The present invention relates to a method for identifying an immunoglobulin, recombinant or synthetic antigen-binding fragments thereof that present in vivo tumor binding activity and do not significantly cross-react with normal cells and to antibodies thereby obtained and uses thereof.
Since the approval of rituximab 20 years ago, antibody-based immunotherapies have dramatically changed the natural history of several cancer types1,2. However, due to the difficulty in identifying tumor-associated antigens, only a few antibody-based drugs (21 at the end of 2017), targeting even fewer antigens (13 molecules), have entered into clinical use3. Furthermore, more than 50% of the available therapeutic antibodies target only five antigens (CD20, EGFR, HER2, PD-1 and PD-L1), and consequently no targeted immunotherapeutic option exists for the majority of cancer types4. Therefore, it has become of pivotal importance to design immunotherapies against novel tumor-associated antigens efficacious in halting currently untreatable tumors. The success of targeted immunotherapies lies in the balance between clinical efficacy, which strictly depends on in vivo accessibility of the target antigen, and toxicity, which instead depends on the preferential or tumor-restricted antigen expression. Indeed, immunotherapies raised against widely expressed antigens or promiscuous epitopes are at risk of high toxicity hindering their clinical efficacy. On the other hand, immunotherapies against highly cancer-specific antigens, which are poorly expressed or inaccessible, show diminished efficacy5. Currently available therapeutic-antibodies have been developed starting from fully characterized antigens, whose suitability as molecular targets was based upon in-depth knowledge of their function and their cancer cell-specificity/enrichment. Nowadays, the target-first approaches involve the discovery of tumor-specific antigens from high-throughput RNA- and DNA-sequencing data (6,7), or protein-based methodologies, 8,9,10. Such strategies allow optimal tumor-antigen specificity due to dataset analyses, however the accessibility of tumor antigens remains uncertain and cannot be easily predicted. Additionally, such approaches cannot accurately predict a variety of post-translational modifications, which can either generate novel tumor-associated epitopes or mask expected antigenicity. The paucity of viable, clinically relevant tumor antigens uncovered by these approaches underscores the difficulty of translating data mining into functional in vivo antigenicity11. Alternative to the target-first approach is the antibody-first line of action. This strategy uses unbiased, phenotypic screening to select antibodies against true tumor-associated antigens. In so doing, new antibodies can be selected against cancer cells without prior knowledge of target antigen, using high complexity antibody phage libraries12. This approach provides the advantage of immediately generating a viable antibody that can be directly tested in relevant species for specific diseases. Phenotypic screenings can be performed in vitro, with cultured cells, or in vivo, with growing tumors (or in combination). Screening strategies utilizing cultured cells, however, are limited as cells qualitatively and quantitatively change protein expression, especially of membrane proteins, due to their adaptation to in vitro culture conditions13. Currently, there are no examples of immunotherapies based on antibodies obtained from in vivo screenings, likely because of their intrinsic complexity. No such selected antibody has entered into clinical trials to gauge efficacy. However, a number of recombinant antibodies raised against purified antigen in vitro are currently under clinical evaluation14 or in use15. In principle, however, antibody selection by in vivo tumor targeting allows for the creation and validation of immunotherapies against bona fide tumor antigens that are accessible in their relevant environmental context.
International Patent Application WO2010028791 refers to synthetic antibody display library containing human germline antibody molecules with variation in VH CDR3 and VL CDR3 and at position 52 of VH CDR2, for screening and selection of antibody molecules specific for antigens of interest. Said International Patent Application also refers to a method of obtaining one or more antibody molecules able to bind an antigen, the method including bringing into contact a library of antibody molecules according to the invention and said antigen and selecting one or more antibody molecules of the library able to bind said antigen.
The International Patent Application WO2018002952 refers to a naïve antibody phage display library (APDL), a process for producing the same and a method of obtaining manufacturable antibodies as soluble Fabs from the antibody phage display library.
The US Patent Application US2017355750 refers to methods for high-throughput screening of a functional antibody fragment for an immunoconjugate that targets a protein antigen. The method therein described combines a phage-displayed synthetic antibody library and high-throughput cytotoxicity screening of non-covalently assembled immunotoxins or cytotoxic drug to identify highly functional synthetic antibody fragments for delivering toxin payloads.
The International Patent Application WO2017175176 refers to vectors for cloning and expressing genetic material including but not limiting to antibody gene or parts thereof, and methods of generating said vectors. Said vectors express the antibody genes in different formats such as Fab or scFv as a part of intertransfer system, intratransfer system or direct cloning and expression in individual display systems. In particular, phage display technology is therein used to clone and screen potential antibody genes in phagemid which is followed by the transfer of said genes to yeast vector for further screening and identification of lead molecules against antigens. Bauer et al., The Journal of Immunology, vol. 172, no. 6, 2004.01.01, refer to human anti fibroblast activating protein (FAP) antibody TNF fusions targeting tumor stroma by binding to the FAP antigen and delivering membrane-anchored TNF-α bioactivity. The anti FAP antibody therein described binds tumor stroma cells and doesn't bind tumors cells directly.
Spitaleri et al., Journal of Cancer Research and Clinical Oncology, vol. 139, no. 3, 2013-03, refer to a human monoclonal antibody (L19) fused to TNF. L19 antibody binds to the extra domain B-fibronectin on tumor blood vessels and not directly to tumor cells. The antibody was found to be safe but did not result in objective tumor response.
Hoogenboom et al., Molecular Immunology, vol. 28, no.9, 1991-09-01, refer to antibody-TNF fusions. The antibody therein used binds to the transferrin receptor. However, said antibody is not specific for tumor cells since transferrin receptor may be present also on normal cells.
Fellermeier et al., Oncoimmunology, vol. 5, no. 11, 2016-09-27, refer to antiEpCAM or FAP scFvs fused to extracellular domain of 4-1BBL, OX4OL, GITRL or LIGHT, but not to TNF-α. The anti FAP antibody therein described binds tumor stroma cells and doesn't bind tumors cells directly. EpCAM is expressed on epithelial derived cells, thus an anti EpCAM antibody is not specific for tumor cells.
WO2007128563 refers to fusion protein comprising antibody having specific binding affinity to either extracellular domain of oncofetal fibronectin or to extracellular domains of oncofetal tenascin fused to IL-10, GM-CSF and IL-24, but not to TNF-α. The antibodies L19 and Gil therein used bind to the extra domain B-fibronectin on tumor blood vessels or tenascin around vascular structures in the tumor stroma. Therefore, the fusion protein therein disclosed does not bind directly to tumor cells.
Sanchez-Martin et al., Trends in Biotechnology, vol 33, no. 5, 2015 March 1, refer to methods for selecting anti-tumor antibodies. In particular,
WO2006017173 refers to methods of identification of anti-cancer antibodies comprising collecting the antiserum from patients immunized with a cancer cell and eliminating antibodies binding to human red and white blood cells. The international application also refers to a method comprising a phage displayed antibody library using cells collected from subjects immunized with cancer cells; removing members of the library that bind to human red blood cells to generate a sub-library and recovering from the sub-library members that display antibodies that bind to the cancer cell.
WO02006017173 therefore only describes in vitro selection of phage antibodies. None of such documents disclose the combination of in vivo and ex vivo rounds of selection of phages from a library respectively in healthy mice and healthy cells to remove phages binding to healthy tissue in order to provide a phage library depleted of healthy tissue binding phages to be used in further in vivo and ex vivo rounds of phage selection in mice bearing tumors or in tumor cells. Moreover, it is therein not disclosed the further testing of in vivo anti-tumor efficacy (e.g. by testing specificity, localization, distribution, cytotoxicity, protection against pathology, . . . ).
Therefore, there is still the need for a rapid method to select antibodies that directly bind tumor cells in vivo that could be harnessed in the context of any neoplasia, thus providing antibodies able to selectively bind to tumor cells and not to normal cells and to efficiently treat tumors.
The generation of antibodies versus tumor-associated antigens constitutes a hurdle to the availability of immunotherapies against all cancers. Here, inventors describe an antibody-screening strategy against tumors growing in immune-competent mice, including steps to exclude healthy tissue antigens. In particular, the present method may be applied also to chemotherapy-resistant and/or relapsed T-cell acute lymphoblastic leukemia (T-ALL) and inventors herein show e.g. that the method can be successfully applied, in addition to untreated tumors, also to chemo-resistant and relapsed Patient derived xenografts (PDX). As a way of example, inventors found that the procedure yielded in vivo targeting binders cytotoxic against murine and human T-ALL when fused to TNFα. Strikingly, inventors found cross-reactivity to tumors of neuro-ectodermal origin among which inventors show in vivo efficacy versus patient derived xenografts of metastatic melanoma. Whilst antibody-TNFα immuno-cytokines directly killed T-ALL cells in vitro and in vivo, melanomas were successfully treated through the modulation of host inflammation. The workflow herein presented can be harnessed in the context of any neoplasia. The antibodies according to the invention have the advantage of directly binding the tumor. Therefore, the present antibodies may directly kill tumor cells by means of immune system activation and/or can also be effective by the bystander effect. Indeed, by binding tumor cells, the present antibodies may induce the death of stromal cells or other adjacent not bound cells.
Inventors have adapted and streamlined an antibody-screening strategy against tumor cells growing in immune-competent animals, which incorporates in vivo and ex vivo library-depletion steps to counter-select antigens expressed on healthy tissues. Such workflow can be tailored and applied to virtually any tumor model and allows to identify novel immunotherapies through the in vivo selection of specificity and evaluation of tumoricidal efficacy. As such, the platform described herein provides a rational, high-throughput, rapid workflow to discover and pre-clinically validate treatment options for the benefit of patients. As a proof-of-principle, inventors in particular set out to isolate antibodies targeting T-cell acute lymphoblastic leukemia (T-ALL) including human relapsed and/or chemotherapy-resistant T-ALL. While chemotherapeutic treatment of T-ALL induces robust survival in ˜90% of pediatric cases16, overall survival is only 40% in adults17 and 5% for refractory or relapsing patients due to the absence of efficacious second line treatments18, 19. Thus, novel immunotherapies against relapsed chemo-resistant T-ALL would provide an essential option to otherwise untreatable patients.
It is therefore an object of the present invention a method for identifying an immunoglobulin, recombinant or synthetic antigen-binding fragments thereof that present in vivo tumor binding activity and do not significantly cross-react with normal cells comprising the steps of:
(a) recovery of tumor cell bound phages from a sample isolated from a subject affected by a cancer wherein said subject has been administered with a depleted first phage library, wherein said depleted first phage library comprises a plurality of phage-displayed synthetic single-chain variable fragments (scFv) that do not bind significantly in vivo and ex vivo to antigens expressed on normal cells, thereby obtaining a first enriched phage library and/or
(b) depletion from the obtained first enriched phage library of phages that bind ex vivo antigens expressed on normal cells thereby obtaining a depleted first enriched phage library and/or
(c) recovery of tumor cell bound phages from a sample isolated from a subject affected by a cancer wherein said subject has been administered with the depleted first enriched phage library, thereby obtaining a second enriched phage library and/or
(d) identification from the second enriched phage library of scFv having in vitro and in vivo tumor specificity. Said library is preferably human
Preferably, the method according to the invention comprises the above steps (a), (b), (c) and (d). Any order of the above steps may be possible, however in a preferred embodiment, the steps (a), (b), (c) and (d) are sequentially performed.
Preferably, the identified immunoglobulin, recombinant or synthetic antigen-binding fragments thereof binds directly to tumor cell.
