood that the first and second antibodies have different binding specificities, i.e., the antibodies specifically bind to distinct epitopes. These polypeptides assemble into a complete tetravalent bispecific antibody.
In a further embodiment, the first polypeptide may contain a linker between the C-terminus of the heavy chain constant domain and the N-terminus of the light chain variable domain. In one embodiment the linker is G4S (amino acid sequence GGGGS, SEQ ID NO:6). The linker may contain multiple, concatenated G4S elements, (G4S)n, where n is an integer between 2 and 10. In a further embodiment, n is an integer between 2 and 6. In yet a further embodiment n is 4.
In a further embodiment the free Fab heavy chain polypeptide, VH(2)-CH1 of the TetBiAb described above, further comprises at its C-terminus an Fc hinge region of the amino acid sequence EPKSC (SEQ ID NO:10; “upper hinge region”), which allows the heavy chain polypeptide to form a disulfide bond with its cognate light chain.
In another aspect of the invention, DNA constructs are provided encoding the three polypeptide chains forming the TetBiAb. The first construct encodes a heavy chain of the first antibody (VH(1)-CH1-hinge-CH2-CH3) genetically fused via an optional linker to a light chain of a second antibody (VL(2)-CL) to give the DNA sequence encoding VH(1)-CH1-hinge-CH2-CH3-optional linker-VL(2)-CL; the second construct encodes a light chain of the first antibody (VL(1)-CL); and the third construct encodes a Fab heavy chain of the second antibody (VH(2)-CH1), optionally with in addition the sequence encoding a hinge region (amino acid sequence EPKSC, SEQ ID NO:10; see
In another embodiment the DNA construct encodes a fusion polypeptide, comprising a light chain of the first antibody (VL(1)-CL1) genetically fused to the hinge-CH2-CH3 followed by an optional linker and a Fab heavy chain of a second antibody (VH(2)-CH1) to give the sequence VL(1)-CL1-hinge-CH2-CH3-optional linker-VH(2)-CH1 (
In a further aspect of the invention, methods to produce the TetBiAbs of the invention are provided. Upon coexpression of the three DNA constructs in appropriate expression vectors containing signal peptides for secretion in a host cell, the desired TetBiAb with the two different binding specificities (
It is evident to a person skilled in the art that the three expressed polypeptide chains are not linked to one another by peptide bonds. This invention takes advantage of the fact that there is only one free light chain (VL-CL), so that the random light chain pairing problem is overcome. Another advantage of the invention is the fact that the Fab fragment is very stable, compared to scFv, and an antibody with an extra Fab fragment fused to the C-terminus of its heavy chain is expected to be very stable and produced at a high level in general. Importantly, this invention is based on the expression of one single species of antibody heavy chain fusion polypeptide chain, which pairs specifically with one cognate free light chain polypeptide at one end and one cognate free Fab heavy chain polypeptide at the other end of the fusion polypeptide. Hence a heterodimeric Fc backbone is not needed to provide the means for assembling a bispecific antibody. Therefore, there is no mis-pairing of heavy chains.
It is an object of the invention to provide DNAs that are modular in nature, with respect to the variable regions of the first and second antibody, so that cDNAs encoding the VH and VL of the first and second antibody can be readily assembled without having to introduce, for example, stabilizing mutations and extensive optimization for expression of a bispecific antibody. Such a robust technology to facilitate the production of a bispecific antibody is highly advantageous in discovery of target combinations that may yield synergistic effect in certain disease settings.
Another object of the invention is to provide a stable antibody-based fusion protein suitable for development as a biotherapeutic, featuring Fab fragments to accomplish bispecific binding, and an Fc region, optionally altered, to achieve the desired effector function and half-life profile. Fc variants that affect effector functionand half-life are well understood in the art (see, for example WO 2000/042072). It is well appreciated in the art that Fab fragments are intrinsically more stable than single-chain Fv's (Rothlisberger et al, J. Mol. Biol. 347:773, 2005), they occur naturally as the binding arms of an antibody, and can be used as such without further engineering (Schoonjans et al, J. Immunol. 165:7050, 2000).
In one embodiment, the human IgG1 constant regions and the kappa constant regions are used for the construction of TetBiAbs. To date, all approved therapeutic antibodies are of the immunoglobulin G (IgG) isotype because IgGs are the predominant serum immunoglobulins and are readily manufacturable as biotherapeutics. Furthermore, IgG binds the Fcγ receptors (FcγR) on immune cells to elicit various effector functions and is the only isotype that binds the protective neonatal Fc receptor FcRn, which gives typical IgGs their long serum half-lives in humans. Within the IgG isotype, there are four subclasses, namely IgG1, IgG2, IgG3 and IgG4. The IgG subclass of the antibody, which determines its effector functions, is carefully chosen to suit its therapeutic applications. Accordingly, the IgG1 subclass is chosen when effector functions are desirable, IgG2 is chosen for its lack of FcγR binding to minimize antibody-dependent cellular cytotoxicity (ADCC), and IgG4 is chosen for its low ADCC activity and complete lack of complement-dependent cytotoxicity (CDC). Constant regions of the other immunoglobulin isotypes, such as IgA, IgD, IgE and IgM can also be used for constructing the TetBiAbs. In addition to the heavy chain constant region sequences from the natural isotypes and IgG subclasses, recombinant hybrid isotypes can also be used in this invention (e.g. Gillies, S. D., and Lo, K.-M. Expression technology for proteins containing a hybrid isotype antibody moiety. U.S. Pat. No. 7,148,321). Furthermore, the CH1 used for the C-terminal Fab can be of a different isotype from the CH1 used in the N-terminal Fab. Moreover, if a CH1 of IgG1 is used for the C-terminal Fab, the CH1 may be extended at its C-terminus by an additional five residues EPKSC (SEQ ID NO:10) from the IgG1 upper hinge region, in order to provide the cysteine residue that normally forms a disulfide bond with the light chain (Röthlisberger et al, J Mol Biol. 347:773, 2005). For the light chain constant region, the kappa chain constant region or the lambda chain constant region are used for either the N-terminal Fab or C-terminal Fab, or both
Another object of the invention is to provide TetBiAbs as diagnostic agents with more specific detection, extended dissociation half-times, and improved sensitivity in assays such as Luminex and other multiplex assays, and increase the specific binding of target cells in fluorescence-activated cell sorting (FACS) analysis.
In another aspect, the invention provides methods of producing a TetBiAb for therapeutic application. The method comprises the steps of (a) providing a mammalian cell containing transfected DNA molecules encoding such a tetravalent bispecific antibody; (b) culturing the mammalian cell to produce the tetravalent bispecific antibody; (c) purifying the tetravalent bispecific antibody using conventional techniques well known in the art; and (4) formulating the TetBiAb for therapeutic application. Just like natural antibodies, the TetBiAb retains bivalent binding per target, but in addition, avidity of binding to the disease-causing cell is increased through binding to two disease-related targets on the same cell, resulting in more specific targeting and less side effects. Furthermore, such increased avidity can provide extensive multivalent crosslinking of receptors that often enhance biological activities such as growth arrest, apoptosis, and receptor internalization and degradation. Overall, the multivalent binding and high avidity of a TetBiAb are characteristics that in therapeutic applications have potential for leading to decreased therapeutic dosages and increased efficacy.
Specific non-limiting embodiments for tetravalent bispecific antibodies include anti-EGFR/anti-CD16 (Example 3), anti-CD20/anti-CD16 (Example 4), anti-CD20/anti-CD47 (Example 5), anti-CD20/anti-CD52 (Example 6), anti-EGFR/anti-CD47 (Example 8) and anti-Her2/anti-CD47 (Example 9) in which the specificity of the first antibody is comprised on the N-terminal Fab and the specificity of the second antibody is comprised on the C-terminal Fab (see
One skilled in the art can express both forms of the tetravalent bispecific antibody and then determine which is the preferred form based on expression level, binding affinities of the N-terminal and C-terminal Fabs, and other biological activity assays. In one method, to simplify the construction of the DNA and the analysis of the fusion protein, one skilled in the art expresses the Fab-Fc (a normal antibody) and Fc-Fab for comparison, and determines which antibody Fab domain should be expressed as C-terminal Fabs.
One skilled in the art may also consider the nature of the target antigen in guiding the choice of which Fab to use as the C-terminally linked Fab. As a general rule, accessibility to the target antigen is more constrained at the binding site of the C-terminal Fab, and therefore soluble factors or receptors with large exposed extracellular domains are likely to be more amenable to targeting by a C-terminal Fab. Conversely, target antigens on multi-spanning membrane proteins with only small exposed extra-cellular loop regions or antigen surfaces close to the cell membrane may be less amenable to targeting by a C-terminal Fab.
Without being bound by theory, it is possible that the proximity of the Fc region to the binding site of the C-terminal Fab causes steric hindrance. For binding of a C-terminal Fab to a target, especially a cellular receptor, incorporation of a flexible linker may help to retain binding affinity by relieving steric hindrance. In one embodiment the flexible linker has the amino acid sequence GGGGS. One skilled in the art can readily test the optimal length of the flexible linker by incorporating multiple copies of the GGGGS sequence (SEQ ID NO:6). Generally, up to 10 copies are used, in one embodiment 4 copies are used.
Accordingly, in one embodiment the TetBiAb binds two distinct targets on two different cell types. Exemplary embodiments are an anti-EGFR/anti-CD16 or an anti-CD20/anti-CD16, in which the TetBiAb bridges between the EGFR or CD20 on a target tumor cell and the CD16 on a natural killer cell to direct the natural killer cell to the tumor. In another embodiment the tetravalent bispecific antibody binds two distinct targets on the same cell, such as exemplary embodiments anti-CD20/anti-CD47 or anti-CD20/anti-CD52. In yet another embodiment of the invention, the tetravalent bispecific antibody binds two different epitopes on the same molecular target (i.e. biparatopic). It is also apparent to the one skilled in the art that one or both of the targets of the TetBiAb can be soluble or expressed on a cell surface.
In one exemplary embodiment, the invention provides for an anti-CD20/anti-CD47 TetBiAb comprising an anti-CD20 heavy chain-anti-CD47 light chain fusion polypeptide, an anti-CD20 light chain, and an anti-CD47 Fab heavy chain, wherein:
In a further embodiment, the invention provides for an anti-CD20/anti-CD47 tetravalent bispecific antibody comprising an anti-CD20 heavy chain-anti-CD47 light chain fusion polypeptide, an anti-CD20 light chain, and an anti-CD47 Fab heavy chain, wherein:
In another exemplary embodiment, the invention provides for an anti-CD20/anti-CD47 tetravalent bispecific antibody comprising an anti-CD20 heavy chain-anti-CD47 light chain fusion polypeptide, an anti-CD20 light chain, and an anti-CD47 Fab heavy chain, wherein:
According to another embodiment of the invention, TetBiAbs bind an antigen preferably expressed only on a disease-causing target cell, and is either not expressed or expressed at a low level in healthy tissues. Non-limiting examples of such target antigens include carcinoembryonic antigen, EGFR, EGFRvIII, IGF-1R, HER-2, HER-3, HER-4, MUC1, MUC-1C, EpCAM, PSMA, and gangliosides GD2 and GD3, many of which are tumor-specific antigens. In a TetBiAb, a Fab binding to any one of these tumor-specific antigens can be paired with a Fab that targets an antigen on an effector cell, such as antigens CD3 on a T cell, CD16 on an NK cell, or CD64 on a monocyte, to generate a TetBiAb that promotes lysis of the tumor cell. Such TetBiAbs can be used in the treatment of cancers characterized by the expression of these tumor antigens.
In an alternate embodiment of the invention, a TetBiAb binds an antigen that is expressed on the disease-causing cell and may also be expressed on a class of normal cells, such as is the case, for example, with antigens CD19 and CD20 expressed on normal and malignant B cells. In such a TetBiAb, a Fab binding to CD 19 or CD20 can be paired with a Fab that targets an effector cell, such as CD16 on an NK cell. For example, an anti-CD20/anti-CD16 TetBiAb may be used in the treatment of a hematological malignancy.