The depleted first phage library of step a) is preferably obtained by previously depleting it:
a) of phages that bind in vivo to cells of subjects not presenting tumors and
b) of phages that bind ex vivo to normal cells.
Preferably, in the method of the invention said depleted first phage library is obtained by
removing cell bound phages from a sample isolated from a subject not affected by a cancer wherein said subject has been administered with a first phage library to recover unbound phages and/or
depletion from said unbound phages of phages that bind ex vivo antigens expressed on normal cells thereby obtaining a depleted first phage library.
Preferably, in the method of the invention said depleted first phage library is obtained by
removing cell bound phages from a sample isolated from a subject not affected by a cancer wherein said subject has been administered with a first phage library to recover unbound phages and
depletion from said unbound phages of phages that bind ex vivo antigens expressed on normal cells thereby obtaining a depleted first phage library.
The above “sample isolated from a subject affected by a cancer” may be e.g. any sample containing tumor cells as e.g. infiltrated spleen. The above “sample isolated from a subject not affected by a cancer” may be e.g. any sample comprising normal cells, preferably a heart blood sample.
In the context of the present invention, the term “do not significantly cross-react with normal cells” or “do not bind significantly in vivo and ex vivo to antigens expressed on normal cells” or “do not bind significantly to normal cells” indicates that the antibodies bind to tumor cells as opposed to normal cells preferably with at least 1.5, more preferably 2.5, fold greater mean fluorescence intensity or percent positivity as assessed by flow cytometry.
In a more preferred embodiment, the identified immunoglobulin, recombinant or synthetic antigen-binding fragments thereof bind at least 20% of the tumor cells and/or bind to tumor cells as opposed to normal cells with at least about 1.5, preferably at least about 2.5, fold greater affinity or avidity and/or bind to tumor cells as opposed to normal cells with at least about 1.5, preferably at least about 2.5, fold greater mean fluorescence intensity or percent positivity as assessed by flow cytometry.
In the context of the present invention a “normal cell” is a cell which is not a cancer cell. A “normal cell” may be a cell from any tissue, except for cells of thymus.
Preferably, the unbound phages and/or phages of the first depleted phage library and/or of the depleted first enriched phage library and/or of the first and/or second enriched phage library are amplified in bacterial host cells after recovery. In particular, the unbound phages isolated after in vivo phage library depletion on healthy subjects and the bound phages isolated after phage recovery from the subject sample are amplified in bacteria.
Preferably, the step d) comprises a competitive in vitro single scFv clone binding analysis to tumor versus normal cells, preferably by flow cytometry, to select in vitro tumor specific immunoglobulin, recombinant or synthetic antigen-binding fragments thereof.
Preferably, the step d) comprises a selection of specific and/or effective clones in vivo. The scFv-phage clones are e.g. selected for in vivo localization and/or efficacy in a subject affected by a cancer wherein said subject has been administered with scFv-phage clones.
Preferably, the selected phages were used to carry out phage infection. Then phage clones were picked and grown to mid-log phase and scFv production was induced, e.g. in the presence of IPTG. In a preferred embodiment of the method as above defined the subject is an animal, preferably a mouse. When the subject is affected by a cancer the subject is preferably a syngeneic murine T-ALL disease model (mT-ALL) or a murine model of other tumors. However, in principle any tumor animal model may be used, e.g. models of different leukemia, of subcutaneous solid tumors such as melanoma, breast or lung carcinoma.
Another object of the invention is an immunoglobulin, recombinant or synthetic antigen-binding fragments thereof that presents in vivo tumor binding activity and does not significantly cross-react with normal cells obtainable by the method as above defined. Preferably said immunoglobulin, recombinant or synthetic antigen-binding fragments thereof binds directly to tumor cell.
Preferably, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined comprises at least one heavy chain complementary determining region (CDRH3) amino acid sequence having at least 80% identity to an amino acid sequence selected from the group consisting of: SEQ ID NO:11 (SVTR), SEQ ID NO:12 (TASIL) and SEQ ID NO: 13 (VMGRNA) and/or at least one light complementary determining region (CDRL3) amino acid sequence having at least 80% identity to an amino acid sequence selected from the group consisting of: SEQ ID NO: 14 (RGLARP), SEQ ID NO: 15 (PWHRTS) and SEQ ID NO: 16 (PPTPDT).
Another object of the invention is an immunoglobulin, recombinant or synthetic antigen-binding fragments thereof that presents in vivo tumor binding activity and does not significantly cross-react with normal cells comprising at least one heavy chain complementary determining region (CDRH3) amino acid sequence having at least 80% identity to an amino acid sequence selected from the group consisting of: SEQ ID NO:11 (SVTR), SEQ ID NO:12 (TASIL) and SEQ ID NO: 13 (VMGRNA) and/or comprising at least one light complementary determining region (CDRL3) amino acid sequence having at least 80% identity to an amino acid sequence selected from the group consisting of: SEQ ID NO: 14 (RGLARP), SEQ ID NO: 15 (PWHRTS) and SEQ ID NO: 16 (PPTPDT).
Preferably said CDRH3 comprises the sequence aa. 99-102 of SEQ. ID NO: 2 (SVTR) or aa. 99-103 of SEQ. ID NO: 4 (TASIL) or and aa. 99-104 of SEQ ID NO: 6 (VMGRNA).
Preferably said CDRL3 comprises the sequence aa. 221-226 of SEQ. ID NO: 2 (RGLARP) or aa. 221-226 of SEQ. ID NO: 4 (PWHRTS) or aa. 223-228 of SEQ ID NO: 6 (PPTPDT).
The immunoglobulin, recombinant or synthetic antigen-binding fragments thereof according to the invention preferably comprise: a) a CDRH3 amino acid sequence having at least 80% identity to an amino acid sequence of SEQ. ID NO: 11 (SVTR) and a CDRL3 amino acid sequence having at least 80% identity to an amino acid sequence of SEQ ID NO: 14 (RGLARP) or b) a CDRH3 amino acid sequence having at least 80% identity to an amino acid sequence of SEQ. ID NO: 12 (TASIL) and a CDRL3 amino acid sequence having at least 80% identity to an amino acid sequence of SEQ ID NO: 15 (PWHRTS) or c) a CDRH3 amino acid sequence having at least 80% identity to an amino acid sequence of SEQ ID NO: 13 (VMGRNA) and a CDRL3 amino acid sequence having at least 80% identity to an amino acid sequence of SEQ ID NO: 16 (PPTPDT).
Preferably, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof according to the invention further comprise a heavy chain complementary determining region (CDRH2) amino acid sequence having at least 80% identity to SEQ ID NO: 17 (SGSGGSTYYADSVKG) and/or a heavy chain complementary determining region (CDRH1) amino acid sequence having at least 80% identity to SEQ ID NO: 18 (SYAMS) and/or a light chain complementary determining region (CDRL2) amino acid sequence having at least 80% identity to SEQ ID NO: 19 (GKNNRPS) and/or a light chain complementary determining region (CDRL1) amino acid sequence having at least 80% identity to SEQ ID NO: 20 (QGDSLRSYYAS).
Preferably, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof according to the invention comprise the complementarity determining regions (CDRs) amino acid sequence having at least 80% identity to SEQ ID NO: SEQ ID NOs: 11, 14, 17-20, or to SEQ ID NOs: 12, 15, 17-20 or to SEQ ID NOs: 13, 16, 17-20.
More preferably, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof according to the invention comprise the complementarity determining regions (CDRs) set forth in SEQ ID NOs: 11, 14, 17-20, or the complementarity determining regions (CDRs) set forth in SEQ ID NOs: 12, 15, 17-20 or the complementarity determining regions (CDRs) set forth in SEQ ID NOs: 13, 16, 17-20.
More preferably, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof according to the invention comprise a heavy chain variable region (VH) amino acid sequence having at least 80% identity to the amino acid sequence selected from the group consisting of: SEQ ID NO:
or fragments thereof and/or a light chain variable region (VL) amino acid sequence having at least 80% identity to the amino acid sequence selected from the group consisting of:
or fragments thereof.
In a preferred embodiment, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof comprise a heavy chain variable region amino acid sequence having at least 80% identity to SEQ ID NO: 21 and a light chain variable region amino acid sequence having at least 80% identity to SEQ ID NO: 24 or a heavy chain variable region amino acid sequence having at least 80% identity to SEQ ID NO: 22 and a light chain variable region amino acid sequence having at least 80% identity to SEQ ID NO: 25 or a heavy chain variable region amino acid sequence having at least 80% identity to SEQ ID NO: 23 and a light chain variable region amino acid sequence having at least 80% identity to SEQ ID NO: 26.
Preferably, the VH and the VL of said immunoglobulin, recombinant or synthetic antigen-binding fragments are linked by an amino acid linker, said linker preferably consisting of a sequence of from 15 aa to 19 aa which is not subjected to intracellular cleavage by proteases, more preferably the linker comprises or consists of the sequence set forth in SEQ ID NO: 27 (GGGGSGGGGSGGGG). Preferably the VH is linked by its C-terminus to the N-terminus of the VL.
In a preferred embodiment, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined further comprise an IgG-Fc tag, preferably a human IgG1-Fc tag, more preferably comprising or consisting of a sequence having at least 80% identity to SEQ ID NO:30.
The term “Fc tag” herein is used to define a C-terminal region of an immunoglobulin heavy chain that contains at least a portion of the constant region. The term includes native sequence Fc regions and variant Fc regions. Unless otherwise specified herein, numbering of amino acid residues in the Fc region or constant region is according to the EU numbering system, also called the EU index, as described in Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD, 1991.
In a preferred embodiment of the invention, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof comprise or consist of a sequence having at least 80% identity to SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO: 38 or SEQ ID NO:10, more preferably of a sequence selected from the group consisting of: SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO: 38 and SEQ ID NO:10.
In a preferred embodiment, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined bind directly to tumor cell.
Preferably the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof according to the invention is fused to at least one molecule selected from the group consisting of: pro-inflammatory cytokine, preferably of the TNF family, more preferably TNF, and TNF related molecules (es. TRAIL), IFNs (alfa, beta or gamma), interleukins and functional fragments and derivatives thereof and/or radionuclides or domains able to recruit radio/chemotherapy compounds, bacterial and fungine toxins, chemotherapeutic agents, enzymes, other domains mediating the attachment of the antibody to the plasma membrane or to vesicles derived from a cell or artificial source, fluorophores, markers.
More preferably the TNF is human TNFα, even more preferably comprising a sequence encoded by SEQ ID NO: 8 or comprising a sequence having at least 80% identity to SEQ ID NO:29, ore preferably comprising or consisting of the sequence set forth in SEQ ID NO:29, or functional fragments or derivatives thereof
In a preferred embodiment of the invention, the molecule as above defined is linked to the VH or the IgG-Fc tag of the immunoglobulin recombinant or synthetic antigen-binding fragments, preferably to the C-terminus of the VH or of the IgG-Fc tag, by an amino acid linker, said linker preferably consisting of a sequence of from 15 aa to 19 aa which is not subjected to intracellular cleavage by proteases, more preferably the linker comprises or consists of the sequence set forth in in SEQ ID NO: 28 (SSSSGSSSSGSSSSG)
In a preferred embodiment, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined is fused to human TNF-α.
In a preferred embodiment, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined bind to at least 20% of murine T-ALL blasts (FITC+) and/or to at least 50% of a human T-ALL cell line and/or exhibit at least 2.5-fold stronger signal on tumor than normal cells.