In yet another embodiment, a TetBiAb contains the Fabs of two antibodies, each antibody having otherwise mediocre selectivity for the same desired target cell, thereby significantly increasing the selectivity for the desired target compared to each individual antibody. Exemplary embodiments of a TetBiAb containing Fabs that bind any of the disease-specific antigens paired with another Fab that binds a second disease-specific antigen on the same target cell are, for example, anti-Her2/anti-Her3 and anti-EGFR/anti-IGF-1R.
Alternatively, a TetBiAb is directed against any of the disease-specific antigens and against an antigen that is expressed by a class of normal cells. In one exemplary embodiment the TetBiAb is anti-EpCAM/anti-CD47. In yet further exemplary embodiments, a TetBiAb targets two different antigens that are expressed by a class of normal cells, such as anti-CD20/anti-CD47 or anti-CD20/anti-CD52. It yet further embodiments, TetBiAbs contain Fabs in which one or both Fabs bind to a soluble factor, such as any growth factor, e.g., EGF, HGF, VEGF, and CSF-1, or cytokine, e.g. IL-6, IL-10, IL-12 and TNFα.
In another aspect of the invention, the invention provides methods for administering the TetBiAb into subjects, preferably humans, for treatment of diseases such as cancer, inflammatory diseases, autoimmune diseases, and infections.
Methods of preparing and administering a tetravalent bispecific antibody of the invention to a subject are well known to or are readily determined by a person skilled in the art. The route of administration of the tetravalent bispecific antibodies may be oral, parenteral, topical or by inhalation. Examples of parenteral administration include intravenous, intraarterial, intraperitoneal, intramuscular, subcutaneous, rectal or vaginal administration. A preferred form for administration is, for example, a solution for injection, in particular for intravenous or intraarterial injection or drip. Usually, a suitable pharmaceutical composition for injection may further comprise a pharmaceutically acceptable carrier. Examples of pharmaceutically acceptable carrier include saline, sterile water, Ringer's solution, buffered saline, dextrose solution, maltodextrin solution, glycerol, ethanol, etc. Optionally, conventional additives, such as antioxidants, buffers, bacteriostatic agents, etc., may be added to the composition.
The effective dosage of a tetravalent bispecific antibody for the treatment of a patient depends on many different factors, including the route of administration, state of health of the patient, the severity of the disease, the patient's weight, age, and gender, etc. In general, it may administered as a single dose, a daily dose, a weekly dose, a weekly dose, a biweekly dose, a monthly dose, etc. The dose may range from 0.1 mg/kg to 100 mg/kg of the tetravalent bispecific antibody.
In an exemplary embodiment, an effective dose of the TetBiAb anti-CD20/anti-CD47, in the typical range of 1 to 10 mg/kg, is administered intravenously into patients suffering from a B cell disorder, for example, from non-Hodgkin's lymphomas, rheumatoid arthritis, or systemic lupus erythematosus.
In another exemplary embodiment, an effective dose of the tetravalent bispecific antibody anti-EGFR/anti-CD16, in the typical range of 1 to 10 mg/kg, is administered intravenously into patients with solid tumors overexpressing EGFR, such as a colorectal or a lung cancer.
In the treatment of cancer, a tetravalent bispecific antibody may be used in conjunction or in combination with any chemotherapeutic agent or regimen that eliminates, reduces, or controls the growth of neoplastic cells in the patient. Exemplary chemotherapeutic agents include an alkylating agent, a vinca alkaloid, a taxane, an antimetabolite, a nitrosourea agent, a topoisomerase inhibitor, an aromatase inhibitor, a P-glycoprotein inhibitor, a platinum complex derivative, a hormone antagonist, a cytotoxic antibiotic, etc. The amount of chemotherapeutic agent to be used in combination with the tetravalent bispecific antibody may vary by subject and type and severity of disease and may be administered according to what is known in the art. See, for example, Chabner et al., Antineoplastic Agents, in Goodman & Gilman's The Pharmacological Basis of Therapeutics 1233-1287 (Joel G. Hardman et al., eds., 9th ed. 1996).
Other advantages and features of the invention will be apparent from the examples, drawings, and claims that follow.
The following examples serve to illustrate certain preferred embodiments and aspects of the present invention and are not to be construed as limiting the scope thereof.
Unless otherwise noted, the numbering of the amino acid residues in an IgG heavy chain is that of the EU index as in Kabat et al, Sequences of Proteins of Immunological Interest, 5th Ed., Public Health Service, NIH, Bethesda, Md. (1991).
Table 1 provides sequences described herein. All polypeptide sequences of secreted molecules are shown without signal sequence. Variable domain is underlined.
CAGCCCTCACAGAGCCTGTCCATCACCTGCACAGTCTCTGGTTTCTCATTAACTAACTATGGTGTAC
ACTGGGTTCGCCAGTCTCCAGGAAAGGGTCTGGAGTGGCTGGGAGTGATATGGAGTGGTGGAAACAC
AGACTATAATACACCTTTCACATCCAGACTGAGCATCAACAAGGACAATTCCAAGAGCCAAGTTTTC
TTTAAAATGAACAGTCTGCAATCTAATGACACAGCCATATATTACTGTGCCAGAGCCCTCACCTACT
ATGATTACGAGTTTGCTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCTGCAGCCTCCACCAAGGG
TGACTCAGTCTCCAGTCATCCTGTCTGTGAGTCCAGGAGAAAGAGTCAGTTTCTCCTGCAGGGCCAG
TCAGAGTATTGGCACAAACATACACTGGTATCAGCAAAGAACAAATGGTTCTCCAAGGCTTCTCATA
AAGTATGCTTCTGAGTCTATCTCTGGAATCCCTTCCAGGTTTAGTGGCAGTGGATCAGGGACAGATT
TTACTCTTAGCATCAACAGTGTGGAGTCTGAAGATATTGCAGATTATTACTGTCAACAAAATAATAA
CTGGCCAACCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAACGAACTGTGGCTGCACCATCTGTC
GVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARAL
TYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALT
DILLTQSPVILSVSPGERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGS
GTDFTLSINSVESEDIADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVC
GTGAGTCCAGGAGAAAGAGTCAGTTTCTCCTGCAGGGCCAGTCAGAGTATTGGCACAAACATACACT
GGTATCAGCAAAGAACAAATGGTTCTCCAAGGCTTCTCATAAAGTATGCTTCTGAGTCTATCTCTGG
AATCCCTTCCAGGTTTAGTGGCAGTGGATCAGGGACAGATTTTACTCTTAGCATCAACAGTGTGGAG
TCTGAAGATATTGCAGATTATTACTGTCAACAAAATAATAACTGGCCAACCACGTTCGGTGCTGGGA
CCAAGCTGGAGCTGAAACGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCA
tgaagcagtcaggacctggcctagtgcagccctcacagagcctgtccatcacctgcacagtctctgg
tttctcattaactaactatggtgtacactgggttcgccagtctccaggaaagggtctggagtggctg
ggagtgatatggagtggtggaaacacagactataatacacctttcacatccagactgagcatcaaca
aggacaattccaagagccaagttttctttaaaatgaacagtctgcaatctaatgacacagccatata
ttactgtgccagagccctcacctactatgattacgagtttgcttactggggccaagggactctggtc
actgtctctgcaGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCT
IHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIADYYCQQNNNWPTTFG
AGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQ
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRL
SINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSS
TCAGTTTCTCCTGCAGGGCCAGTCAGAGTATTGGCACAAACATACACTGGTATCAGCAAAGAACAAA
TGGTTCTCCAAGGCTTCTCATAAAGTATGCTTCTGAGTCTATCTCTGGAATCCCTTCCAGGTTTAGT
GGCAGTGGATCAGGGACAGATTTTACTCTTAGCATCAACAGTGTGGAGTCTGAAGATATTGCAGATT
ATTACTGTCAACAAAATAATAACTGGCCAACCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAACG
ERVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDI
ADYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
aagcctggggcctcagtgaagatgtcctgcaaggcttctggctacacatttaccagttacaatatgc
actgggtaaaacagacacctggtcggggcctggaatggattggagctatttatcccggaaatggtga
tacttcctacaatcagaagttcaaaggcaaggccacattgactgctgacaaatcctccagcacagcc
tacatgcagctcagcagcctgacatctgaggactctgcggtctattactgtgcaagatcgacttact
acggcggtgactggtacttcaatgtctggggcgcagggaccacggtcaccgtctccgcaGCCTCCAC
TCTCCCAGTCTCCAGCAATCCTGTCTGCATCTCCAGGGGAGAAGGTCACAATGACTTGCAGGGCCAG
CTCAAGTGTAAGTTACATCCACTGGTTCCAGCAGAAGCCAGGTTCCTCCCCCAAACCCTGGATTTAT
GCCACATCCAACCTGGCTTCTGGAGTCCCTGTTCGCTTCAGTGGCAGTGGGTCTGGGACTTCTTACT
CTCTCACCATCAGCAGAGTGGAGGCTGAAGATGCTGCCACTTATTACTGCCAGCAGTGGACTAGTAA
CCCACCCACGTTCGGAGGGGGGACCAAGCTGGAAATCAAAACTGTGGCTGCACCATCTGTCTTCATC
YNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQLSSLTSEDSAVYYCAR
STYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSG
QIVLSQSPAILSASPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSG
TSYSLTISRVEAEDAATYYCQQWTSNPPTFGGGTKLEIKRGTVAAPSVFIFPPSDEQLKSGTASVVC
agatgtcctgcaaggcttctggctacacatttaccagttacaatatgcactgggtaaaacagacacc
tggtcggggcctggaatggattggagctatttatcccggaaatggtgatacttcctacaatcagaag
ttcaaaggcaaggccacattgactgctgacaaatcctccagcacagcctacatgcagctcagcagcc
tgacatctgaggactctgcggtctattactgtgcaagatcgacttactacggcggtgactggtactt
caatgtctggggcgcagggaccacggtcaccgtctccgcaGCCTCCACCAAGGGCCCATCGGTCTTC
ASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGKATLTADKSSSTAYMQ
LSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCL
GCATCTCCAGGGGAGAAGGTCACAATGACTTGCAGGGCCAGCTCAAGTGTAAGTTACATCCACTGGT