Preferably, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined comprises the complementarity determining regions (CDRs) set forth in SEQ ID NOs: 11, 14, 17-20.
More preferably, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof comprise a VH amino acid sequence having at least 80% identity to SEQ ID NO: 21 and a VL amino acid sequence having at least 80% identity to SEQ ID NO: 24, even more preferably the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof comprise a VH amino acid sequence set forth in SEQ ID NO: 21 and a VL amino acid sequence set forth in SEQ ID NO: 24
Preferably, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof comprise the complementarity determining regions (CDRs) set forth in SEQ ID NOs: 12, 15, 17-20. More preferably, said immunoglobulin, recombinant or synthetic antigen-binding fragments thereof comprise a VH amino acid sequence having at least 80% identity to SEQ ID NO: 22 and a VL amino acid sequence having at least 80% identity to SEQ ID NO: 25, even more preferably said immunoglobulin, recombinant or synthetic antigen-binding fragments thereof comprise a VH amino acid sequence set forth in SEQ ID NO: 22 and a VL amino acid sequence set forth in SEQ ID NO: 25.
Preferably, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof comprise the complementarity determining regions (CDRs) set forth in SEQ ID NOs: 13, 16, 17-20. More preferably, said immunoglobulin, recombinant or synthetic antigen-binding fragments thereof comprise a VH amino acid sequence having at least 80% identity to SEQ ID NO: 23 and a VL amino acid sequence having at least 80% identity to SEQ ID NO: 26, even more preferably said immunoglobulin, recombinant or synthetic antigen-binding fragments thereof comprise a VH amino acid sequence set forth in SEQ ID NO: 23 and a VL amino acid sequence set forth in SEQ ID NO: 26.
More preferably, the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof according to the invention comprise a sequence having a % of identity of at least 80% with a sequence selected from the group consisting of: SEQ ID NO:32, 34 and 36.
A further object of the invention is an immunoglobulin, recombinant or synthetic antigen-binding fragments thereof with in vivo tumor binding activity, and which do not bind normal cells, preferably as above defined.
The immunoglobulin, recombinant or synthetic antigen-binding fragments as above defined are preferably for medical use, more preferably for use in the prevention and/or treatment of cancer, wherein said cancer is preferably selected from the group consisting of:
T-cell acute lymphoblastic leukemia (T-ALL), preferably chemotherapy-resistant and/or relapsed and/or refractory tumors, tumors of embryonic/neuroectodermal origin, preferably melanomas, including metastatic melanoma, brain tumor, Ewing's sarcomas, glioblastoma, testicular carcinoma, embryonal carcinomas, embryonal ovarian carcinoma, primitive neuroectodermal tumors, neuroblastoma, retinoblastoma, osteosarcoma, astrocytoma, glioma, medulloblastoma.
The present immunoglobulin, recombinant or synthetic antigen-binding fragments are also for use in a method of delivering a molecule as defined above, preferably TNF-α, to tumor cells in a patient. The immunoglobulin, recombinant or synthetic antigen-binding fragments according to the invention is preferably systemically or locally administered, preferably by intravenous injection. Another object of the invention is an in vitro or ex-vivo method for diagnosing and/or assessing the risk of developing and/or prognosing and/or for monitoring the progression and/or for monitoring the efficacy of a therapeutic treatment and/or for the screening of a therapeutic treatment of a tumor or metastasis in a subject and/or for selecting patients to be subjected to a specific treatment and/or for target identification and/or target validation comprising the steps of:
a) detecting a tumor cell in a sample isolated from the subject with the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as defined above,
b) comparing with respect to a proper control and/or reference.
Further object of the invention is a pharmaceutical composition comprising at least one immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined and at least one pharmaceutically acceptable excipient.
Other objects of the invention are a nucleic acid molecule encoding the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined, or hybridizing with said nucleic acid, or a degenerate sequence thereof; an expression vector comprising the nucleic acid as above defined; a host cell that produces the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined or comprising said vector; a method for producing the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined comprising culturing said host cell under conditions for expression of the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof and optionally recovering the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof from the cell culture. Preferably the above defined nucleic acid molecule has or comprises the nucleotide sequence set forth in SEQ ID NO: 3, 5, 7, 31, 33, 35, 37 or 39.
A further object of the invention is a kit comprising at least one immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as defined above and optionally detecting means, wherein said kit is preferably for the diagnosis of tumors and/or metastases, preferably said tumors being chemotherapy-resistant and/or relapsed and/or refractory tumors.
Another object of the invention is a method of treating and/or preventing a cancer or metastasis comprising administering a therapeutically effective amount of the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as defined above or the pharmaceutical composition as above defined above or the host cells as defined above or the nucleic acid as above defined or the vector as above defined.
Other type of binding library may be used in the present method, e.g. a DNA or RNA aptamers library.
The step d) of the method according to the invention may also comprise selecting antibody with tumor specificity in vivo by in vivo treatment of animal presenting tumor with candidate antibody phage, preferably by phage accumulation assay.
In the context of the present invention a “normal cell” is intended as a cell which is not affected by cancer and is not a tumor cell (herein also defined as a healthy cell). Said “normal cell” is not a thymus cell.
While the present invention focuses on the above antibodies, as an exemplification of the present invention, one of ordinary skill in the art will appreciate that, once given the present disclosure, other similar antibodies, and antibody fragments thereof, as well as antibody fragments of these similar antibodies may be produced and used within the scope of the present invention. Such similar antibodies may be produced by a reasonable amount of experimentation by those skilled in the art. The present method may allow patient stratification e.g. by IHC or tumor detection by in vivo imaging. The present antibodies can also be used for diagnostic and/or target identification and/or target validation uses. In an object of the present invention the diagnostic use can be applied as non-exclusive example to diagnostic imaging in vivo in patients. The term immunoglobulin also includes phage antibody clone. In a particular embodiment of the invention, all the antibodies were initially tested in flow cytometry reactions containing 50% murine TALL blasts and 50% normal healthy murine blood nucleated cells. The scFv selected according to the present method preferably binds to at least about 20% of the mT-ALL tumor, with preferably at least about 2.5-fold greater positivity or fluorescence signal as compared to the healthy cells. More preferably, said scFv preferably binds to at least about 50% of a human T-ALL cell line when tested singularly by flow cytometry.
When tested against normal mouse tissues, the antibodies of the invention preferably do not significantly cross-react with healthy cells. The antigen of the antibodies of the invention is therefore predominantly or preferentially expressed upon the surface of tumor cells. Alternatively, the antibodies of the invention bind to healthy tissues that are not essential for survival.
The immunoglobulin, recombinant or synthetic antigen-binding fragments thereof or the phage antibody clone according to the invention is preferably specific for T-cell acute lymphoblastic leukemia (T-ALL), preferably chemotherapy-resistant and/or relapsed and/or refractory tumors, tumors of embryonic/neuroectodermal origin, preferably melanomas, including metastatic melanoma, brain tumor, Ewing's sarcomas, and malignant embryonal carcinoma.
In the present invention the term “immunoglobulin, recombinant or synthetic antigen-biding fragments thereof” also includes bivalent small immune proteins, dia- tria- tetrabodies, bispecific scFvs with a second scFv (es. anti-CD3), CAR-T of any kind (any generation and any configuration, es. tandem, conditional, split, inducible etc.).
The antibodies according to the invention may also be fused or conjugated with immunoglobulins or immunoglobin regions (IgG vs IgM vs IgA vs IgD vs IgE, rat versus human versus murine, etc, hIgG1 vs hIgG3 vs hIgG4 etc), radionuclides or domains able to recruit radio/chemotherapy compounds, bacterial and fungine toxins, chemotherapeutic agents, enzymes, other domains mediating the attachment of the antibody to the plasma membrane or to vesicles derived from a cell or artificial source, fluorophores, markers (e.g. that can be used in the diagnosis of tumors, as e.g. gadolinium, iron or manganese particles in MRI, or markers for heat induced tumoricidal therapy (as gold or iron) that can be excited in a reactive way to treat the tumour).
Other objects of the invention are an expression vector encoding the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined, an isolated host cell comprising the nucleic acid as above defined, preferably producing the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined.
A nucleic acid molecule that codes for the antibody according to the invention or its fragments, derivatives or conjugates according to the present invention can be generated using technologies that are known in the art, such as gene synthesis or PCR amplification. The nucleic acid molecule can be cloned into an expression vector, with the recombinant DNA techniques that are known in the art. A vector for the expression of the antibodies or their derivatives or conjugates according to the present invention can be inserted into host cell lines, for example by transfection. Methods of transfection are known and kits for transfection can be purchased from commercial sources (e.g., Stratagene, La Jolla, Calif.). Transfectants that stably express the antibodies or their derivatives or conjugates according to the present invention can be selected according to techniques known in the art. Different clones of these transfectants can then be isolated and cultured, and the expression levels of each clone (amount of antibody or derivative secreted in the supernatant) can be quantified according to techniques known in the art. One example is the competitive binding to cells that express the antigen, in the presence of known amounts of fluorophore-labelled antibody or derivative; the fluorescent signal measured for example by flow cytometry according to techniques known in the art is inversely proportional to the amount of antibody or derivative produced by the clone in question. In this way a person skilled in the art can obtain cell lines that stably produce the antibodies or their derivatives in sufficient quantities for subsequent use, for example the production of a drug, and can validate quantitatively the production capacity of such cell line.
Cells that produce the antibodies or their derivatives or conjugates according to the present invention can be grown in media and culture conditions known in the art so as to maximize production. The antibodies or their derivatives or conjugates according to the present invention can be purified by one skilled in the art using known processes, for example binding to protein A or to new synthetic materials, which can be arranged in a column or on a membrane, said purification being in batch or continuous. Production, purification and subsequent analytical control can also take place according to “Good Manufacturing Practices” GMP, known in the art, in accordance with the requirements that must be satisfied during the development, production and control of medicines for use in humans.
In the context of the present invention the molecules defined as “hIgG-IEOmAb-hTNFα” correspond to the molecules defined as “hIgG-IEOmAB-scFv-hTNFα” or “IEOmAB-hIgG-scFv-hTNFα”. Therefore, e.g., the expression “hIgG-IEOmAb2-hTNFα” and “hIgG-IEOmAB2-scFv-hTNFα” or “IEOmAB2-hIgG-scFv-hTNFα” are herein exchangeable. The order of the term “hIgG”, “scFv”, “IEOmAB” in the definition of the molecules of the invention may be changed without affecting the nature of the molecule.
Moreover, in the definition of the herein described molecule, the term “scFv” may be present or not without any effect on the nature of molecule, e.g. in the context of the present invention the molecule defined as “IEOmAB1-scFv-hTNFα” is the same as “IEOmAB1-hTNFα”, the molecule defined as “IEOmAB-scFv” correspond to the molecule defined as “IEOmAB”, e.g., the molecule “IEOmAB1-scFv” corresponds to the molecule “IEOmAB1”.
Also the term “hT-ALL binding immune-cytokine” corresponds to the term “immune-cytokine”. Derivatives of antibodies according to the present invention, such as functional fragments, or conjugates with biologically active molecules (eg toxins), or with radioisotopes, fluorescent dyes, enzymes that can be detected by chemiluminescence, can be obtained using chemical or genetic engineering procedures known in the art.
The antibodies and their derivatives or conjugates according to the present invention, in particular conjugates with radioactive isotopes or fluorescent or chemiluminescent tracers, can be used in imaging diagnostics of patients using technologies and procedures known in the art. The signal generated by the conjugated antibodies that bind the target in vivo is a specific indicator of antigen localization and can be revealed and quantified by tomographic instruments that are known in the art. The process for the preparation of the antibody of the invention is within the skills of the man skilled in the art and comprises cultivating host cells that have been transfected with a vector for the expression of the antibody and isolating the antibody according to standard procedures.
As far as the industrial aspects of the present invention are concerned, the antibody herein disclosed shall be suitably formulated in pharmaceutical compositions as normally done in this technical field. The antibodies of the present invention may comprise at least one CDRH as defined above that contains one or more amino acid substitutions, deletions or insertions of no more than 4 amino acids, preferably of no more than 2 amino acids. The antibodies of the present invention may further comprise at least one CDRL as defined above that contains one or more amino acid substitutions, deletions or insertions of no more than 4 amino acids, preferably of no more than 2 amino acids. The immunoglobulin, recombinant or synthetic antigen-binding fragments or the nucleic acid molecule or the expression vector or the host cell according to the invention are for medical use. The definition of fragment, derivative or conjugate of an antibody according to the invention, includes a scFv, a Fv fragment, a Fab fragment, a F(ab)2 fragment, a bifunctional hybrid antibody, a multimeric antibody, a derivative that contains biologically active molecules, including a member of the avidin family or a growth factor that can stimulate immunological effectors, or a pharmacologically active molecule, including a toxin, a cytokine, or any other molecule that is able to increase the therapeutic effect, an immunoconjugate, for example with radioactive isotopes, fluorescent tracers, enzymes for chemiluminescence, cytokines or toxins, including enzymatically active toxins of bacterial, fungal, vegetal or animal origin and fragments thereof.
Preferably, the immunoglobulin according to the invention is selected from the group consisting of an intact immunoglobulin, a Fv, a scFv (single chain Fv fragment), a Fab, a F(ab′)2, an “antibody-like” domain, an “antibody-mimetic domain”, a single antibody domain (VH domain or VL domains). The antibody like domain comprises binding proteins structurally related to antibodies such as Tcell receptors.
The term “antibody mimetics” refers to those organic compounds that are not antibody derivatives but that can bind specifically an antigen like antibodies do. They include anticalins, DARPins, affibodies, affilins, affimers, affitins, alphabodies, avimers, fynomers, monobodies and others. The single antibody domain is also called Nanobody (VH domain or VL domains).
Further object of the invention is an isolated nucleic acid molecule encoding the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as defined above or hybridizing with said nucleic acid, or a degenerate sequence thereof Preferably, said nucleic acid molecule has sequence having at least 80% identity to the nucleotide sequence of SEQ ID NOs: 3, 5, 7, 31, 33, 35, 37 or 39 or fragments thereof
The present invention also provides antibodies, or derivatives thereof, with high affinity and directed against distinct portions or specific forms of post-translational modification of the target, such antibodies comprising heavy chain and light chain variable regions as above defined, combined with sequences of human immunoglobulins (IgM, IgD, IgG, IgA, IgE) coding for peptides that do not induce immune response in human
In a preferred aspect of the invention the variable regions of the heavy chains and light chains have been joined to a gamma-1 (G1) heavy chain constant region of human immunoglobulins (Ig) (preferably represented by an aa. sequence encoded by SEQ ID NO:9 or comprising or consisting of SEQ ID NO:30 or derivatives or fragments thererof), for the production of a chimeric antibody. Other objects of the invention are an isolated nucleic acid molecule encoding the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined, or hybridizing with said nucleic acid, or a degenerate sequence thereof, an expression vector encoding the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined, an isolated host cell comprising the nucleic acid as above defined, said cell preferably producing the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined.
Another object of the invention is the immunoglobulin, recombinant or synthetic antigen-binding fragments of the invention or the nucleic acid molecule of the invention or the expression vector of the invention or the host cell of the invention for medical use. The herein mentioned or reported polynucleotide and polypeptide also includes derivatives and functional fragments thereof. The molecules herein mentioned also includes corresponding orthologous or homologous genes, isoforms, variants, allelic variants, functional derivatives, functional fragments thereof. The herein mentioned protein or polypeptide include also the corresponding protein encoded from a corresponding orthologous or homologous genes, functional mutants, functional derivatives, functional fragments or analogues, isoforms thereof. The term “analogue” as used herein referring to a protein means a modified peptide wherein one or more amino acid residues of the peptide have been substituted by other amino acid residues and/or wherein one or more amino acid residues have been deleted from the peptide and/or wherein one or more amino acid residues have been deleted from the peptide and or wherein one or more amino acid residues have been added to the peptide. Such addition or deletion of amino acid residues can take place at the N-terminal of the peptide and/or at the C-terminal of the peptide. A “derivative” may be a nucleic acid molecule, as a DNA molecule, coding the polynucleotide as above defined, or a nucleic acid molecule comprising the polynucleotide as above defined, or a polynucleotide of complementary sequence. In the context of the present invention the term “derivatives” also refers to longer or shorter polynucleotides and/or polypeptides having e.g. a percentage of identity of at least 41% , 50%, 60%, 65%, 70% or 75%, more preferably of at least 85%, as an example of at least 90%, and even more preferably of at least 95% or 100% with the sequences herein mentioned or with their complementary sequence or with their DNA or RNA corresponding sequence. The term “derivatives” and the term “polynucleotide” also include modified synthetic oligonucleotides. The modified synthetic oligonucleotide are preferably LNA (Locked Nucleic Acid), phosphoro-thiolated oligos or methylated oligos, morpholinos, 2′-O-methyl, 2′-O-methoxyethyl oligonucleotides and cholesterol-conjugated 2′-O-methyl modified oligonucleotides (antagomirs). The term “derivative” may also include nucleotide analogues, i.e. a naturally occurring ribonucleotide or deoxyribonucleotide substituted by a non-naturally occurring nucleotide. The term “derivatives” also includes nucleic acids or polypeptides that may be generated by mutating one or more nucleotide or amino acid in their sequences, equivalents or precursor sequences. The term “derivatives” also includes at least one functional fragment of the polynucleotide. In the context of the present invention “functional” is intended for example as “maintaining their activity”, e.g. a TNF-α functional fragment or derivative is able to either: i) mediate direct TNFα-dependent cell cytotoxicity or; ii) act as a chemoattractant molecule to favor the invasion of tumors by inflammatory immune cells or; iii) to favor pro-inflammatory signaling within a tumor in order to create a microenvironment unfavorable for tumor growth conditions by stimulating tumor vasculature, tumor-resident immune cells, tumor-resident stromal cells or the self-same tumor cells. In the context of the present invention, the term “cancer” or “tumor” includes e.g. leukemia, glioblastoma, lymphomas, blood cell cancers, tumors of embrionic/neuroectodermal origin, preferably brain tumor, melanoma, Ewing's sarcomas, and malignant embryonal carcinoma, more preferably metastatic melanoma, breast cancer, colon cancer, pancreatic cancer, preferably T-cell acute lymphoblastic leukemia (T-ALL), more preferably chemotherapy-resistant and/or relapsed and/or refractory tumors. The “tumors” are preferably chemotherapy-resistant and/or relapsed and/or refractory tumors. Another object of the invention is a method of producing the immunoglobulin as above defined comprising culturing the cell that produces the immunoglobulin of the invention and recovering the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof from the cell culture. Another object of the invention is a pharmaceutical composition comprising at least one immunoglobulin, recombinant or synthetic antigen-biding fragments thereof or nucleic acid molecule according to the invention and pharmaceutically acceptable excipients. Preferably, said composition is for use as systemic and local treatment, preferably for intravenous, intratumoral, intraperitoneal, intramuscular, topic and intranasal administration. Systemic is by far the most relevant route, especially when hematological or metastatic cancers are treated. However, protocols using local treatments (e.g. radiotherapy) are also known to elicit a systemic immunological response (Abscopal effect). Intraperitoneal and intravenous administration are e.g. preferred for the immunocytokine format of the present antibodies, as the other routes provided slower uptake and would have had more deleterious, local effects. Unconjugated antibodies can be given by any of the above administration routes. In the context of the present invention local treatment comprises also the use on single metastasis of e.g. melanoma. In the herein described screening procedure to select the antibodies according to the invention, the production of phage from bacteria and their use ex vivo is preferably carried out by intravenous or intra-tumor administration. In the case of nucleic acid molecule, the administration may be by gene therapy by ex vivo genetic modification of cells or by direct infection of tissue cells in the organism, using viral vectors or other gene delivery methods.
In the present invention, the above-mentioned linker preferably consists of a sequence of from 15aa to 19aa which is not subjected to intracellular cleavage by proteases. Preferably the linker between the VH and the VL has a sequence of SEQ ID NO: 27 (GGGGSGGGGSGGGG) (G4SG4SG4). Preferably the linker between VL and TNF-α or between hIgG-Fc tag and TNF-α has a sequence of SEQ ID NO: 28 (SSSSGSSSSGSSSSG) (S4GS4GS4G). All the variants in nucleotide sequence (according to genetic code) that produce the same protein sequences will work equally as linker.
It is also an object of the invention a method of treating and/or preventing a cancer or metastasis comprising administering a therapeutically effective amount of the immunoglobulin or fragment or derivative or conjugate thereof or cellular composition or viral particle or host cells or nucleic acids as above defined. The method for treating or preventing a cancer or metastasis, comprises administering to a patient in need thereof an effective amount of at least one immunoglobulin, fragments or derivatives or conjugates thereof or cellular composition or viral particle or host cells or nucleic acids as described above. In some aspects, the invention comprises a method for treating or preventing tumors and/or metastasis in a subject, the method comprising administering to a subject in need thereof an effective amount of at least one immunoglobulin, fragments or derivatives or conjugates thereof or cellular composition or viral particle or host cells or nucleic acids of the invention simultaneously or sequentially with an anti-cancer agent. Preferably, the above tumor is a chemotherapy-resistant and/or relapsed and/or a refractory tumor.
Nucleic acids encoding immunoglobulins may be obtained from libraries encoding a multiplicity of such molecules. For example, phage display libraries of immunoglobulin molecules are known and may be used in this process. Advantageously, the library encodes a repertoire of immunoglobulin molecules. A “repertoire” refers to a set of molecules generated by random, semi-random or directed variation of one or more template molecules, at the nucleic acid level, in order to provide a multiplicity of binding specificities. Methods for generating repertoires are well characterized in the art. It is another object of the invention a pharmaceutical composition comprising at least one immunoglobulin, antibody, recombinant or synthetic antigen-binding fragments thereof as described above and pharmaceutically acceptable excipients, preferably for use in systemic, local, intraperitoneal, intramuscular or intranasal administration.
The composition comprises an effective amount of the immunoglobulin, antibody, recombinant or synthetic antigen-binding fragments thereof Pharmaceutical compositions are conventional in this field and can be made by the person skilled in the art just based on the common general knowledge. For sake of brevity, the preferred antibody according to the present invention shall be identified with the name IEOmAB1 (comprising SEQ ID NO: 2), IEOmAB2 (comprising SEQ ID NO:4) and IEOmAB3 (comprising SEQ ID NO:6).
Still preferably, the antibody, immunoglobulin, recombinant or synthetic antigen-biding fragments thereof is a scFv, Fv fragment, a Fab fragment, a F(ab)2 fragment, a multimeric antibody, a peptide or a proteolytic fragment containing the epitope binding region.