TCCAGCAGAAGCCAGGTTCCTCCCCCAAACCCTGGATTTATGCCACATCCAACCTGGCTTCTGGAGT
CCCTGTTCGCTTCAGTGGCAGTGGGTCTGGGACTTCTTACTCTCTCACCATCAGCAGAGTGGAGGCT
GAAGATGCTGCCACTTATTACTGCCAGCAGTGGACTAGTAACCCACCCACGTTCGGAGGGGGGACCA
AGCTGGAAATCAAACGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTT
TGCAACAGCCTGGGGCTGAGCTGGTGAAGCCTGGGGCCTCAGTGAAGATGTCCTGCAAGGCTTCTGG
CTACACATTTACCAGTTACAATATGCACTGGGTAAAACAGACACCTGGTCGGGGCCTGGAATGGATT
GGAGCTATTTATCCCGGAAATGGTGATACTTCCTACAATCAGAAGTTCAAAGGCAAGGCCACATTGA
CTGCTGACAAATCCTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACATCTGAGGACTCTGCGGT
CTATTACTGTGCAAGATCGACTTACTACGGCGGTGACTGGTACTTCAATGTCTGGGGCGCAGGGACC
ACGGTCACCGTCTCCGCAGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGA
HWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAEDAATYYCQQWTSNPPTFGG
GTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGK
ATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAP
TCACAATGACTTGCAGGGCCAGCTCAAGTGTAAGTTACATCCACTGGTTCCAGCAGAAGCCAGGTTC
CTCCCCCAAACCCTGGATTTATGCCACATCCAACCTGGCTTCTGGAGTCCCTGTTCGCTTCAGTGGC
AGTGGGTCTGGGACTTCTTACTCTCTCACCATCAGCAGAGTGGAGGCTGAAGATGCTGCCACTTATT
ACTGCCAGCAGTGGACTAGTAACCCACCCACGTTCGGAGGGGGGACCAAGCTGGAAATCAAACGAAC
EKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAEDAA
TYYCQQWTSNPPTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD
tgaagcagtcaggacctggcctagtgcagccctcacagagcctgtccatcacctgcacagtctctgg
tttctcattaactaactatggtgtacactgggttcgccagtctccaggaaagggtctggagtggctg
ggagtgatatggagtggtggaaacacagactataatacacctttcacatccagactgagcatcaaca
aggacaattccaagagccaagttttctttaaaatgaacagtctgcaatctaatgacacagccatata
ttactgtgccagagccctcacctactatgattacgagtttgcttactggggccaagggactctggtc
actgtctctgcagcctccaccaagggcccatcggtcttccccctggcaccctcctccaagagcacct
ccatctcctgcaaggccagccaaagtgttgattttgatggtgatagttttatgaactggtaccaaca
gaaaccaggacagccacccaaactcctcatctatactacatccaatctagaatctggcatcccagcc
aggtttagtgccagtgggtctgggacagacttcaccctcaacatccatcctgtggaggaggaggata
ctgcaacctattactgtcagcaaagtaatgaggacccgtacacgttcggaggggggaccaagctgga
gctgaaacgaactgtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaatct
TGCAACAGCCTGGGGCTGAGCTGGTGAAGCCTGGGGCCTCAGTGAAGATGTCCTGCAAGGCTTCTGG
CTACACATTTACCAGTTACAATATGCACTGGGTAAAACAGACACCTGGTCGGGGCCTGGAATGGATT
GGAGCTATTTATCCCGGAAATGGTGATACTTCCTACAATCAGAAGTTCAAAGGCAAGGCCACATTGA
CTGCTGACAAATCCTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACATCTGAGGACTCTGCGGT
CTATTACTGTGCAAGATCGACTTACTACGGCGGTGACTGGTACTTCAATGTCTGGGGCGCAGGGACC
ACGGTCACCGTCTCCGCAGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGA
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRL
SINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSS
QRATISCKASQSVDFDGDSFMNWYQQKPGQPPKLLIYTTSNLESGIPARFSASGSGTDFTLNIHPVE
EEDTATYYCQQSNEDPYTFGGGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV
QVTLKESGPGILQPSQTLSLTCSFSGFSLRTSGMGVGWIRQPSGKGLEWLAHIWWDDDKRYNPALKS
RLTISKDTSSNQVFLKIASVDTADTATYYCAQINPAWFAYWGQGTLVTVSAASTKGPSVFPLAPSSK
TGCAACAGCCTGGGGCTGAGCTGGTGAAGCCTGGGGCCTCAGTGAAGATGTCCTGCAAGGCTTCTGG
CTACACATTTACCAGTTACAATATGCACTGGGTAAAACAGACACCTGGTCGGGGCCTGGAATGGATT
GGAGCTATTTATCCCGGAAATGGTGATACTTCCTACAATCAGAAGTTCAAAGGCAAGGCCACATTGA
CTGCTGACAAATCCTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACATCTGAGGACTCTGCGGT
CTATTACTGTGCAAGATCGACTTACTACGGCGGTGACTGGTACTTCAATGTCTGGGGCGCAGGGACC
ACGGTCACCGTCTCCGCAgcctccaccaagggcccatcggtcttccccctggcaccctcctccaaga
GAGTCAGTTTCTCCTGCAGGGCCAGTCAGAGTATTGGCACAAACATACACTGGTATCAGCAAAGAAC
AAATGGTTCTCCAAGGCTTCTCATAAAGTATGCTTCTGAGTCTATCTCTGGAATCCCTTCCAGGTTT
AGTGGCAGTGGATCAGGGACAGATTTTACTCTTAGCATCAACAGTGTGGAGTCTGAAGATATTGCAG
ATTATTACTGTCAACAAAATAATAACTGGCCAACCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAA
Acgaactgtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaatctggaact
tgacccaatctccagcttctttggctgtgtctctagggcagagggccaccatctcctgcaaggccag
ccaaagtgttgattttgatggtgatagttttatgaactggtaccaacagaaaccaggacagccaccc
aaactcctcatctatactacatccaatctagaatctggcatcccagccaggtttagtgccagtgggt
ctgggacagacttcaccctcaacatccatcctgtggaggaggaggatactgcaacctattactgtca
gcaaagtaatgaggacccgtacacgttcggaggggggaccaagctggagctgaaaCGAACTGTGGCT
QVTLKESGPGILQPSQTLSLTCSFSGFSLRTSGMGVGWIRQPSGKGLEWLAHIWWDDDKRYNPALKS
RLTISKDTSSNQVFLKIASVDTADTATYYCAQINPAWFAYWGQGTLVTVSAASTKGPSVFPLAPSSK
RVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIA
DYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD
DIVLTQSPASLAVSLGQRATISCKASQSVDFDGDSFMNWYQQKPGQPPKLLIYTTSNLESGIPARFS
ASGSGTDFTLNIHPVEEEDTATYYCQQSNEDPYTFGGGTKLELKRTVAAPSVFIFPPSDEQLKSGTA
tgcaacagcctggggctgagctggtgaagcctggggcctcagtgaagatgtcctgcaaggcttctgg
ctacacatttaccagttacaatatgcactgggtaaaacagacacctggtcggggcctggaatggatt
ggagctatttatcccggaaatggtgatacttcctacaatcagaagttcaaaggcaaggccacattga
ctgctgacaaatcctccagcacagcctacatgcagctcagcagcctgacatctgaggactctgcggt
ctattactgtgcaagatcgacttactacggcggtgactggtacttcaatgtctggggcgcagggacc
acggtcaccgtctccgcagcctccaccaagggcccatcggtcttccccctggcaccctcctccaaga
gggccaccatctcctgcaaggccagccaaagtgttgattttgatggtgatagttttatgaactggta
ccaacagaaaccaggacagccacccaaactcctcatctatactacatccaatctagaatctgggatc
ccagccaggtttagtgccagtgggtctgggacagacttcaccctcaacatccatcctgtggaggagg
aggatactgcaacctattactgtcagcaaagtaatgaggatccgtacacgttcggaggggggaccaa
gctggagctgaaacgtggaactgtggctgcaccatctgtcttcatcttcccgccatctgatgagcag
TGAAAGAGTCTGGCCCTGGGATATTGCAGCCCTCCCAGACCCTCAGTCTGACTTGTTCTTTCTCTGG
GTTTTCACTGAGGACTTCTGGTATGGGTGTAGGCTGGATTCGTCAGCCTTCAGGGAAGGGTCTAGAG
TGGCTGGCACACATTTGGTGGGATGATGACAAGCGCTATAATCCAGCCCTGAAGAGCCGACTGACAA
TCTCCAAGGATACCTCCAGCAACCAGGTATTCCTCAAAATCGCCAGTGTGGACACTGCAGATACTGC
CACATACTACTGTGCTCAAATAAACCCCGCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGGTCACT
GTCTCTGCGGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTG
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGK
ATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAP
LGQRATISCKASQSVDFDGDSFMNWYQQKPGQPPKLLIYTTSNLESGIPARFSASGSGTDFTLNIHP
VEEEDTATYYCQQSNEDPYTFGGGTKLELKRGTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRE
QVTLKESGPGILQPSQTLSLTCSFSGFSLRTSGMGVGWIRQPSGKGLEWLAHIWWDDDKRYNPALKS
RLTISKDTSSNQVFLKIASVDTADTATYYCAQINPAWFAYWGQGTLVTVSAASTKGPSVFPLAPSSK
tgcaacagcctggggctgagctggtgaagcctggggcctcagtgaagatgtcctgcaaggcttctgg
ctacacatttaccagttacaatatgcactgggtaaaacagacacctggtcggggcctggaatggatt
ggagctatttatcccggaaatggtgatacttcctacaatcagaagttcaaaggcaaggccacattga
ctgctgacaaatcctccagcacagcctacatgcagctcagcagcctgacatctgaggactctgcggt
ctattactgtgcaagatcgacttactacggcggtgactggtacttcaatgtctggggcgcagggacc
acggtcaccgtctccgcagcctccaccaagggcccatcggtcttccccctggcaccctcctccaaga
atattgtgatgactcagtctccagccaccctgtctgtgactccaggagatagagtctctctttcctg
cagggccagccagactattagcgactacttacactggtatcaacaaaaatcacatgagtctccaagg
cttctcatcaaatttgcttcccaatccatttctggaatcccctccaggttcagtggcagtggatcag
gctcagatttcactctcagtatcaacagtgtggaacctgaagatgttggagtgtattactgtcaaaa
tggtcacggctttcctcggacgttcggtggagggaccaagctggaaataaaacgtggaactgtggct
TGGTGGAGTCTGGGGGAGACTTAGTGAAGCCTGGAGGGTCCCTGAAACTCTCCTGTGCAGCCTCTGG
ATTCACTTTCAGTGGCTATGGCATGTCTTGGGTTCGCCAGACTCCAGACAAGAGGCTGGAGTGGGTC
GCAACCATTACTAGTGGTGGTACTTACACCTACTATCCAGACAGTGTGAAGGGGCGATTCACCATCT
CCAGAGACAATGCCAAGAACACCCTGTACCTGCAAATAGACAGTCTGAAGTCTGAGGATACAGCCAT
ATATTTCTGTGCAAGATCCCTCGCGGGAAATGCTATGGACTACTGGGGTCAAGGGACCAGCGTCACC
GTCTCCTCAGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTG
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGK
ATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAP
EVQLVESGGDLVKPGGSLKLSCAASGFTFSGYGMSWVRQTPDKRLEWVATITSGGTYTYYPDSVKGR
FTISRDNAKNTLYLQIDSLKSEDTAIYFCARSLAGNAMDYWGQGTSVTVSSASTKGPSVFPLAPSSK
tgcaacagcctggggctgagctggtgaagcctggggcctcagtgaagatgtcctgcaaggcttctgg
ctacacatttaccagttacaatatgcactgggtaaaacagacacctggtcggggcctggaatggatt
ggagctatttatcccggaaatggtgatacttcctacaatcagaagttcaaaggcaaggccacattga
ctgctgacaaatcctccagcacagcctacatgcagctcagcagcctgacatctgaggactctgcggt
ctattactgtgcaagatcgacttactacggcggtgactggtacttcaatgtctggggcgcagggacc
acggtcaccgtctccgcagcctccaccaagggcccatcggtcttccccctggcaccctcctccaaga
acagagtgaccatcacctgtaaagcaagtcagaatattgacaaatacttaaactggtaccagcagaa
gccaggtgaggctccaaagctgctgatctacaatacaaacaatttgcaaacgggtgtgccaagcaga
ttcagcggtagcggtagcggtaccgacttcaccttcaccatcagcagcctccagccagaggacatcg
ccacctactactgcttgcagcatataagtaggccgcgcacgttcggccaagggaccaaggtggaaat
caaacgtggaactgtggctgcaccatctgtcttcatcttcccgccatctgatgagcagttgaaatct
TGCAACAGCCTGGGGCTGAGCTGGTGAAGCCTGGGGCCTCAGTGAAGATGTCCTGCAAGGCTTCTGG
CTACACATTTACCAGTTACAATATGCACTGGGTAAAACAGACACCTGGTCGGGGCCTGGAATGGATT
GGAGCTATTTATCCCGGAAATGGTGATACTTCCTACAATCAGAAGTTCAAAGGCAAGGCCACATTGA
CTGCTGACAAATCCTCCAGCACAGCCTACATGCAGCTCAGCAGCCTGACATCTGAGGACTCTGCGGT
CTATTACTGTGCAAGATCGACTTACTACGGCGGTGACTGGTACTTCAATGTCTGGGGCGCAGGGACC
ACGGTCACCGTCTCCGCAGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGA
QVQLQQPGAELVKPGASVKMSCKASGYTFTSYNMHWVKQTPGRGLEWIGAIYPGNGDTSYNQKFKGK
ATLTADKSSSTAYMQLSSLTSEDSAVYYCARSTYYGGDWYFNVWGAGTTVTVSAASTKGPSVFPLAP
SVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPSRFSGSGSGTDFTFTISSLQP
EDIATYYCLQHISRPRTFGQGTKVEIKGTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTTEYNPSVK
GRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVSAASTKGPSVFPLAP
tgcaggagagcggtccaggtcttgtgagacctagccagaccctgagcctgacctgcaccgtgtctgg
cttcaccttcaccgatttctacatgaactgggtgagacagccacctggacgaggtcttgagtggatt
ggatttattagagacaaagctaaaggttacacaacagagtacaatccatctgtgaaggggagagtga
caatgctggtagacaccagcaagaaccagttcagcctgagactcagcagcgtgacagccgccgacac
cgcggtctattattgtgcaagagagggccacactgctgctccttttgattactggggtcaaggcagc
ctcgtcacagtctcctcagcctccaccaagggcccatcggtcttccccctggcaccctcctccaaga
agaaggtcacaatgacttgcagggccagctcaagtgtaagttacatccactggttccagcagaagcc
aggttcctcccccaaaccctggatttatgccacatccaacctggcttctggagtccctgttcgcttc
agtggcagtgggtctgggacttcttactctctcaccatcagcagagtggaggctgaagatgctgcca
cttattactgccagcagtggactagtaacccacccacgttcggaggggggaccaagctggaaatcaa
TGACCCAGAGCCCAAGCAGCCTGAGCGCCAGCGTGGGTGACAGAGTGACCATCACCTGTAAAGCAAG
TCAGAATATTGACAAATACTTAAACTGGTACCAGCAGAAGCCAGGTAAGGCTCCAAAGCTGCTGATC
TACAATACAAACAATTTGCAAACGGGTGTGCCAAGCAGATTCAGCGGTAGCGGTAGCGGTACCGACT
TCACCTTCACCATCAGCAGCCTCCAGCCAGAGGACATCGCCACCTACTACTGCTTGCAGCATATAAG
TAGGCCGCGCACGTTCGGCCAAGGGACCAAGGTGGAAATCAAAACTGTGGCTGCACCATCTGTCTTC
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTTEYNPSVK
GRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVSSASTKGPSVFPLAP
SPGEKVTMTCRASSSVSYIHWFQQKPGSSPKPWIYATSNLASGVPVRFSGSGSGTSYSLTISRVEAE
DAATYYCQQWTSNPPTFGGGTKLEIKGTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQW
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPSRFSGSGS
GTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKGTVAAPSVFIFPPSDEQLKSGTASVVC
AACTCTCCTGTGCAGCCTCTGGATTCACTTTCAGTGGCTATGGCATGTCTTGGGTTCGCCAGACTCC
AGACAAGAGGCTGGAGTGGGTCGCAACCATTACTAGTGGTGGTACTTACACCTACTATCCAGACAGT
GTGAAGGGGCGATTCACCATCTCCAGAGACAATGCCAAGAACACCCTGTACCTGCAAATAGACAGTC
TGAAGTCTGAGGATACAGCCATATATTTCTGTGCAAGATCCCTCGCGGGAAATGCTATGGACTACTG
GGGTCAAGGGACCAGCGTCACCGTCTCCTCAGCCTCCACCAAGGGCCCATCGGTCTTCCCCCTGGCA
tgactcagtctccagccaccctgtctgtgactccaggagatagagtctctctttcctgcagggccag
ccagactattagcgactacttacactggtatcaacaaaaatcacatgagtctccaaggcttctcatc
aaatttgcttcccaatccatttctggaatcccctccaggttcagtggcagtggatcaggctcagatt
tcactctcagtatcaacagtgtggaacctgaagatgttggagtgtattactgtcaaaatggtcacgg
ctttcctcggacgttcggtggagggaccaagctggaaataaaaCGAACTGTGGCTGCACCATCTGTC
GSLKLSCAASGFTFSGYGMSWVRQTPDKRLEWVATITSGGTYTYYPDSVKGRFTISRDNAKNTLYLQ
IDSLKSEDTAIYFCARSLAGNAMDYWGQGTSVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
DIVMTQSPATLSVTPGDRVSLSCRASQTISDYLHWYQQKSHESPRLLIKFASQSISGIPSRFSGSGS
GSDFTLSINSVEPEDVGVYYCQNGHGFPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVC
tctctctttcctgcagggccagccagactattagcgactacttacactggtatcaacaaaaatcaca
tgagtctccaaggcttctcatcaaatttgcttcccaatccatttctggaatcccctccaggttcagt
ggcagtggatcaggctcagatttcactctcagtatcaacagtgtggaacctgaagatgttggagtgt
attactgtcaaaatggtcacggctttcctcggacgttcggtggagggaccaagctggaaataaaaCG
DRVSLSCRASQTISDYLHWYQQKSHESPRLLIKFASQSISGIPSRFSGSGSGSDFTLSINSVEPEDV
GVYYCQNGHGFPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKV
tgaagcagtcaggacctggcctagtgcagccctcacagagcctgtccatcacctgcacagtctctgg
tttctcattaactaactatggtgtacactgggttcgccagtctccaggaaagggtctggagtggctg
ggagtgatatggagtggtggaaacacagactataatacacctttcacatccagactgagcatcaaca
aggacaattccaagagccaagttttctttaaaatgaacagtctgcaatctaatgacacagccatata
ttactgtgccagagccctcacctactatgattacgagtttgcttactggggccaagggactctggtc
actgtctctgcagcctccaccaagggcccatcggtcttccccctggcaccctcctccaagagcacct
tgatgactcagtctccagccaccctgtctgtgactccaggagatagagtctctctttcctgcagggc
cagccagactattagcgactacttacactggtatcaacaaaaatcacatgagtctccaaggcttctc
atcaaatttgcttcccaatccatttctggaatcccctccaggttcagtggcagtggatcaggctcag
atttcactctcagtatcaacagtgtggaacctgaagatgttggagtgtattactgtcaaaatggtca
cggctttcctcggacgttcggtggagggaccaagctggaaataaaacgtggaactgtggctgcacca
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIWSGGNTDYNTPFTSRL
SINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDYEFAYWGQGTLVTVSAASTKGPSVFPLAPSS
SGSDFTLSINSVEPEDVGVYYCQNGHGFPRTFGGGTKLEIKRGTVAAPSVFIFPPSDEQLKSGTASV
TGGTGGAGTCTGGGGGAGACTTAGTGAAGCCTGGAGGGTCCCTGAAACTCTCCTGTGCAGCCTCTGG
ATTCACTTTCAGTGGCTATGGCATGTCTTGGGTTCGCCAGACTCCAGACAAGAGGCTGGAGTGGGTC
GCAACCATTACTAGTGGTGGTACTTACACCTACTATCCAGACAGTGTGAAGGGGCGATTCACCATCT
CCAGAGACAATGCCAAGAACACCCTGTACCTGCAAATAGACAGTCTGAAGTCTGAGGATACAGCCAT
ATATTTCTGTGCAAGATCCCTCGCGGGAAATGCTATGGACTACTGGGGTCAAGGGACCAGCGTCACC
GTCTCCTCAgcctccaccaagggcccatcggtcttccccctggcaccctcctccaagagcacctctg
TCTCCTGCAGGGCCAGTCAGAGTATTGGCACAAACATACACTGGTATCAGCAAAGAACAAATGGTTC
TCCAAGGCTTCTCATAAAGTATGCTTCTGAGTCTATCTCTGGAATCCCTTCCAGGTTTAGTGGCAGT
GGATCAGGGACAGATTTTACTCTTAGCATCAACAGTGTGGAGTCTGAAGATATTGCAGATTATTACT
GTCAACAAAATAATAACTGGCCAACCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAAcgaactgt
EVQLVESGGDLVKPGGSLKLSCAASGFTFSGYGMSWVRQTPDKRLEWVATITSGGTYTYYPDSVKGR
FTISRDNAKNTLYLQIDSLKSEDTAIYFCARSLAGNAMDYWGQGTSVTVSSASTKGPSVFPLAPSSK
RVSFSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIA
DYYCQQNNNWPTTFGAGTKLELKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD
tggtggagagcggaggaggcctcgtgcaacccggaggatccctcagactgagctgtgccgccagcgg
cttcaatatcaaggatacctatatccactgggtgaggcaggcccccggaaaaggactggagtgggtg
gccaggatctatcccacaaacggctacaccaggtacgccgattccgtgaagggcagattcaccatca
gcgccgatacctccaaaaacaccgcctatctccagatgaacagcctcagagccgaggacaccgccgt
ctattactgttccagatggggcggcgacggcttttacgctatggattactggggccagggaaccctg
gtgaccgtgagcagcgcctccaccaagggcccatcggtcttccccctggcaccctcctccaagagca
ttgtgatgactcagtctccagccaccctgtctgtgactccaggagataaagtctctctttcctgcag
ggccagccagactattagcgactacttacactggtatcaacaaaaatcacatgagtctccaaggctt
ctcatcaaatttgcttcccaatccatttctggaatcccctccaggttcagtggcagtggatcaggct
cagatttcactctcagtatcaacagtgtggaacctgaagatgttggagtgtattactgtcaaaatgg
tcacggctttcctcggacgttcggtggagggaccaagctggaaataaaacgtggaactgtggctgca
tgacccagagccctagcagcctgagcgcgagcgtgggcgacagagtgacaatcacctgcagggccag
ccaggacgtgaataccgccgtggcctggtaccagcagaaacccggcaaggcccctaagctgctgatc
tactccgcctccttcctctacagcggcgtgcccagcaggtttagcggcagcaggagcggcacagatt
tcaccctgaccatcagcagcctgcagcccgaggacttcgccacctactactgccagcagcattacac
caccccccccaccttcggccagggaacaaaggtaaaaatcaagCGAACTGTGGCTGCACCATCTGTC
EVQLVESGGDLVKPGGSLKLSCAASGFTFSGYGMSWVRQTPDKRLEWVATITSGGTYTYYPDSVKGR
FTISRDNAKNTLYLQIDSLKSEDTAIYFCARSLAGNAMDYWGQGTSVTVSSASTKGPSVFPLAPSSK
DIVMTQSPATLSVTPGDRVSLSCRASQTISDYLHWYQQKSHESPRLLIKFASQSISGIPSRFSGSGS
GSDFTLSINSVEPEDVGVYYCQNGHGFPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVC
DIVMTQSPATLSVTPGDRVSLSCRASQTISDYLHWYQQKSHESPRLLIKFASQSISGIPSRFSGSGS
GSDFTLSINSVEPEDVGVYYCQNGHGFPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVC
TGGTGGAGTCTGGGGGAGACTTAGTGAAGCCTGGAGGGTCCCTGAAACTCTCCTGTGCAGCCTCTGG
ATTCACTTTCAGTGGCTATGGCATGTCTTGGGTTCGCCAGACTCCAGACAAGAGGCTGGAGTGGGTC
GCAACCATTACTAGTGGTGGTACTTACACCTACTATCCAGACAGTGTGAAGGGGCGATTCACCATCT
CCAGAGACAATGCCAAGAACACCCTGTACCTGCAAATAGACAGTCTGAAGTCTGAGGATACAGCCAT
ATATTTCTGTGCAAGATCCCTCGCGGGAAATGCTATGGACTACTGGGGTCAAGGGACCAGCGTCACC
GTCTCCTCAgcctccaccaagggcccatcggtcttccccctggcaccctcctccaagagcacctctg
tcacctgcagggccagccaggacgtgaataccgccgtggcctggtaccagcagaaacccggcaaggc
ccctaagctgctgatctactccgcctccttcctctacagcggcgtgcccagcaggtttagcggcagc
aggagcggcacagatttcaccctgaccatcagcagcctgcagcccgaggacttcgccacctactact
gccagcagcattacaccaccccccccaccttcggccagggaacaaaggtggagatcaagcgaactgt
tggtggagagcggaggaggcctcgtgcaacccggaggatccctcagactgagctgtgccgccagcgg
cttcaatatcaaggatacctatatccactgggtgaggcaggcccccggaaaaggactggagtgggtg
gccaggatctatcccacaaacggctacaccaggtacgccgattccgtgaagggcagattcaccatca
gcgccgatacctccaaaaacaccgcctatctccagatgaacagcctcagagccgaggacaccgccgt
ctattactgttccagatggggcggcgacggcttttacgctatggattactggggccagggaaccctg
gtgaccgtgagcagcGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCA
EVQLVESGGDLVKPGGSLKLSCAASGFTFSGYGMSWVRQTPDKRLEWVATITSGGTYTYYPDSVKGR
FTISRDNAKNTLYLQIDSLKSEDTAIYFCARSLAGNAMDYWGQGTSVTVSSASTKGPSVFPLAPSSK
RVSLSCRASQTISDYLHWYQQKSHESPRLLIKFASQSISGIPSRFSGSGSGSDFTLSINSVEPEDVG
VYYCQNGHGFPRTFGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD
EVQLVESGGDLVKPGGSLKLSCAASGFTFSGYGMSWVRQTPDKRLEWVATITSGGTYTYYPDSVKGR
FTISRDNAKNTLYLQIDSLKSEDTAIYFCARSLAGNAMDYWGQGTSVTVSSASTKGPSVFPLAPSSK
1A) Construction and Expression of Fc-Fab Precursors
In order to create full TetBiAb molecules, a number of Fc-Fab precursors were generated and tested to see if antigen binding of the Fab can still occur when the Fab is moved to the C-terminus of Fc. The generation of the Fc-anti-EGFR is based on the anti-EGFR C225 (cetuximab) monoclonal antibody (Kawamoto, PNAS 80:1337, 1983). The DNA and protein sequence of the Fab light chain for C225 are provided in SEQ ID NO:1 and SEQ ID NO:2, respectively. The DNA and protein sequence of the Fab heavy chain for C225 are provided in SEQ ID NO:3 and SEQ ID NO:4, respectively. Three different Fc-EGFR molecules were generated: (i) Fc-G4S-anti-EGFR(VHCH1), in which the C-terminus of the Fc region heavy chain is linked to the N-terminus of the anti-EGFR Fab heavy chain via a G4S linker (GGGGS, heavy chain is linked to the N-terminus of the anti-EGFR Fab light chain via a G4S linker; and (iii) Fc-(G4S)4-anti-EGFR(LC), which is the same molecule as (ii) but with a quadruple repeat of the linker.