It is a further object of the present invention a nucleic acid encoding the immunoglobulin, recombinant or synthetic antigen-biding fragments thereof, the antibody or functional derivatives thereof of the invention (e.g. effector domains for protein degradation, imaging, catalysis and also genetic tags, binding switches, localization peptides) or hybridizing with the above nucleic acid or consisting of a degenerated sequence thereof.
The process for the preparation of the antibody is within the skills of the man skilled in the art and comprises cultivating host cell and isolating the antibody according to standard procedures.
The antibodies of the present invention may comprise at least one of the sequence as herein defined that contains one or more amino acid substitutions, deletions or insertions, preferably of no more than 16 amino acids, more preferably of no more than 8 amino acids. Said antibodies must retain the ability to bind to their epitope.
The antibodies of the invention may be for medical use. Preferably, they are for use in the treatment of cancer. The present antibodies can also be used for diagnostic and/or target identification and/or target validation uses.
The terms “antibody” and “immunoglobulin” can be herein used interchangeably and are used in the broadest sense and encompass various antibodies and antibody mimetics structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), chimeric antibodies, nanobodies, antibody derivatives, antibody fragments, anticalins, DARPins, affibodies, affilins, affimers, affitins, alphabodies, avimers, fynomers, monobodies and other binding domains or antibody fragments or derivatives, so long as they exhibit the desired antigen-binding activity.
The term immunoglobulin also includes “conjugate” thereof. In the context of the present invention “conjugate” in relation to the antibody of the invention includes antibodies (or fragments thereof) conjugated with a substance (a compound, etc.) having a therapeutic activity, e.g. anti-tumor activity and/or cell-killing activity or a cytotoxic agents such as various A chain toxins, ribosomes inactivating proteins, and ribonucleases; bispecific antibodies designed to induce cellular mechanisms for killing tumors (see, for example, U.S. Pat. Nos. 4,676,980 and 4,954,617).
The conjugate may be formed by previously preparing each of the aforementioned antibody molecule and the aforementioned substance having anti-tumor activity and/or cell-killing activity, separately, and then combining them (immunoconjugate) or by ligating a protein toxin used as such a substance having anti-tumor activity and/or cell-killing activity to an antibody gene on a gene according to a genetic recombination technique, so as to allow it to express as a single protein (a fusion protein) (immunotoxin).
An “antibody fragment” refers to a molecule other than an intact antibody that comprises a portion of an intact antibody that binds the antigen to which the intact antibody binds. Said fragments are preferably functional.
Examples of antibody fragments include but are not limited to Fv, Fab, Fab′, Fab′-SH, F(ab′)2; diabodies; linear antibodies; single-chain antibody molecules (e.g. scFv); and multispecific antibodies formed from antibody fragments. VH or VL Fvs are also called “Nanobodies”.
The term “antibody mimetics” refers to those organic compounds or binding domains that are not antibody derivatives but that can bind specifically an antigen like antibodies do. They include anticalins, DARPins, affibodies, affilins, affimers, affitins, alphabodies, avimers, fynomers, monobodies and others.
The term “chimeric” antibody refers to an antibody in which a portion of the heavy and/or light chain is derived from a particular source or species, while the remainder of the heavy and/or light chain is derived from a different source or species.
The terms “full length antibody,” “intact antibody,” and “whole antibody” are used herein interchangeably to refer to an antibody having a structure substantially similar to a native antibody structure or having heavy chains that contain an Fc region.
The terms “host cell,” “host cell line,” and “host cell culture” are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include “transformants” and “transformed cells,” which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
A “human antibody” is one which possesses an amino acid sequence which corresponds to that of an antibody produced by a human or a human cell or derived from a non-human source that utilizes human antibody repertoires or other human antibody-encoding sequences. This definition of a human antibody specifically excludes a humanized antibody comprising non-human antigen-binding residues.
A “humanized” antibody refers to a chimeric antibody comprising amino acid residues from non-human HVRs and amino acid residues from human FRs. In certain embodiments, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the HVRs (e.g., CDRs) correspond to those of a non-human antibody, and all or substantially all of the FRs correspond to those of a human antibody. A humanized antibody optionally may comprise at least a portion of an antibody constant region derived from a human antibody. A “humanized form” of an antibody, e.g., a non-human antibody, refers to an antibody that has undergone humanization.
The term “monoclonal antibody” as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variant antibodies, e.g., containing naturally occurring mutations or arising during production of a monoclonal antibody preparation, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations, which typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody of a monoclonal antibody preparation is directed against a single determinant on an antigen. Thus, the modifier “monoclonal” indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by a variety of techniques, including but not limited to the hybridoma method, recombinant DNA methods, phage-display methods, and methods utilizing transgenic animals containing all or part of the human immunoglobulin loci, such methods and other exemplary methods for making monoclonal antibodies being described herein.
“Percent (%) of amino acid sequence identity” or “% identity” with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared.
The term “pharmaceutical composition” refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered. The pharmaceutical composition of the present invention can be administered in the form of a dosage unit, for example tablets or capsules, or a solution.
In the present invention the term “effective amount” shall mean an amount which achieves a desired effect or therapeutic effect as such effect is understood by those of ordinary skill in the art. In the present invention, the antibody may be administered simultaneously or sequentially with another therapeutic treatment, that may be a chemotherapy or radiotherapy.
The invention provides formulations comprising a therapeutically effective amount of an antibody as disclosed herein, and preferably a buffer maintaining the pH in the range from about 4.5 to about 8.5, and, optionally, a surfactant.
The formulations are typically for an antibody as disclosed herein, recombinant or synthetic antigen-binding fragments thereof of the invention as active principle concentration from about 0.01 mg/ml to about 100 mg/ml or from about 1-100 mg/kg body weight for nude antibodies and from about 0.05-50 mg/kg body weight for conjugated antibodies. In certain embodiments, the antibody, recombinant or synthetic antigen-binding fragments thereof concentration is from about 0.1 mg/ml to 1 mg/ml; preferably from 1 mg/ml to 10 mg/ml, preferably from 10 to 100 mg/ml. Therapeutic formulations of the antibody/antibodies can be prepared by mixing the antibody having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed., 1980), in the form of lyophilized formulations or aqueous solutions.
Pharmaceutical compositions containing the antibody or immunoglobulin, recombinant or synthetic antigen-biding fragments thereof of the present invention may be manufactured by processes well known in the art, e.g., using a variety of well-known mixing, dissolving, granulating, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes. The compositions may be formulated in conjunction with one or more physiologically acceptable carriers comprising excipients and auxiliaries which facilitate processing of the active compounds into preparations which can be used pharmaceutically. Proper formulation is dependent upon the route of administration chosen. Parenteral routes are preferred in many aspects of the invention.
For injection, including, without limitation, intravenous, intramusclular and subcutaneous injection, the compounds of the invention may be formulated in aqueous solutions, preferably in physiologically compatible buffers such as physiological saline buffer or polar solvents including, without limitation, a pyrrolidone or dimethylsulfoxide.
Formulations for injection may be presented in unit dosage form, e.g. in ampoules or in multi-dose containers. Useful compositions include, without limitation, suspensions, solutions or emulsions in oily or aqueous vehicles, and may contain adjuncts such as suspending, stabilizing and/or dispersing agents. Pharmaceutical compositions for parenteral administration include aqueous solutions of a water-soluble form, such as, without limitation, a salt of the active compound. Additionally, suspensions of the active compounds may be prepared in a lipophilic vehicle. Suitable lipophilic vehicles include fatty oils such as sesame oil, synthetic fatty acid esters such as ethyl oleate and triglycerides, or materials such as liposomes. Aqueous injection suspensions may contain substances that increase the viscosity of the suspension, such as sodium carboxyl ethyl cellulose, sorbitol, or dextran. Optionally, the suspension may also contain suitable stabilizers and/or agents that increase the solubility of the compounds to allow for the preparation of highly concentrated solutions. Alternatively, the active ingredient may be in powder form for constitution with a suitable vehicle, e.g., sterile, pyrogen-free water, before use.
For oral administration, the compounds can be formulated by combining the active compounds with pharmaceutically acceptable carriers well-known in the art. Such carriers enable the compounds of the invention to be formulated as tablets, pills, lozenges, dragees, capsules, liquids, gels, syrups, pastes, slurries, solutions, suspensions, concentrated solutions and suspensions for diluting in the drinking water of a patient, premixes for dilution in the feed of a patient, and the like, for oral ingestion by a patient. Pharmaceutical preparations for oral use can be made using a solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding other suitable auxiliaries if desired, to obtain tablets or dragee cores. Useful excipients are, in particular, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol, cellulose preparations such as, for example, maize starch, wheat starch, rice starch and potato starch and other materials such as gelatin, gum tragacanth, methyl cellulose, hydroxypropyl-methylcellulose, sodium carboxy-methylcellulose, and/or polyvinylpyrrolidone (PVP). If desired, disintegrating agents may be added, such as cross-linked polyvinyl pyrrolidone, agar, or alginic acid. A salt such as sodium alginate may also be used.
For administration by inhalation, the antibody of the present invention can conveniently be delivered in the form of an aerosol spray using a pressurized pack or a nebulizer and a suitable propellant. The antibody may also be formulated in rectal compositions such as suppositories or retention enemas, using, e.g., conventional suppository bases such as cocoa butter or other glycerides.
In addition to the formulations described previously, the antibody or immunoglobulin, recombinant or synthetic antigen-biding fragments thereof may also be formulated as depot preparations. Such long acting formulations may be administered by implantation (for example, subcutaneously or intramuscularly) or by intramuscular injection. The compounds of this invention may be formulated for this route of administration with suitable polymeric or hydrophobic materials (for instance, in an emulsion with a pharmacologically acceptable oil), with ion exchange resins, or as a sparingly soluble derivative such as, without limitation, a sparingly soluble salt.
Additionally, the antibody may be delivered using a sustained-release system, such as semi-permeable matrices of solid hydrophobic polymers containing the therapeutic agent. Various sustained-release materials have been established and are well known by those skilled in the art. Sustained-release capsules may, depending on their chemical nature, release the compounds for a few weeks up to over 100 days. Depending on the chemical nature and the biological stability of the particular compound, additional stabilization strategies may be employed. Other delivery systems such as liposomes and emulsions can also be used.
A therapeutically effective amount refers to an amount of compound effective to prevent, alleviate or ameliorate cancer or cancer recurrence symptoms. Determination of a therapeutically effective amount is well within the capability of those skilled in the art, especially in light of the disclosure herein.
For any antibody or immunoglobulin, recombinant or synthetic antigen-biding fragments thereof used in the methods of the invention, the therapeutically effective amount can be estimated initially from in vitro assays. Then, the dosage can be formulated for use in animal models so as to achieve a circulating concentration range that includes the effective dosage. Such information can then be used to more accurately determine dosages useful in patients.
The amount of the composition that is administered will depend upon the parent molecule included therein. Generally, the amount used in the treatment methods is that amount which effectively achieves the desired therapeutic result in mammals. Naturally, the dosages of the various compounds can vary somewhat depending upon the compound, rate of in vivo hydrolysis, etc. In addition, the dosage, of course, can vary depending upon the dosage form and route of administration.