For expression of Fc-G4S-anti-EGFR(VHCH1), the following two gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion): 1) Construct H-CH2-CH3-G4S-VH(anti-EGFR)-CH1-H (SEQ ID NO:11), encoding the following elements: a human heavy chain hinge region with cysteine (which natively forms a disulfide bond with the light chain) mutated to a serine, (EPKSS, SEQ ID NO:8), followed by constant domains 2 and 3, followed by a G4S linker, and anti-EGFR heavy chain variable domain followed by human heavy chain constant domain 1 followed by the hinge region (EPKSC, SEQ ID NO:10, to allow for a disulfide bridge with the anti-EGFR light chain); and 2) Construct VL(anti-EGFR)-CL (SEQ ID NO:12), encoding the following elements: an anti-EGFR light chain variable domain followed by human kappa light chain constant domain. The corresponding amino acid sequences for these two constructs are shown in SEQ ID NO:13 and SEQ ID NO:14 respectively.
For expression of Fc-G4S-anti-EGFR(LC), the following two gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion): 1) Construct H-CH2-CH3-G4S-VL(anti-EGFR)-CL (SEQ ID NO:15), encoding the following elements: a human heavy chain hinge region EPKSC (SEQ ID NO:8) followed by constant domains 2 and 3, followed by a G4S linker, and anti-EGFR light chain variable domain followed by human kappa light chain constant domain; and 2) Construct VH(anti-EGFR)-CH1-H (SEQ ID NO:16), encoding the following elements: anti-EGFR heavy chain variable domain followed by human heavy chain constant domain 1 followed by the hinge region EPKSC (SEQ ID NO:10). The corresponding amino acid sequences for these two constructs are shown in SEQ ID NO:17 and SEQ ID NO:18 respectively.
For expression of Fc-(G4S)4-anti-EGFR(LC), the following two gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion): 1) Construct H-CH2-CH3-(G4S)4-VL(anti-EGFR)-CL (SEQ ID NO:19), encoding the following elements: a human heavy chain hinge region EPKSC (SEQ ID NO:8) followed by constant domains 2 and 3, followed by a (G4S)4 linker, and anti-EGFR light chain variable domain followed by human kappa light chain constant domain; and 2) Construct VH(anti-EGFR)-CH1-H (SEQ ID NO:16), encoding the following elements: anti-EGFR heavy chain variable domain followed by human heavy chain constant 1 followed by the hinge region EPKSC (SEQ ID NO:10). The corresponding amino acid sequences for these two constructs are shown in SEQ ID NO:20 and SEQ ID NO:18 respectively.
Each set of the two vectors was co-transfected transiently into HEK 293-6E cells using Genejuice (Life Technologies, Grand Island, N.Y.) or polyethylenimine (PEI, Polysciences, Warrington, Pa.) for expression of Fc-G4S-anti-EGFR(VHCH1), Fc-G4S-anti-EGFR(LC), and Fc-G4S4-anti-EGFR(LC). The proteins were purified in a single step by protein A affinity chromatography. Expression of the two polypeptides and assembly of the full tetrameric molecule were confirmed on sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and size exclusion chromatography (SEC).
In addition, a control anti-EGFR in a standard monoclonal antibody format (anti-EGFR IgG1) was generated to compare to the different Fc-Fab formats.
1B) Binding of Fc-Fab Precursors to Antigens
1Bi) Competition Binding of Fc-EGFR for EGF on A431 Membranes
The ability of Fc-G4S-anti-EGFR(VHCH1) and Fc-G4S-anti-EGFR(LC) to retain binding for EGFR was shown by competitive radioligand binding assays. Competing antibodies were mixed with 125I-EGF (Perkin Elmer, Waltham, Mass.) prior to the addition of 2 mg of membrane prepared from human A431 epidermoid carcinoma cells that overexpress EGFR. A431 cell membranes were prepared by nitrogen cavitation. The cells were disrupted with 900 psi of with N2 gas for 30 min, after which the lysate was centrifuged at 1000 g for 10 min at 4° C. The supernatant was collected and centrifuged at 100,000 g for 1 h at 4° C. The resulting pellet was re-suspended with a dounce homogenizer. The protein concentration of the samples was determined using the BioRad protein assay reagent, and the samples were stored frozen at −80° C. for future use. Non-specific binding was determined in the presence of a large excess of unlabeled EGF (100 nM) to saturate all the EGFR binding sites. The reactions were incubated for 90 min at 37° C., with shaking, and terminated by filtering through glass fiber filters (EMD Millipore, Billerica, Mass.). The filters were washed and counted on a gamma counter to determine the amount of 125I-EGF bound on the A431 cell memebrane.
The results show that Fc-G4S-anti-EGFR(VHCH1) has a similar ability to inhibit binding of 125I-EGF to EGFR on A431 cell membranes as anti-EGFR (
1Bii) SPR Analysis
The ability for Fc-G4S-anti-EGFR(VHCH1), Fc-G4S-anti-EGFR(LC), and Fc-(G4S)4-anti-EGFR(LC) to retain binding for EGFR was determined by surface plasmon resonance (SPR). Purified goat anti-human IgG Fc (Jackson Immuno Research Laboratories) was immobilized onto the CM5 chip using amine coupling chemistry using a Biacore 4000 instrument (GE Healthcare). Biacore CM-5 chips, ethanolamine, NHS/EDC coupling reagents and buffers were obtained from Biacore (GE Healthcare). The immobilization steps were carried out at a flow rate of 30 μl/min in HEPES buffer (20 mM HEPES, 150 mM NaCl, 3.4 mM EDTA and 0.005% P20 surfactant). The sensor surfaces were activated for 7 min with a mixture of NHS (0.05 M) and EDC (0.2 M). The goat anti-human IgG Fc was injected at a concentration of ˜30 μg/ml in 10 mM sodium acetate, pH 5.0, for 7 min. Ethanolamine (1 M, pH 8.5) was injected for 7 min to block any remaining activated groups. An average of 12,000 response units (RU) of capture antibody was immobilized on each flow cell. Kinetic binding experiments were performed using the same HEPES buffer (20 mM HEPES, 150 mM NaCl, 3.4 mM EDTA and 0.005% P20 surfactant) and was equilibrated at 25° C. Kinetic data was collected by injecting test and control antibodies at 0.5 and 1 μg/ml for two minutes at a flow rate of 30 μl/min, followed by a buffer wash for 30 s at the same flow rate. Human EGFR-1 (R&D Systems recombinant Human EGF Receptor (1095-ER)) was bound at 40, 20, 10, 5, 2.5 and 0 nM for 3 min followed by a dissociation step for 10 min at the 30 μl/min flow rate. The data were fit using a 1:1 Langmuir binding model with the BIA evaluation software. Kinetic rate constants were determined from the fits of the association and dissociation phases, and the KD was derived from the ratio of these constants.
The results show that Fc-G4S-anti-EGFR(VHCH1) bound EGFR with a slightly higher KD than anti-EGFR, ˜2 nM vs ˜1 nM respectively (
2A) Construction and Expression of Fc-Fab Precursors
The generation of Fc-anti-CD20 is based on the anti-CD20 2B8 (rituximab) monoclonal antibody (Reff et al, Blood 83:435, 1994). The DNA and protein sequence of the Fab light chain for 2B8 are provided in SEQ ID NO:21 and SEQ ID NO:22, respectively. The DNA and protein sequence of the Fab heavy chain for 2B8 are provided in SEQ ID NO:23 and SEQ ID NO:24, respectively. Four different Fc-CD20 molecules were generated: (i) Fc-G4S-anti-CD20(VHCH1), in which the C-terminus of the Fc region eavy chain is linked to the N-terminus of the anti-CD20 Fab heavy chain via a G4S linker (GGGGS, SEQ ID NO:6); (ii) Fc-(G4S)4-anti-CD20(VHCH1), which is the same molecule as (i) but with a quadruple repeat of the linker; (iii) Fc-G4S-anti-CD20(LC), in which the C-terminus of the Fc region heavy chain is linked to the N-terminus of the anti-CD20 Fab light chain via a G4S linker; and (iv) Fc-(G4S)4-anti-CD20(LC), which is the same molecule as (iil) but with a quadruple repeat of the linker.
For expression of Fc-G4S-anti-CD20(VHCH1), the following two gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion): 1) Construct H-CH2-CH3-G4S-VH(anti-CD20)-CH1-H (SEQ ID NO:25), encoding the following elements: a human heavy chain hinge region EPKSC (SEQ ID NO:8) followed by constant domains 2 and 3, followed by a G4S linker, and anti-CD20 heavy chain variable domain followed by human heavy chain constant domain 1 followed by the hinge region EPKSC (SEQ ID NO:10); and 2) Construct VL(anti-CD20)-CL (SEQ ID NO:26), encoding the following elements: an anti-CD20 light chain variable domain followed by human kappa light chain constant domain:). The corresponding amino acid SEQ ID NO:for these two constructs are shown in SEQ ID NO:27 and SEQ ID NO:28 respectively.
For expression of Fc-(G4S)4-anti-CD20(VHCH1), the following two gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion): 1) Construct H-CH2-CH3-(G4S)4-VH(anti-CD20)-CH1-H (SEQ ID NO:29), encoding the following elements: a human heavy chain hinge region EPKSC (SEQ ID NO:8) followed by constant domains 2 and 3, followed by a (G4S)4 linker, and anti-CD20 heavy chain variable domain followed by human heavy chain constant domain 1 followed by the hinge region EPKSC (SEQ ID NO:10); and 2) Construct VL(anti-CD20)-CL (SEQ ID NO:26), encoding the following elements: an anti-CD20 light chain variable domain followed by human kappa light chain constant domain:). The corresponding amino acid SEQ ID NO:for these two constructs are shown in SEQ ID NO:30 and SEQ ID NO:28 respectively.
For expression of Fc-G4S-anti-CD20(LC), the following two gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion): 1) Construct H-CH2-CH3-G4S-VL(anti-CD20)-CL (SEQ ID NO:31), encoding the following elements: a human heavy chain hinge region EPKSC (SEQ ID NO:8) followed by constant domains 2 and 3, followed by a G4S linker, and anti-CD20 light chain variable domain followed by human kappa light chain constant domain; and 2) Construct VH(anti-CD20)-CH1-H (SEQ ID NO:32), encoding the following elements: anti-CD20 heavy chain variable domain followed by human heavy chain constant domain 1 followed by the hinge region EPKSC (SEQ ID NO:10). The corresponding amino acid SEQ ID NO:for these two constructs are shown in SEQ ID NO:33 and SEQ ID NO:34 respectively.
For expression of Fc-(G4S)4-anti-CD20(LC), the following two gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion): 1) Construct H-CH2-CH3-(G4S)4-VL(anti-CD20)-CL (SEQ ID NO:35), encoding the following elements: a human heavy chain hinge region EPKSC (SEQ ID NO:8) followed by constant domains 2 and 3, followed by a (G4S)4 linker, and anti-CD20 light chain variable domain followed by human kappa light chain constant domain; and 2) Construct VH(anti-CD20)-CH1-H (SEQ ID NO:32), encoding the following elements: anti-CD20 heavy chain variable domain followed by human heavy chain constant domain 1 followed by the hinge region EPKSC (SEQ ID NO:10). The corresponding amino acid SEQ ID NO:for these two constructs are shown in SEQ ID NO:36 and SEQ ID NO:34 respectively.
Each set of the two vectors was co-transfected transiently into HEK 293-6E cells using Genejuice (Life Technologies, Grand Island, N.Y.) or polyethylenimine (PEI, Polysciences, Warrington, Pa.) for expression of Fc-G4S-anti-CD20(VHCH1), Fc-(G4S)4-anti-CD20(VHCH1), Fc-G4S-anti-CD20(LC), and Fc-(G4S)4-anti-CD20(LC). The proteins were purified in a single step by protein A affinity chromatography. Expression of the two polypeptides and assembly of the full tetrameric molecule were confirmed on sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and size exclusion chromatography (SEC).
In addition, a control anti-CD20 in a standard monoclonal antibody format (anti-CD20 IgG1) was generated to compare to the differen Fc-Fab formats.
2B) Binding of Fc-Fab Precursors to Antigens
The ability of Fc-G4S-anti-CD20(VHCH1), Fc-G4S4-anti-CD20(VHCH1), Fc-G4S-anti-CD20(LC), and Fc-G4S4-anti-CD20(LC) to retain binding to CD20 on the cell surface was measured on human Daudi Burkitt's lymphoma cells, which express CD20. 1×105 Daudi cells per well were incubated with varying concentrations of anti-CD20/anti-CD16 and anti-CD20 diluted in PBS+1% FBS in a 96 well plate for 30 min on ice. After washing with PBS+1% FBS, cells were incubated with TRITC F(ab′)2 goat Anti-Human IgG, Fcγ (Jackson ImmunoResearch, West Grove, Pa.), diluted 1:200 in PBS+1% FBS for 30 min on ice. After washing again, cells were fixed with 1% formaldehyde in PBS. Cells were analyzed by flow cytometry (Guava, EMD Millipore, Billerica, Mass.).
The results show that Fc-G4S-anti-CD20(VHCH1) and Fc-G4S4-anti-CD20(VHCH1) retain binding to CD20, although not as well as anti-CD20 IgG1 (
3A) Construction and Expression of TetBiAbs
The generation of the TetBiAbs against EGFR and CD16 is based on the anti-EGFR C225 (cetuximab) monoclonal antibody (Kawamoto, PNAS 80:1337, 1983) and the anti-CD16 3G8 monoclonal antibody (Fleit et al, PNAS 79:3275, 1982). The DNA and protein sequence of the Fab light chain for C225 are provided in SEQ ID NO:1 and SEQ ID NO:2, respectively. The DNA and protein sequence of the Fab heavy chain for C225 are provided in SEQ ID NO:3 and SEQ ID NO:4, respectively. The DNA and protein sequence of the Fab light chain for 3G8 are provided in SEQ ID NO:37 and SEQ ID NO:38, respectively. The DNA and protein sequence of the Fab heavy chain for 3G8 are provided in SEQ ID NO:39 and SEQ ID NO:40, respectively. Two different TetBiAbs against EGFR and CD16 molecules were generated: (i) anti-EGFR/anti-CD16, in which the C-terminus of the anti-EGFR heavy chain polypeptide is linked to the N-terminus of the anti-CD16 Fab light chain via a G4S linker and (ii) anti-CD16/anti-EGFR, in which the C-terminus of the anti-CD16 heavy chain polypeptide is operably linked to the N-terminus of the anti-EGFR Fab light chain via a G4S linker.
For expression of the anti-EGFR/anti-CD16 TetBiAb, the following three gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion), as in
For expression of the anti-CD16/anti-EGFR TetBiAb, the following three gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5, as in
Each set of the three vectors was co-transfected transiently into HEK 293-6E cells using Genejuice (Life Technologies, Grand Island, N.Y.) or polyethylenimine (PEI, Polysciences, Warrington, Pa.) for expression of anti-EGFR/anti-CD16 and anti-CD16/anti-EGFR. The two TetBiAbs were purified in a single step by protein A affinity chromatography. Expression of the three polypeptides and assembly of the full hexameric molecule were confirmed on sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and size exclusion chromatography (SEC). For SDS-PAGE, the purified TetBiAbs samples were reduced with DTT and run on NuPAGE MES 4-12% Gel, 200V for 35 min, followed by Coomassie staining.
The three major bands on the gel had the expected molecular weights (MW) and the correct stoichiometirc ratio with >95% purity (
In addition, a number of controls were generated to compare or optimize the TetBiAb format. These include anti-EGFR in a standard monoclonal antibody format (anti-EGFR IgG1) and anti-EGFR in an effector silent format (anti-EGFR IgG1.4).
3B) Binding of TetBiAbs to Antigens
The ability of anti-EGFR/anti-CD16 and anti-CD16/anti-EGFR to retain binding for EGFR was shown by competitive radioligand binding assays. Competing antibodies were mixed with 125I-EGF (Perkin Elmer, Waltham, Mass.) prior to the addition of 2 mg of membrane prepared from human A431 epidermoid carcinoma cells that overexpress EGFR. A431 cell membranes were prepared by nitrogen cavitation. The cells were disrupted with 900 psi of with N2 gas for 30 min, after which the lysate was centrifuged at 1000 g for 10 min at 4° C. The supernatant was collected and centrifuged at 100,000 g for 1 h at 4° C. The resulting pellet was re-suspended with a dounce homogenizer. The protein concentration of the samples was determined using the BioRad protein assay reagent, and the samples were stored frozen at −80° C. for future use. Non-specific binding was determined in the presence of a large excess of unlabeled EGF (100 nM) to saturate all the EGFR binding sites. The reactions were incubated for 90 min at 37° C., with shaking, and terminated by filtering through glass fiber filters (EMD Millipore, Billerica, Mass.). The filters were washed and counted on a gamma counter to determine the amount of 125I-EGF bound on the A431 cell membrane.
The results show that anti-EGFR/anti-CD16 has a similar ability to inhibit binding of 125I-EGF to EGFR on A431 cell membranes as anti-EGFR. Anti-CD16/anti-EGFR also bound to EGFR, although with a slightly higher inhibition constant (Ki) (
3C) Biological Activities of TetBiAbs
The function and utility of anti-EGFR/anti-CD16 and anti-CD16/anti-EGFR were further shown in an antibody-dependent cell-mediated cytotoxicity (ADCC) assay as described in Mueller et al (J. Immunol. 144:1382, 1990). 3×106 human A431 epidermoid carcinoma cells were labeled with 300 μCi of Na 51Cr (Perkin Elmer, Waltham, Mass.) for 45 min at 37° C. After the cells were washed, 500 cells were transferred to each well of a 96-well plate together with serial dilutions of the recombinant antibodies for concentrations between 0.25-1000 ng/ml. Specific lysis was measured after a 4-hour incubation with effector cells. The effector cells were either resting human peripheral blood mononuclear cells (PBMCs) (effector-to-target cells ratio 100:1) or natural killer (NK) cells (effector-to-target cells ratio 10:1). The NK cells were isolated from the PBMCs with a MACS NK Cell Isolation Kit (Miltenyi Biotec, Bergisch-Gladbach, Germany). Total releasable radioactivity (maximal lysis) was measured by lysing target cells with Triton 100 detergent. Background spontaneous release of radioactivity was measured in wells that contained only target cells. Percentage of specific lysis was calculated by subtracting the background lysis from the experimental values, dividing by the maximal lysis, and multiplying by 100.
Since the Fc of the effector silent IgG1.4 cannot engage the FcγRIII (CD16) on NK cells, this assay requires simultaneous binding of the TetBiAbs for antigens on two different cell types for ADCC to occur. In particular, anti-EGFR/anti-CD16 and anti-CD16/anti-EGFR must engage both EGFR on target A431 cells and CD16 on effector NK cells for killing of and Cr release from the A431 cells to occur.
The results show that both anti-EGFR/anti-CD16 and anti-CD16/anti-EGFR with effector silent Fc induced more potent ADCC at low antibody concentrations than the positive control anti-EGFR IgG1 (
4A) Construction and Expression of TetBiAbs
The generation of the TetBiAbs against CD20 and CD16 is based on the anti-CD20 2B8 (rituximab) monoclonal antibody (Reff et al, Blood 83:435, 1994) and the anti-CD16 3G8 monoclonal antibody (Fleit et al, PNAS 79:3275, 1982 The DNA and protein sequence of the Fab light chain for 2B8 are provided in SEQ ID NO:21 and SEQ ID NO:22, respectively. The DNA and protein sequence of the Fab heavy chain for 2B8 are provided in SEQ ID NO:23 and SEQ ID NO:24, respectively. The DNA and protein sequence of the Fab light chain for 3G8 are provided in SEQ ID NO:37 and SEQ ID NO:38, respectively. The DNA and protein sequence of the Fab heavy chain for 3G8 are provided in SEQ ID NO: 39 and SEQ ID NO:40, respectively. One TetBiAb against CD20 and CD16 molecules was generated: anti-CD20/anti-CD16, in which the C-terminus of the anti-CD20 heavy chain polypeptide is linked to the N-terminus of the anti-CD16 Fab light chain via a G4S linker.
For expression of the anti-CD20/anti-CD16 TetBiAb, the following three gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion), as in
The three vectors were co-transfected transiently into HEK 293-6E cells using Genejuice (Life Technologies, Grand Island, N.Y.) or PEI (Polysciences, Warrington, Pa.) for expression of anti-CD20/anti-CD16. The two TetBiAbs were purified in a single step by protein A affinity chromatography. Expression of the three polypeptides and assembly of the full hexameric molecule were confirmed on SDS-PAGE and SEC. For SDS-PAGE, the purified TetBiAbs samples were reduced with DTT and run on NuPAGE MES 4-12% Gel, 200V for 35 min, followed by Coomassie staining. The three major bands on the gel had the expected MW and the correct stoichiometric ratio with >95% purity (
In addition, anti-CD20 in a standard monoclonal antibody format (anti-CD20 IgG1) was generated as a control to compare with the TetBiAb format.
4B) Binding of TetBiAbs to Antigens
The ability of anti-CD20/anti-CD16 to retain binding to CD20 on the cell surface was measured on human Ramos Burkitt's lymphoma cells, which express CD20 but not CD16. 1×105 Ramos cells per well were incubated with varying concentrations of anti-CD20/anti-CD16 and anti-CD20 diluted in PBS+1% FBS in a 96 well plate for 30 min on ice. After washing with PBS+1% FBS, cells were incubated with TRITC F(ab′)2 goat Anti-Human IgG, Fcγ (Jackson ImmunoResearch, West Grove, Pa.), diluted 1:200 in PBS+1% FBS for 30 min on ice. After washing again, cells were fixed with 1% formaldehyde in PBS. Cells were analyzed by flow cytometry (Guava, EMD Millipore, Billerica, Mass.).
The results show that anti-CD20/anti-CD16 binds to CD20 expressed on Daudi cells (
4C) Biological Activities of TetBiAbs
The function and utility of anti-CD20/anti-CD16 were further shown by an antibody-dependent cell-mediated cytotoxicity (ADCC) assay using human Ramos Burkitt's lymphoma cells. 2000 cells were transferred to each well of a 96-well plate together with serial dilutions of the recombinant antibodies for concentrations between 0.05-200 ng/ml. Specific lysis was measured via lactate dehydrogenase (LDH) release after a 4-hour incubation with natural killer (NK) effector cells (effector-to-target cells ratio 10:1). The NK cells were isolated from resting human peripheral blood mononuclear cells (PBMCs) with a MACS NK Cell Isolation Kit (Miltenyi Biotec, Bergisch-Gladbach, Germany). Total releasable LDH (maximal lysis) was measured by lysing target cells with Triton 100 detergent. Background spontaneous release of LDH was measured in wells that contained only target cells. Percentage of specific lysis was calculated by subtracting the background lysis from the experimental values, dividing by the maximal lysis, and multiplying by 100.