The range set forth above is illustrative and those skilled in the art will determine the optimal dosing of the compound selected based on clinical experience and the treatment indication. Moreover, the exact formulation, route of administration and dosage can be selected by the individual physician in view of the patient's condition and of the most effective route of administration (e.g., intravenous, subcutaneous, intradermal). Additionally, toxicity and therapeutic efficacy of the antibody and other therapeutic agent described herein can be determined by standard pharmaceutical procedures in cell cultures or experimental animals using methods well-known in the art.
It is contemplated that the treatment will be given for one or more cycles until the desired clinical and biological result is obtained. The exact amount, frequency and period of administration of the compound of the present invention will vary, of course, depending upon the sex, age and medical condition of the patient as well as the severity and type of the disease as determined by the attending clinician.
The term “vector,” as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as “expression vectors”. The vector for use according to the invention is preferably a nanoparticle, a liposome, an exosome, or a viral vector, preferably an adenoviral vector, a herpetoviral vector, a lentiviral vector, a gammaretroviral vector, an adenoassociated vector (AAV), or a vector with a naked DNA plasmid. Preferably said vector is for use in the gene therapy.
The invention also provides a host cell as described above transformed with a vector as described above. The invention further provides a cellular composition comprising at least 50% of the cells as defined above, a viral particle for medical use, preferably for use in the treatment and/or prevention of a cancer, comprising the immunoglobulin, recombinant or synthetic antigen-biding fragments thereof or the vector as described above. The invention further provides the immunoglobulin, recombinant or synthetic antigen-binding fragments thereof, the nucleic acid, the vector, the host cell, the cellular composition or the viral particle as defined above in combination with at least one therapeutic treatment.
Different immunoglobulin, recombinant or synthetic antigen-binding fragments thereof as above defined may also be used in combination.
Preferably the therapeutic treatment is selected from the group consisting of radiotherapy or chemotherapy. The immunoglobulin, the nucleic acid, the vector, the host cell, the cellular composition or the viral particle for use as defined above may also be used in combination with the anti-angiogenic agent or anti-viral agent. The invention further provides a pharmaceutical composition comprising the vector as described above or the host cell as described above or the viral particle as described above or the cellular composition as described above and at least one pharmaceutically acceptable excipient, preferably for medical use, more preferably in the treatment and/or prevention of a cancer. Preferably the pharmaceutical composition further comprises at least one therapeutic agent, as e.g. cancer drugs (such as 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), Capecitabine (Xeloda®), Cytarabine (Ara-C®), Floxuridine, Fludarabine, Gemcitabine (Gemzar®), Hydroxyurea, Methotrexate, Pemetrexed (Alimta®), Taxanes: paclitaxel (Taxol®) and docetaxel (Taxotere®), Epothilones: ixabepilone (Ixempra®), Vinca alkaloids: vinblastine (Velban®), vincristine (Oncovin®), and vinorelbine (Navelbine®), Estramustine (Emcyt®), Prednisone, Methylprednisolone (Solumedrol®), Dexamethasone (Decadron®), Monoclonal antibody therapy, such as rituximab (Rituxan®) and alemtuzumab (Campath®), Non-specific immunotherapies and adjuvants (other substances or cells that boost the immune response), such as BCG, interleukin-2 (IL-2), and interferon-alfa, Immunomodulating drugs, such as thalidomide and lenalidomide (Revlimid®)). Preferably, in the vector as described above, the polynucleotide is under the control of a promoter capable of efficiently expressing said polynucleotide or polypeptide.
The vector according to the invention can comprise, in the 3′UTR of the transgene, miRNA-responsive modules which destabilise the resulting mRNA in undesirable cell types, for example in order to obtain a selective expression in the tumour stem cell compartment.
In the vector, the polynucleotide sequence, preferably a DNA sequence, is operatively tied to an appropriate sequence of control of the expression (promoter) for directing the synthesis of mRNA. As examples of promoters inventors can mention the immediate promoter of the early genes of cytomegalovirus (CMV), HSV thymidine kinase, early and late SV40 and retroviral LTRs. The vectors can also contain one or more selectable gene markers.
The cells of the invention also comprise “genetically engineered host cells” which are host cells that have been transduced, transformed or transfected with the polynucleotide or with the vector as described above. As examples of appropriate host cells, it can be mentioned bacterial cells, fungal and yeast cells, insect cells, plant cells and animal cells, preferably cancer cells, or cells derived from biopsies. The introduction of the previously described nucleotide molecules or vector into the host cell can be achieved using methods known to the person skilled in the art, such as, for example, calcium phosphate transfection, DEAE-dextran mediated transfection, electroporation, lipofection, microinjection, viral infection, thermal shock, cell fusion . . . the previously described polynucleotide or vector can be introduced into the cancer cells of the patient using exosomes from engineered autologous cells or artificial nanoparticles or self-complementary adenoassociated viruses.
Suitable routes of administration of the pharmaceutical composition of the invention include, for example, oral, intranasal and parenteral administration . . . Other methods of administration include injection, viral transfer, the use of liposomes, artificial nanoparticles, exosomes from engineered autologous cells and oral intake. The exosomes from engineered autologous cells or artificial nanoparticles or self-complementary adenoassociated viruses can be functionalised if necessary in order to pass through the blood-brain bather following intravenous administration.
In another aspect, the antibody or derivatives thereof comprises a heavy chain variable domain (VH) sequence (or a VL sequence) having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to an amino acid sequence selected from the group of: of SEQ ID No: 21-26. In certain embodiments, the VH sequence (or the VL sequence) having at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the above-mentioned sequences contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but the antibody comprising that sequence retains the ability to bind the tumor cells.
In the present invention, “at least 80% sequence identity” means that the identity may be at least 80% or at least 85% or 90% or 91% or 92% or 93% or 94% or 95% or 96% or 97% or 98% or 99% or 100% sequence identity to referred sequences.
The term “immunoglobulin” refers to any moiety capable of binding a target, in particular a member of the immunoglobulin superfamily, including T-cell receptors and antibodies. It includes any fragment of a natural immunoglobulin which is capable of binding to a target molecule, for example antibody fragments such as Fv (also called “Nanobodies”) and scFv. The term “target” includes antigens, which may be targets for antibodies, T-cell receptors, or other immunoglobulin.
The term “immunoglobulin” or “antibody”, in this document, also refers to antibody mimetic molecules, which even if structurally unrelated to immunoglobulins, are able to exert binding of a desired target upon artificial generation of antibody mimetic libraries. They include anticalins, DARPins, affibodies, affilins, affimers, affitins, alphabodies, avimers, fynomers, monobodies and others.
Preferably, the immunoglobulin is an antibody and the target is an antigen. “Antibody” explicitly includes antibody fragments.
Antibodies, as used herein, refer to complete antibodies or antibody fragments capable of binding to a selected target, and including Fv, ScFv, Fab′ and F (ab′) 2, monoclonal and polyclonal antibodies, engineered antibodies including chimeric, CDR-grafted and humanized antibodies, and artificially selected antibodies produced using phage display or alternative techniques. Small fragments, such as Fv and ScFv, possess advantageous properties for diagnostic and therapeutic applications on account of their small size and consequent superior tissue distribution. Preferably, the antibody is a single chain antibody or scFv.
The antibodies according to the invention are especially indicated for diagnostic and therapeutic applications, target validation studies. Accordingly, they may be altered antibodies comprising an effector protein such as a toxin or a label, or an enzyme. Especially preferred are labels which allow the imaging of the distribution of the antibody in vivo. Effector groups may be added prior to the selection of the antibodies by the method of the present invention, or afterwards. Recombinant DNA technology may be used to improve the antibodies of the invention.
The term “antibody library” refers to a collection of antibodies and/or antibody fragments displayed for screening and/or combination into full antibodies. The antibodies and/or antibody fragments may be displayed on a ribosome; on a phage; or on a cell surface, in particular a yeast cell surface.
As used herein, the term “single-chain variable fragment” or “scFv” is a fusion protein comprising the variable regions of the heavy (VH) and light chains (VL) of an immunoglobulin, in which the VH and VL are covalently linked to form a VH:VL heterodimer. The VH and VL are either joined directly or joined by a peptide-encoding linker, which connects the N-terminus of the VH with the C-terminus of the VL, or the C-terminus of the VH with the N-terminus of the VL. The linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility. Despite removal of the constant regions and the introduction of a linker, scFv proteins retain the specificity of the original immunoglobulin. Single chain Fv polypeptide antibodies can be expressed from a nucleic acid including VH- and VL-encoding sequences.
The method for diagnosis of tumor according to the present invention is characterized in that it comprises allowing the aforementioned antibodies of the present invention to react with a sample collected from a living body (hereinafter referred to as a biological sample), and detecting a signal(s) of the reacted antibody.
The antibody of the present invention is allowed to react with a biological sample, and a signal of the reacted antibody is then detected, so as to detect a tumor. The obtained antibody signal can be used as an indicator of the amount of an antigen in the biological sample. In detection of a tumor using the antibody of the present invention, first, a biological sample collected as an analyte from a subject, such as a tissue section or blood used as a test target, is allowed to bind to the antibody of the present invention by an antigen-antibody reaction. Subsequently, based on the measurement results of the amount of the bound antibody, the amount of an antigen of interest contained in the biological sample is measured. This measurement may be carried out in accordance with known immunoassay methods. For example, an immunoprecipitation method, an immunoagglutination method, radioimmunoassay, immunonephelometry, a Western blot method, flow cytometry and the like can be used. In radioimmunoassay, a labeled antibody is used, and thus an antibody signal is expressed as the amount of the labeled antibody that is directly detected. Otherwise, an antibody whose concentration or antibody titer has been known may be used as a standard solution, and thus a signal of the target antibody may be expressed as a relative value. That is, both the standard solution and the analyte may be measured using a measurement device, and an antibody signal in a biological sample may be expressed as a value relative to the value of the standard solution used as a criterion. Examples of such radioimmunoassay include the ELISA method, the EI method, the RIA method, fluorescence immunoassay (FIA), and luminescence immunoassay. Of these, the ELISA method is particularly preferable in that it is simple and highly sensitive.
In the present invention, the state of a tumor can be evaluated or diagnosed, using the detection result obtained by the aforementioned detection method as an indicator. For example, when the detection result exceeds a proper control or reference, the state of a tumor is defined as tumor positive, and when the detection result is less than the proper control or reference, it is defined as tumor negative. The term “the state of a tumor” is used herein to mean the presence or absence of the development of a tumor, or the progression degree thereof. Thus, specific examples of the state of a tumor include the presence or absence of the development of a tumor, the progression degree thereof, the degree of malignancy, the presence or absence of metastasis, and the presence or absence of recurrence.
In the aforementioned evaluation, as a state of a tumor to be evaluated, only one state may be selected from the aforementioned examples, or multiple examples may be combined and selected. The presence or absence of a tumor can be evaluated by determining whether or not the tumor has been developed, with reference to the predetermined standard value used as a boundary, based on the obtained detection result. The degree of malignancy is used as an indicator that indicates the progression degree of a cancer. Based on the detection result, the target tumor can be classified into a certain disease stage and it can be evaluated. Otherwise, an early cancer and an advanced cancer can be distinguished from each other, and then they can be evaluated. For example, it is also possible to determine the target tumor as an early cancer or an advanced cancer, using the detection result as an indicator. The metastasis of tumor can be evaluated by determining whether or not neoplasm has appeared at a site apart from the position of the initial lesion, using the detection result as an indicator. The recurrence can be evaluated by determining whether or not the detection result has exceeded the predetermined standard value again after interval stage or remission.