The two graphs of ADCC results show data from different experiments that were executed similarly except using different donors of effector cells. Anti-CD20/anti-CD16, unlike anti-EGFR/anti-CD16, could induce ADCC without engagement of anti-CD16 with CD16 on effectors cells, due to its IgG1 format. However, a ten-fold enhanced induction of ADCC of Ramos cells incubated with anti-CD20/anti-CD16 was observed compared to anti-CD20 with effector cells from four out of seven donors (
5A) Construction and Expression of TetBiAbs
The generation of the TetBiAbs against CD20 and CD47 is based on the anti-CD20 2B8 (rituximab) monoclonal antibody (Reff et al, Blood 83:435, 1994) and the anti-CD47 B6H12 monoclonal antibody (Lindberg et al, JBC 269:1567, 1994). The DNA and protein sequence of the Fab light chain for 2B8 are provided in SEQ ID NO: 21 and SEQ ID NO:22, respectively. The DNA and protein sequence of the Fab heavy chain for 2B8 are provided in SEQ ID NO:23 and SEQ ID NO:24, respectively. The DNA and protein sequence of the Fab light chain for B6H12 are provided in SEQ ID NO: 53 and SEQ ID NO:54, respectively. The DNA and protein sequence of the Fab heavy chain for B6H12 are provided in SEQ ID NO: 55 and SEQ ID NO:56, respectively. One TetBiAb against CD20 and CD47 molecules was generated: anti-CD20/anti-CD47, in which the C-terminus of the anti-CD20 heavy chain polypeptide is linked to the N-terminus of the anti-CD47 Fab light chain via a G4S linker.
For expression of the anti-CD20/anti-CD47 TetBiAb, the following three gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion), as in
The three vectors were co-transfected transiently into HEK 293-6E cells using Genejuice (Life Technologies, Grand Island, N.Y.) or polyethylenimine (PEI, Polysciences, Warrington, Pa.) for expression of anti-CD20/anti-CD47. The TetBiAb was purified in a single step by protein A affinity chromatography. Expression of the three polypeptides and assembly of the full hexameric molecule were confirmed on SDS-PAGE and SEC. For SDS-PAGE, the purified TetBiAbs samples were reduced with DTT and run on NuPAGE MES 4-12% Gel, 200V for 35 min, followed by Coomassie staining. The three major bands on the gel had the expected MW and the correct stoichiometirc ratio with >95% purity (
In addition, anti-CD20 and anti-CD47 in a standard monoclonal antibody format (anti-CD20 IgG1 and anti-CD47 IgG1) were generated as controls to compare with the TetBiAb format.
5B Binding of TetBiAbs
(i) Binding of TetBiAbs to antigens The ability of anti-CD20/anti-CD47 to bind to both antigens expressed on the cell surface was measured, and compared to the two control molecules anti-CD20 and anti-CD47. 1×105 mouse NS0 myeloma cells transfected with CD20 or human U937 histiocytic lymphoma cells per well were incubated with varying concentrations of antibodies diluted in PBS+1% FBS in a 96 well plate for 30 min on ice. After washing with PBS+1% FBS, cells were incubated with TRITC F(ab′)2 goat Anti-Human IgG, Fcγ (Jackson ImmunoResearch, West Grove, Pa.) diluted 1:200 in PBS+1% FBS for 30 min on ice. After washing again, cells were fixed with 1% formaldehyde in PBS. Cells were analyzed by flow cytometry (Guava, EMD Millipore, Billerica, Mass.).
The results show that anti-CD20/anti-CD47 and anti-CD20 bind to CD20 expressed on CD20-tranfected NS0 cells, but anti-CD47 does not bind to NS0/CD20 cells because CD47 is not expressed (
(ii) Binding avidity of anti-CD20/anti-CD47 TetBiAb on cells expressing both antigens.
Binding of anti-CD20/anti-CD47 to CD20 and CD47 on the cell surface was measured on human SU-DHL4 B cell lymphoma cells that overexpress CD20 and express CD47 at low levels. Anti-CD20/anti-CD47, anti-CD20, and anti-CD47 were conjugated with Alexa Fluor® 488 carboxylic acid, TFP ester, bis (triethylammonium salt) (Life Technologies, Grand Island, N.Y.). 1×105 SU-DHL4 cells per well were incubated with varying concentrations of Alexa 488-labeled anti-CD20/anti-CD47, anti-CD20, and anti-CD47 diluted in PBS+1% FBS in a 96 well plate for 60 min on ice. After washing with PBS+1% FBS, cells were fixed with 1% formaldehyde in PBS. Cells were analyzed by flow cytometry (MACSQuant, Miltenyi Biotec, Cologne, Germany).
The results show that anti-CD20/anti-CD47 binding to SU-DHL4 cells is enhanced compared to the binding of anti-CD20 or of anti-CD47, either individually or in combination, to SU-DHL4 cells (
5C) Biological Activities of TetBiAbs
The utility of anti-CD20/anti-CD47 is shown by an in vivo experiment. In a disseminated lymphoma model, SCID mice are injected i.v. with 5×106 CD20+ human Raji lymphoma cells, followed by i.v. injection of 200 mg/mouse of an antibody isotype control (Group 1), 200 mg/mouse of anti-CD20 (Group 2), 200 mg/mouse of anti-CD47 (Group 3), combination of 200 mg/mouse of anti-CD20 and 200 mg/mouse of anti-CD47 (Group 4), or 333 mg/mouse of anti-CD20/anti-CD47, which is the equimolar amount of tetravalent bispecific antibody (Group 5). All the groups (n=10) receive weekly injections and results are reported as general health, e.g. paralysis, which precedes death by 10-14 days, and survival of mice. Treatment with anti-CD20/anti-CD47 tetravalent bispecific antibody (Group 5) is found to be at least as efficacious as the combination therapy (Group 4), but superior to the two monotherapies (groups 2 and 3).
6A) Construction and Expression of TetBiAbs
The generation of the TetBiAbs against CD20 and CD52 is based on the anti-CD20 2B8 (rituximab) monoclonal antibody (Reff et al, Blood 83:435, 1994) and the anti-CD52 Campath monoclonal antibody (James et al, JMB 289:293, 1999). The DNA and protein sequence of the Fab light chain for 2B8 are provided in SEQ ID NO:21 and SEQ ID NO:22, respectively. The DNA and protein sequence of the Fab heavy chain for 2B8 are provided in SEQ ID NO:23 and SEQ ID NO:24, respectively. The DNA and protein sequence of the Fab light chain for Campath are provided in SEQ ID NO:61 and SEQ ID NO:62, respectively. The DNA and protein sequence of the Fab heavy chain for Campath are provided in SEQ ID NO: 63 and SEQ ID NO:64, respectively. Two different TetBiAbs against CD20 and CD52 molecules were generated: (i) anti-CD20/anti-CD52, in which the C-terminus of the anti-CD20 heavy chain polypeptide is linked to the N-terminus of the anti-CD52 Fab light chain via a G4S linker and (ii) anti-CD52/anti-CD20, in which the C-terminus of the anti-CD52 heavy chain polypeptide is linked to the N-terminus of the anti-CD20 Fab light chain via a G4S linker.
For expression of the anti-CD20/anti-CD52 TetBiAb, the following three gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion), as in
For expression of the anti-CD52/anti-CD20 TetBiAb, the following three gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion), as in
Each set of the three vectors was co-transfected transiently into HEK 293-6E cells using Genejuice (Life Technologies, Grand Island, N.Y.) or polyethylenimine (PEI, Polysciences, Warrington, Pa.) for expression of anti-CD20/anti-CD52 and anti-CD52/anti-CD20. The two TetBiAbs were purified in a single step by protein A affinity chromatography. Expression of the three polypeptides and assembly of the full hexameric molecule were confirmed on sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and size exclusion chromatography (SEC). For SDS-PAGE, the purified TetBiAbs samples were reduced with DTT and run on NuPAGE MES 4-12% Gel, 200V for 35 min, followed by Coomassie staining. The three major bands on the gel had the expected molecular weights (MW) and the correct stoichiometirc ratio with >95% purity (
In addition, a number of controls were generated to compare or optimize the TetBiAb format. These include anti-CD20 and anti-CD52 in standard monoclonal antibody format (anti-CD20 IgG1 and anti-CD52 IgG1).
6B) Binding of TetBiAbs to Antigens
The ability of anti-CD20/anti-CD52 and anti-CD52/anti-CD20 to bind both CD20 and CD52 expressed on the cell surface was measured, and compared to the two control molecules anti-CD20 and anti-CD52. 1×105 human Daudi Burkitt's lymphoma cells or human Kasumi-3 acute myeloblastic leukemia cells per well were incubated with varying concentrations of antibodies diluted in PBS+1% FBS in a 96 well plate for 30 min on ice. After washing with PBS+1% FBS, cells were incubated with TRITC F(ab′)2 goat Anti-Human IgG, Fcγ (Jackson ImmunoResearch, West Grove, Pa.) diluted 1:200 in PBS+1% FBS for 30 min on ice. After washing again, cells were fixed with 1% formaldehyde in PBS. Cells were analyzed by flow cytometry (Guava, EMD Millipore, Billerica, Mass.).
The results show that anti-CD20/anti-CD52 and anti-CD20 bind to Daudi cells, and anti-CD52/anti-CD20 and anti-CD52 do not bind to Daudi cells, which express CD20 but not CD52 (
These results are in agreement with the results from
7A) Construction and Expression of Fc-Fab Precursors
The generation of the Fc-anti-CD47 is based on the anti-CD47 B6H12 monoclonal antibody (Lindberg et al, JBC 269: 1567, 1994). The DNA and protein sequence of the Fab light chain for B6H12 are provided in SEQ ID NO:53 and SEQ ID NO:54, respectively. The DNA and protein sequence of the Fab heavy chain for B6H12 are provided in SEQ ID NO:55 and SEQ ID NO:56, respectively. Two different Fc-CD47 molecules were generated: (i) Fc-(G4S)4-anti-CD47(VHCH1), in which the C-terminus of the Fc heavy heavy chain is linked to the N-terminus of the anti-CD47 Fab heavy chain via a (G4S)4 linker and (ii) Fc-(G4S)4-anti-CD47(LC), in which the C-terminus of the Fc region heavy chain is linked to the N-terminus of the anti-CD47 Fab light chain via a (G4S)4 linker.
For expression of Fc-(G4S)4-anti-CD47(VHCH1), the following two gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion): 1) Construct H-CH2-CH3-(G4S)4-VH(anti-CD47)-CH1-H (SEQ ID NO:73), encoding the following elements: a human heavy chain hinge region with cysteine (which natively forms a disulfide bond with the light chain) mutated to a serine, (EPKSS, SEQ ID NO:8), followed by constant domains 2 and 3, followed by a (G4S)4 linker, and anti-CD47 heavy chain variable domain followed by human heavy chain constant domain 1 followed by the hinge region (EPKSC, SEQ ID NO:10, to allow for a disulfide bridge with the anti-CD47 light chain); and 2) Construct VL(anti-CD47)-CL (SEQ ID NO:74), encoding the following elements: an anti-CD47 light chain variable domain followed by human kappa light chain constant domain. The corresponding amino acid sequences for these two constructs are shown in SEQ ID NO:75 and SEQ ID NO:76 respectively.
For expression of Fc-(G4S)4-anti-CD47(LC), the following two gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion): 1) Construct H-CH2-CH3-(G4S)4-VL(anti-CD47)-CL (SEQ ID NO:77), encoding the following elements: a human heavy chain hinge region EPKSC (SEQ ID NO:8) followed by constant domains 2 and 3, followed by a (G4S)4 linker, and anti-CD47 light chain variable domain followed by human kappa light chain constant domain; and 2) Construct VH(anti-CD47)-CH1-H (SEQ ID NO:58), encoding the following elements: anti-CD47 heavy chain variable domain followed by human heavy chain constant domain 1 followed by the hinge region EPKSC (SEQ ID NO:10). The corresponding amino acid sequences for these two constructs are shown in SEQ ID NO:78 and SEQ ID NO:60, respectively.
Each set of the two vectors was co-transfected transiently into HEK 293-6E cells using Genejuice (Life Technologies, Grand Island, N.Y.) or polyethylenimine (PEI, Polysciences, Warrington, Pa.) for expression of Fc-(G4S)4-anti-CD47(VHCH1) and Fc-(G4S)4-anti-CD47(LC). The proteins were purified in a single step by protein A affinity chromatography. Expression of the two polypeptides and assembly of the full tetrameric molecule were confirmed on sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and size exclusion chromatography (SEC).
In addition, a control anti-CD47 in a standard monoclonal antibody format (anti-CD47 IgG1) was generated to compare to the different Fc-Fab formats.
7B) Binding of Fc-Fab Precursors to Antigens
The ability of Fc-(G4S)4-anti-CD47(VHCH1) and Fc-(G4S)4-anti-CD47(LC) to bind to CD47 was measured via ELISA, and compared to the control molecules anti-CD47. Human CD47 was coated on 96 well plates overnight at 4° C. After washing with PBST, the wells were blocked with PBST+2% BSA for 1 hr at room temperature. After washing with PBST, varying concentrations of antibodies diluted in PBST+2% BSA were added to the wells and incubated for 1 hr at room temperature. After washing with PBST, HRP-conjugated Goat anti-Human IgG Fcγ (Jackson ImmunoResearch, West Grove, Pa.) diluted 1:10000 in PBST+2% BSA was added to the wells and incubated for 1 hr at room temperature. The bound antibodies were visualized with HRP substrate, 3,3′,5,5′-tetramethylbenzidine (TMB). The plates were measured for absorbance at 450 nm. The results show that Fc-(G4S)4-anti-CD47(VHCH1) and Fc-(G4S)4-anti-CD47(LC) retain binding to CD47, although not as well as anti-CD47 IgG1 (
8A) Construction and Expression of TetBiAbs
The generation of the TetBiAbs against EGFR and CD47 is based on the anti-EGFR C225 (cetuximab) monoclonal antibody (Kawamoto, PNAS 80:1337, 1983) and the anti-CD47 B6H12 monoclonal antibody (Lindberg et al, JBC 269: 1567, 1994). The DNA and protein sequence of the Fab light chain for C225 are provided in SEQ ID NO:1 and SEQ ID NO:2, respectively. The DNA and protein sequence of the Fab heavy chain for C225 are provided in SEQ ID NO:3 and SEQ ID NO:4, respectively. The DNA and protein sequence of the Fab light chain for B6H12 are provided in SEQ ID NO:53 and SEQ ID NO:54, respectively. The DNA and protein sequence of the Fab heavy chain for B6H12 are provided in SEQ ID NO:55 and SEQ ID NO:56, respectively. Two different TetBiAbs against EGFR and CD47 molecules were generated: (i) anti-EGFR/anti-CD47, in which the C-terminus of the anti-EGFR heavy chain polypeptide is linked to the N-terminus of the anti-CD47 Fab light chain via a (G4S)4 linker and (ii) anti-CD47/anti-EGFR, in which the C-terminus of the anti-CD47 heavy chain polypeptide is linked to the N-terminus of the anti-EGFR Fab light chain via a (G4S)4 linker.
For expression of the anti-EGFR/anti-CD47 TetBiAb, the following three gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion), as in
For expression of the anti-CD47/anti-EGFR TetBiAb, the following three gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5, as in
In addition, a number of controls were generated to compare or optimize the TetBiAb format. These include anti-EGFR in a standard monoclonal antibody format (anti-EGFR IgG1) and anti-CD47 in a standard monoclonal antibody format (anti-CD47 IgG1).
8B) Binding of TetBiAbs
(i) Binding of TetBiAbs to Antigens
The ability of anti-EGFR/anti-CD47 and anti-CD47/anti-EGFR to retain binding to CD47 was measured by ELISA. Human CD47 was coated on 96 well plates overnight at 4° C. After washing with PBST, the wells were blocked with PBST+2% BSA for 1 hr at room temperature. After washing with PBST, varying concentrations of antibodies diluted in PBST+2% BSA were added to the wells and incubated for 1 hr at room temperature. After washing with PBST, HRP-conjugated Goat anti-Human IgG Fcγ (Jackson ImmunoResearch, West Grove, Pa.) diluted 1:10000 in PBST+2% BSA was added to the wells and incubated for 1 hr at room temperature. The bound antibodies were visualized with HRP substrate, 3,3′,5,5′-tetramethylbenzidine (TMB). The plates were measured for absorbance at 450 nm.
The results show that anti-CD47/anti-EGFR retains binding to CD47, similar to anti-CD47. Anti-EGFR/anti-CD47 also retains binding to CD47, although it does not bind as well as anti-CD47 (
The ability of anti-EGFR/anti-CD47 and anti-CD47/anti-EGFR to retain binding to EGFR was measured by ELISA. Human EGFR was coated on 96 well plates overnight at 4° C. After washing with PBST, the wells were blocked with PBST+2% BSA for 1 hr at room temperature. After washing with PBST, varying concentrations of antibodies diluted in PBST+2% BSA were added to the wells and incubated for 1 hr at room temperature. After washing with PBST, HRP-conjugated Goat anti-Human IgG Fcγ (Jackson ImmunoResearch, West Grove, Pa.) diluted 1:10000 in PBST+2% BSA was added to the wells and incubated for 1 hr at room temperature. The bound antibodies were visualized with HRP substrate, 3,3′,5,5′-tetramethylbenzidine (TMB). The plates were measured for absorbance at 450 nm.
The results show that anti-EGFR/anti-CD47 retains binding to EGFR, similar to anti-EGFR. Anti-CD47/anti-EGFR also retains binding to EGFR, although it does not bind as well as anti-EGFR (
(ii) Binding Avidity of Anti-EGFR/Anti-CD47 TetBiAb on Cells Expressing Both Antigens.
The ability of anti-EGFR/anti-CD47 to bind with avidity to EGFR and CD47 on the cell surface was measured on human A431 epidermoid carcinoma cells that overexpress EGFR and express CD47. anti-EGFR/anti-CD47, anti-EGFR, and anti-CD47 were conjugated with Alexa Fluor® 488 carboxylic acid, TFP ester, bis (triethylammonium salt) (Life Technologies, Grand Island, N.Y.). 1×105 A431 cells per well were incubated with varying concentrations of Alexa 488-labeled anti-EGFR/anti-CD47, anti-EGFR, and anti-CD47 diluted in PBS+1% FBS in a 96 well plate for 60 min on ice. After washing with PBS+1% FBS, cells were fixed with 1% formaldehyde in PBS. Cells were analyzed by flow cytometry (MACSQuant, Miltenyi Biotec, Cologne, Germany).
The results show that anti-EGFR/anti-CD47 binding to A431 cells is enhanced compared to the binding of anti-EGFR or anti-CD47, individually or in combination, to A431 cells (
9A) Construction and Expression of TetBiAbs
The generation of the TetBiAbs against HER2 and CD47 is based on the anti-HER2 4D5 (trastuzumab) monoclonal antibody (Carter et al, PNAS 89: 4285, 1992) and the anti-CD47 B6H12 monoclonal antibody (Lindberg et al, JBC 269: 1567, 1994). The DNA and protein sequence of the Fab light chain for 4D5 are provided in SEQ ID NO:83 and SEQ ID NO:84, respectively. The DNA and protein sequence of the Fab heavy chain for 4D5 are provided in SEQ ID NO:85 and SEQ ID NO:86, respectively. The DNA and protein sequence of the Fab light chain for B6H12 are provided in SEQ ID NO:53 and SEQ ID NO:54, respectively. The DNA and protein sequence of the Fab heavy chain for B6H12 are provided in SEQ ID NO:55 and SEQ ID NO:56, respectively. Two different TetBiAbs against HER2 and CD47 molecules were generated: (i) anti-HER2/anti-CD47, in which the C-terminus of the anti-HER2 heavy chain polypeptide is linked to the N-terminus of the anti-CD47 Fab light chain via a (G4S)4 linker and (ii) anti-CD47/anti-HER2, in which the C-terminus of the anti-CD47 heavy chain polypeptide is linked to the N-terminus of the anti-HER2 Fab light chain via a (G4S)4 linker.
For expression of the anti-HER2/anti-CD47 TetBiAb, the following three gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5 (containing the mouse light chain signal peptide sequence for secretion), as in
For expression of the anti-CD47/anti-HER2 TetBiAb, the following three gene constructs were assembled by standard recombinant DNA techniques and cloned into the mammalian expression vector pTT5, as in
Each set of the three vectors was co-transfected transiently into Expi293 cells using Expi293fectin (Life Technologies, Grand Island, N.Y.) for expression of anti-HER2/anti-CD47 and anti-CD47/anti-HER2. The two TetBiAbs were purified in a single step by protein A affinity chromatography. Expression of the three polypeptides and assembly of the full hexameric molecule were confirmed on sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and size exclusion chromatography (SEC). For SDS-PAGE, the purified TetBiAbs samples were reduced with DTT and run on NuPAGE MES 4-12% Gel, 200V for 35 min, followed by Coomassie staining. The three major bands on the gel had the expected molecular weights (MW) and the correct stoichiometric ratio with >95% purity (
In addition, a number of controls were generated to compare or optimize the TetBiAb format. These include anti-HER2 in a standard monoclonal antibody format (anti-HER2 IgG1) and anti-CD47 in a standard monoclonal antibody format (anti-CD47 IgG1).
9B) Binding of TetBiAbs to Antigens
The ability of anti-HER2/anti-CD47 and anti-CD47/anti-HER2 to retain binding to CD47 was measured by ELISA. Human CD47 was coated on 96 well plates overnight at 4° C. After washing with PBST, the wells were blocked with PBST+2% BSA for 1 hr at room temperature. After washing with PBST, varying concentrations of antibodies diluted in PBST+2% BSA were added to the wells and incubated for 1 hr at room temperature. After washing with PBST, HRP-conjugated Goat anti-Human IgG Fcγ (Jackson ImmunoResearch, West Grove, Pa.) diluted 1:10000 in PBST+2% BSA was added to the wells and incubated for 1 hr at room temperature. The bound antibodies were visualized with HRP substrate, 3,3′,5,5′-tetramethylbenzidine (TMB). The plates were measured for absorbance at 450 nm.
The results show that anti-CD47/anti-HER2 retains binding to CD47, similar to anti-CD47. Anti-HER2/anti-CD47 also retains binding to CD47, although it does not bind as well as anti-CD47 (
The ability of anti-HER2/anti-CD47 and anti-CD47/anti-HER2 to retain binding to HER2 on the cell surface was measured on human SK-BR-3 mammary gland/breast adenocarcinoma cells that overexpress HER2. 1×105 SK-BR-3 cells per well were incubated with varying concentrations of anti-HER2/anti-CD47, anti-CD47/anti-HER2, anti-HER2, and anti-CD47 diluted in PBS+1% FBS in a 96 well plate for 60 min on ice. After washing with PBS+1% FBS, cells were incubated with FITC F(ab′)2 goat Anti-Human IgG, Fcγ (Jackson ImmunoResearch, West Grove, Pa.), diluted 1:200 in PBS+1% FBS for 60 min on ice. After washing again, cells were fixed with 1% formaldehyde in PBS. Cells were analyzed by flow cytometry (MACSQuant, Miltenyi Biotec, Cologne, Germany).
The results show that anti-HER2/anti-CD47 retains binding to SK-BR-3 cells, which express Her2, similar to anti-HER2. Anti-CD47/anti-HER2 also retains binding to HER2, although it does not bind as well as anti-HER2. Anti-CD47 does not bind to SK-BR-3 cells because CD47 is not expressed on SK-BR-3 cells (
The invention may be embodied in other specific forms without departing from the spirit or essential characteristics thereof. The foregoing embodiments are therefore to be considered in all respects illustrative rather than limiting the invention described herein. Scope of the invention is indicated by the appended claims rather than by the foregoing description, and all changes that come within the meaning and range of equivalency of the claims are intended to be embraced therein.
This application claims the benefit of and priority to U.S. Provisional Patent Application No. 61/793,153, filed Mar. 15, 2013, the complete disclosure of which is incorporated by reference herein.
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/US2014/028731 | 3/14/2014 | WO | 00 |
| Number | Date | Country | |
|---|---|---|---|
| 61793153 | Mar 2013 | US |