The antibody of the present invention can be provided in the form of a kit for detecting or diagnosing a tumor. The kit of the present invention may comprise a labeling substance, a solid-phase reagent on which the antibody or the labeled antibody has been immobilized, etc., as well as the aforementioned antibody. A labeling substance that labels the antibody means a substance labeled with an enzyme, a radioisotope, a fluorescent compound, a chemiluminescent compound, etc. The kit of the present invention may also comprise other reagents used for carrying out the detection of the present invention, in addition to the aforementioned constitutional elements. For example, when such a labeling substance is an enzyme labeling substance, the kit of the present invention may comprise an enzyme substrate (a chromogenic substrate, etc.), an enzyme substrate-solving solution, an enzyme reaction stop solution, a diluent used for analytes, etc. Moreover, the present kit may further comprise various types of buffers, sterilized water, various types of cell culture vessels, various types of reactors (an Eppendorf tube, etc.), a blocking agent (a serum component such as bovine serum albumin (BSA), skim milk, or goat serum), a washing agent, a surfactant, various types of plates, an antiseptic such as sodium azide, an experimental operation manual (instruction), etc. The kit of the present invention can be effectively used to carry out the aforementioned detection method of the present invention. The kit of the invention optionally comprises control means that can be used to compare the amount or the increase of amount of the antibody as above defined to a value from a control sample. The value may be obtained for example, with reference to known standard, either from a normal subject or from normal population.
The term “sample” with respect to a patient or subject encompasses blood and other liquid samples of biological origin, solid tissue samples such as a biopsy specimen or tissue cultures or cells derived therefrom and the progeny thereof. The definition also includes samples that have been manipulated in any way after their procurement, such as by treatment with reagents; washed; or enrichment for certain cell populations, such as cancer cells. The definition also includes sample that have been enriched for particular types of molecules, e.g., nucleic acids, polypeptides, etc. The term “biological sample” encompasses a clinical sample, and also includes tissue obtained by surgical resection, tissue obtained by biopsy, cells in culture, cell supernatants, cell lysates, tissue samples, organs, bone marrow, blood, plasma, serum, and the like.
The “detecting means” as above defined are preferably at least one antibody, functional analogous or derivatives thereof, or an enzyme substrate. Said antibody, functional analogous or derivatives thereof are specific for said antibody.
In a preferred embodiment, the kit of the invention comprises:
a solid phase adhered antibody specific for said antibody;
detection means of the ligand specific-antibody complex.
The kits according to the invention can further comprise customary auxiliaries, such as buffers, carriers, markers, etc. and/or instructions for use.
The antibodies taught by the present invention or their derivatives can be fused to sequences, single residues or synthetic molecules (tags) that allow antibody purification by affinity chromatography. The tags utilized can be used as detection molecules or indicators (e.g. radioisotopic or fluorescent tags) or enzymatic tags able to catalyze a detectable substrate modification, both for diagnostic use in the lab and for imaging. The diagnostic techniques that can be utilized are for example optical, confocal, multiple foton and electronic microscopy, ELISA, Western blotting, immunoprecipitation, radioimmunological techniques and similar others.
The antibodies defined in the present invention can be used for the preparation of compositions for the detection of neoplasias, including in vivo tumor imaging. The antibodies can be linked to radioactive isotopes or fluorescent tracers, e.g. quantum dots or organic chromophores or enzymes which can be detected by chemiluminescence. The signal originated by labelled antibodies is detectable by scanners or tomography instrumentation, according to the principles of currently used advanced equipment such as TAC/PET.
The present antibodies are therefore useful as an indication of a tumor status.
The present invention will be described by means of non-limiting examples referring to the following figures:
Five tissue slides containing a sequentially-sliced FDA approved paraffin-embedded healthy human tissue array (AMSBIO, 90 specimens, 3 patients per tissue) were used to detect tissue cross-reactivity for: IEOmAB1-hTNFα, hIgG-IEOmAB2-hTNFα, hIgG-IEOmAB3-hTNFα, hIgG-control-TNFα and antibody-free controls Immunocytokine binding was revealed using a biotinylated anti-human TNFalpha antibody and slides were counterstained with Mayer's hematoxylin. Slides were scanned upon an automated immunohistochemical scanner and individual tissue specimens were captured by bright-field microscopy. Representative images from the same patient sample in each tissue are shown at 20× magnification, bright-field microscopy.
The M13 bacteriophage based ETH2-Gold scFv display library20 was used for all experiments. 1011 Ab-phage colony-forming units (CFUs) were injected into healthy 6-8-week-old female C57-CD45.1 animals [Envigo]. Ten minutes post-injection, mice were sacrificed, heart blood was harvested, and cell-bound phage was removed by centrifugation. Unbound phage (1st round in vivo depleted) was amplified via infection of mid-log phase TG1 E.coli and purified as previously described40 41.The depleted phage library produced was co-incubated for 45 minutes ex vivo at 4° C. with 4×106 CD45.1+ WT murine PBMCs to deplete the library of phage binding to house-keeping proteins. Unbound phage were diluted into PBS and infused intravenously into C57-CD45.1 splenomegalic mice (Charles River) previously injected with CD45.2+ syngeneic murine T-ALL. Ten minutes post-injection, animals were sacrificed and mT-ALL infiltrated spleens harvested, smashed and mononuclear cells (MNCs) were purified on Histopaque gradient. Four million counted splenic MNCs were lysed and eluted phage was then used to infect mid-log phase TG1 (2nd round mT-ALL blast binding phage). A third and final round of in vivo biopanning was performed using 1011 CFUs from the 2nd round phage with pre-depletion upon CD45.2+ PBMCs. All phage preparation-CFUs were determined in triplicate.
Competitive Flow Cytometry Binding Assay to Select scFv Candidates
Following phage infection, single TG1-scFV-myc-phage clones were picked and grown to mid-log phase in selective 2xTY media and scFv production was induced over night in the presence of IPTG. The resulting monoclonal cultures were pelleted and then subjected to TES lysis as previously described41 to isolate periplasmic proteins. ScFv-MYC protein expression was evaluated via Western Blot using an anti-myc tag monoclonal antibody (Abeam). Periplasm from scFv-MYC expressing clones were then incubated overnight with 1 million fixed cells containing 50% murine T-ALL blasts (CD45.2+) and 50% normal MNCs from mouse spleen and bone marrow (CD45.1+). Cell pellets were washed and probed with anti CD45.1-FITC monoclonal antibody (BD Pharmingen) and anti myc-biotin antibody (Miltenyi) and re-probed with an anti-biotin-APC labeled secondary antibody (Miltenyi), before acquisition by flow cytometry.
Antibodies were judged to be candidates if they bound more than 20% of murine T-ALL blasts (FITC+) and exhibited at least 2.5-fold stronger signal on tumor than normal cells. Initial Candidates were confirmed by repeated flow cytometry binding to mT-ALL blasts using different periplasmic preparations from the same clone. Out of 800-screened clones, 83 met the criteria, of which the 25 best performing, non-redundant clones were selected. The TOP25 candidates were then produced in large scale and, secreted scFv protein was purified from ultra-filtrated supernatant by running it by AKTA over a 1 ml packed Protein A Sepharose resin (GE Healthcare). Bound scFv proteins were washed with buffer containing 0.1% Triton-X114 to remove endotoxin. Proteins were eluted on column with 0.1M TEA and eluted into 1M Tris pH 7.4. Protein concentration and buffer exchange were performed on VivaSpin 2 columns, 3000 MWCO to 99.5% purity. The 10 best producing scFv-clones were then used for further tests.
In Vivo Phage Localization
Phage intended for in vivo use was precipitated as previously described40, and were certified to be bacteria-free by limited dilution plating. C57/BI-6J mice bearing full-blown syngeneic mT-ALL tumors with palpable splenomegaly, or their tumor-free littermates were injected with 1×1011 CFUs of the indicated scFv-phage clones, a non-cell binding naïve scFv-phage, or PBS as indicated. Two days post-injection, mice were sacrificed and spleens were collected. Spleen cells (10000) were added to 1 ml of mid-log phase TG1 then subjected to limiting dilution plating. All titrations were performed in triplicate and the resulting CFUs were taken as a proxy of in vivo phage biolocalization.
Counted cells from single cell spleen-suspensions were similarly examined by flow cytometric analysis to count the number of T-ALL blasts (hCD45+ or CD4+CD8+ cells).
In Vivo Phage Treatments
For in vivo phage therapy in a low-grade disease setting, 6-8 week old female NOD-scid-IL2rgamma null mice (The Jackson Laboratory) were injected with 1 million 03008 hT-ALL PDX blasts22 that had been previously co-incubated at with either tumor binding (IEOmAB1) or non-binding (Naïve) phage. Forty-eight hours later, intravenous treatment every 3 days with 1011 of the same phage was commenced. Tumor progression was monitored weekly by hematological analysis (Becton Coulter AcT 5Diff Hematological Analyzer) and flow cytometry. In vivo experimentation using phage was done in accordance with the Italian Ministry Of Health approved animal project #29/2013.
Cell Culture
All cell lines were maintained in accordance with the indications of the American Type Cell Culture Collection (www.atcc.org) or DSMZ (www.dsmz.de). Cell line identity has been verified by an in-house tissue culture service.
Eukaryotic Antibody and Immunocytokine Cloning and Production
Human IgG-scFvs were generated by subcloning single scFv sequences into pINFUSE hIgG1-Fc2 vector (InVivoGen) via Gibson assembly42. Due to biochemical incompatibility between IEOmAB1 scFv and the hIgG1-Fc domain, IEOmAB1 was cloned into the same vector from which the hIgG1-Fc2 sequence had been excised by restriction digestion.
Immuno-cytokine (IC) constructs were generated by fusing the 17 kD secreted form of human TNFα and a (S4G)3 [SSSSGSSSSGSSSSG] (SEQ ID NO:28) flexible polylinker to the 3′ end of the hIgG1-Fc2-scFv clones described above. Similar methods were used to directly fuse scFv clones with the human TNFα (S4G)3 polylinker.
Human IgG- and - and IC vectors were transiently transfected into HEK-293T cells by polyethyleneimine method43, and grown in serum free medium for 5 days. Medium containing the secreted proteins were passed through 0.22 μm filters, supplemented with protease inhibitors and affinity purified in batch overnight. ScFv-TNFα via Protein A Sepharose while scFv-hIgG1, and scFv-hIgG-TNFaα via Protein G Sepharose (GE Healthsciences). Proteins were eluted as described above and concentrated upon 30,000 kD MWCO Vivaspin 20 centrifugal concentrators. Purified proteins were buffer exchanged into 50% glycerol supplemented with 10 mM Tris pH 7.0 and 150 mM NaCl for long term storage. Proteins were run on 12.5% SDS-PAGE and the presence of fusion proteins was verified by Western blot (rabbit anti-human TNFα [Abcam] or donkey anti human Fab2-HRP [Jackson Immunological Research]). Protein concentration and purity was determined via Western blot or Commassie against a relevant standard curve.
In Vitro Toxicity of ICs
In vitro susceptibility to free human TNFα was established in a continuous co-culture system. or A375 human melanoma, MM27 human melanoma PDX (5×104), #03008 human T-ALL PDX cells or CEM human T-ALL cells (5×106) or were incubated for 4 days in the presence of IC proteins or human TNFα protein (Peprotech) in 2-fold serial dilutions from 190 nM to 0.005 nM concentration. Cells were trypsinized, counted, their viability determined by Trypan blue exclusion via Automated Cell Counters (BioRad).
To determine binding-dependency of immune-cytokine proteins, #03008 or CEM cells (5×106) were co-incubated on ice for 30 minutes with equimolar concentrations of hIgG-scFv conjugates, IC and cytokine proteins. Cells were then pelleted by centrifugation, washed twice with ice-cold PBS and then resuspended in growth medium supplemented with amphotericin B (2.5 μg/ml) and gentamicin (50 μg/ml). Cell growth and viability was determined as described above.
In Vivo Treatment with Immuno-cytokines
For intravenous treatments of T lymphoblastic leukemia, IC proteins were injected at equimolar therapeutic doses (≅0.25 mg/kg/mouse for immunocytokines). IC protein was diluted such that each mouse received a precisely similar amount of IC protein and storage buffer (see above) diluted into 300 μl of PBS/mouse/injection. Mice received injections 2-3 times per week via tail vein and were then monitored daily for adverse reactions. A small amount of peripheral blood was periodically drawn to monitor disease progression via hematological analyzer and flow cytometry. All mice received at least 10 total injections and were then monitored daily, until exhibiting signs of morbidity, when they were sacrificed.
For treatments of human melanoma xenografts, age and sex-matched Avertin-anesthetized NSG mice were injected intradermically with 250,000 MM27 or MM6 cells, as previously described25. For intratumoral injections, fully acclaimed tumors (≈=30 mm2) were injected with 50 μl per day of PBS containing equimolar concentrations of IC proteins (150-250 ng). Injection points were rotated daily and tumor progression assessed by digital calipers daily prior to injection. All mice received at least 5 intratumoral injections and animals were sacrificed when their tumors exceeded 120 mm2, in accordance with institutional and international guidelines. For intravenous treatments, mice were xenografted with 250,000 MM26 cells and when animals had a palpable hyperkeratosis in the injection zone (7-10 days post-transplant), mice were treated as above with thrice weekly injections of 0.25 mg/kg/mouse. Animals that did not yield a measureable tumor within 14 days were excluded from the analysis. All experiments were performed at least in duplicate, and representative data is shown.
Immune Infiltration Analysis of Melanoma Xenografts
Age-matched male NSG animals bearing ≅50 mm2 MM27 melanoma xenografts were injected with a single equimolar dose of IC diluted in 100 μl of PBS (150-250 ng). Forty-eight hours post-injection animals were sacrificed and tumors excised. A third of the tumor mass was fixed in 4% PFA overnight before embedding in OCT compound (Tissue Tek) while the remainder was minced and digested in the presence of collagenase A (0.5 mg/ml) [Roche]25. Tumor homogenates were then successively filtered through cell strainers and washed twice in PBS+1 mM EDTA pelleted and red blood cells were lysed with ACK buffer. The resulting cell suspension was counted and fixed with 1% PFA for 15 minutes at 4° C.
Immune infiltrates were quantified by cytometry using either the FACSAria or FACSCanto machines (Becton Dickinson). Total immune infiltrate was assayed by CD11b-APC (BD Pharmingen) antibody. All experiments involving in vivo administration of immunocytokine proteins were done in accordance with the project #968/2017, approved by the Italian Ministry of Health.
Immunohistochemistry and Tissue Immunofluorescence
IC binding to tumor tissue was determined against whole organ tissue fixed overnight at 4° C. in 4% paraformaldehyde and exchanged overnight in 30% sucrose. #03008 hT-ALL infiltrated mouse spleen pre- or post-therapy were embedded in OCT medium and cut into 5-micron slices on frosted microscope slides. Slices were fixed with 30% ethanol and endogenous peroxidases were neutralized by 10-minute incubation with 0.3% hydrogen peroxide. Slides were probed with 1 ng of the indicated immunocytokine protein in 100 μl PBS+2% BSA overnight in a 4° C. humidified chamber. Sections were washed 3 times and probed with a biotinylated rabbit anti human TNFα antibody (R&D Biosystem) for 4 hours at room temperature. Sections were again washed extensively and developed for 1 hr. using the ABC kit (Vector Labs) according to the manufacturers protocol. Antibody binding was revealed by DAB staining and sections were counter-stained by hematoxylin-eosin.
Detection of apoptotic cells within immunocytokine treated melanoma xenografts was performed as indicated above. Rabbit anti cleaved caspase 3 antibody (Cell Signaling Technologies) was used to visualize activation of apoptosis, followed by goat anti rabbit goat-HRP and visualized by DAB positivity. At least 5 distant slices were examined per tumor. All images were acquired on a Nikon color Digital Sight DS-5mc light microscope.
OCT-frozen sections (5 μm, micrometer) were fixed in 4% paraformaldehyde and pre-blocked with PBS supplemented with 1% BSA and normal donkey serum. Primary antibodies were incubated overnight in a 4 degree humidified chamber. Sections were probed with human anti-TNFα (Miltenyi), rabbit anti-mouse cd11b (BD Biosciences), phalloidin FITC and DAPI. Sections were washed and probed with donkey anti rabbit Cy3. Images were acquired upon an Olympus BX61 upright fluorescence microscope using 40× or 60× oil-immersion objectives. Images were analyzed using ImageJ software.
Five tissue slides containing a sequentially sliced FDA approved paraffin-embedded healthy human tissue array (AMSBIO, 90 specimens, 3 patients per tissue) were used to detect full human immunocytokine proteins (IEOmAB1-hTNFα, hIgG-IEOmAB2-hTNFα, hIgG-IEOmAB3-hTNFα) with respective controls hIgG-control-TNFα and antibody-free) For IHC analysis paraffin was removed with xylene and the sections were rehydrated in graded alcohol. Antigen retrieval was carried out using preheated target retrieval solution for 45 minutes. Tissue sections were blocked with FBS serum in PBS for 60 min and incubated overnight with primary immunocytokine protein fused to human IgG1 and human TNFα. The antibody binding was detected with an anti-human TNFα-biotinylated (R&D System) amplified with ABC Kit (Vector lab) followed by a diaminobenzidine chromogen reaction (Peroxidase substrate kit, DAB, SK-4100; Vector Lab). All sections were counterstained with Mayer's hematoxylin and visualized using a bright-field microscope and imaged upon an automated immunohistochemistry scanner. Tissue binding by immunocytokine proteins was graded by an independent pathologist without prior knowledge of the antibody identities or presumed tissue interaction profiles. Stainings were judged as either negative for tissue binding, aspecific/background binding or positive for specific binding.
QPCR Analyses
Snap frozen cell pellets obtained from unfractionated IC-treated MM27 tumors were thawed and mRNAs were extracted using RNeasy columns (Qiagen) and converted to cDNAs using reverse transcriptase following standard protocols. cDNAs were amplified in triplicate by SYBR green (Life Technologies) incorporation method using mouse gene specific primers upon the 7500 Fast Real Time QPCR (Applied Biosystems). mRNA quantifications from −ΔΔt values and their significance were calculated with standard methods and data was obtained from at least 2 different QPCR runs. CT values were normalized versus GAPDH expression levels, and relative fold change values were calculated against the negative control (PBS-injected) MM27 tumor sample.
Statistical Analyses
Kaplan-Meier survival curve analyses and tumor growth curve analyses were performed with the GraphPad Prism software package. Statistical significance of survival outcome was judged by the two-tailed log-rank non-parametric test44, while tumor growth curves were judged by the two-tailed Mann-Whitney test45.
Results
In Vivo Phage Panning Against Growing Mouse TALL Allows Isolation of scFvs with In Vivo Tumor-binding and Anti-leukemic Activities.
To identify antibodies against human T-ALLs (hT-ALL), inventors designed a streamlined workflow (
As a syngeneic model of T-ALL, inventors used a leukemia obtained in C57BL/6 mice following exposure to the mutagen N-ethyl-N-nitrosourea. Blasts express the CD4 and CD8 T-cell antigens, accumulate in the spleen and can be propagated indefinitely in vivo (mT-ALL; not shown). As depicted in
DNA sequence-analyses to eliminate repetitive clones and prioritization of scFvs with the highest production yields reduced numbers of selected clones to 10 non-redundant molecular species (not shown). Cross-reactivity with human T-ALLs for these 10 antibodies produced as Myc-scFv in bacteria or hIgG-scFv fusions in transiently transfected HEK293T cells was assessed by flow cytometry against four hT-ALL cell lines (Jurkat, DND41, T-ALL1 and CEM) and 5 patient derived xenografts (PDXs)22, respectively. Strikingly, 9 of the 10 best antibodies showed >20% reactivity with at least two independent T-ALL specimens (
In vivo anti-leukemic activity was evaluated for the nine phage clones (IEOmAB1, N3H1, IEOmAB3, IEOmAB5, T2D3, T2E7, T2G5, T1E9, T2E9). Intact phage-particles were injected into mice with end-stage mT-ALL (Phage-Myc-scFv; 1011 particles/mouse) and infiltrated spleens were evaluated after 48 hours for weight and blast infiltration (
Fusion of the IEOmAB1 scFv with Human TNFα Mediates Successful Immunotherapy of hT-ALLs.
Inventors then tested the anti-leukemic activity of our best candidate clone (IEOmAB1) against human T-ALL (hT-ALL), using PDXs from relapsed and chemo-resistant samples22. Flow cytometry analyses of the reactivity of IEOmAB1-Myc-scFv with 5 hT-ALL PDXs, using anti-Myc antibodies, showed specific binding to all samples, though to a variable extent (
Thus, to mimic the putative inflammatory state created by intact phage particles21, inventors fused the IEOmAB1-scFv with human TNFα, a major pro-inflammatory cytokine with potent anti-tumoral activity23, and analyzed the effects of the immune-cytokine on hT-ALL in vivo. One single dose of IEOmAB1-scFv-hTNFα or control-scFv-hTNFα was injected intravenously into end-stage, splenomegalic #03008 PDX bearing mice, which were sacrificed 48 hrs. later. Spleen-infiltrating hT-ALL cells were quantified using human-specific anti-CD45+ antibodies. As shown in
Anti-leukemic Effect of the scFv-TNFα Fusion Depends on its Stable Binding to hT-ALL Cells.
Inventors then analyzed mechanisms underlying the in vivo anti-tumor effects of the IEOmAB1 immuno-cytokine, using cells from the #03008 hT-ALL PDX and CEM, an hT-ALL cell line bound by the IEOmAB1-Myc-scFv (
T-ALL selected immune-cytokines exert in vivo anti-tumor activity against human metastatic melanoma. Inventors next investigated cross-reactivity of our lead scFv with other tumor types using the IEOmAB1 immuno-cytokine and two other selected scFv (IEOmAB3 and IEOmAB2) reconstructed as fully human immune-cytokines (IEOmAB3- and IEOmAB2-hIgG-scFv-TNFα; see Methods). The three immune-cytokines were produced in HEK-293T human cells, purified and tested for binding against 29 human tumor cell-lines of different origin. They bound very poorly to epithelial tumors or other types of leukemia, while showing a strong cross-reactivity with tumors of embryonic/neuro-ectodermal origin (brain tumors, Ewing's sarcomas, melanomas and malignant embryonal carcinoma)24 (
Inventors then evaluated the anti-tumor activity of the three immune-cytokines upon intra-tumoral or systemic administration to melanoma-bearing mice. As a model system, inventors used the MM27 PDX25, which showed strong binding to all three immune-cytokines (
Melanoma cells are TNFα-resistant, yet their sensitivity to scFv-TNFα depends upon tumor binding of the immune-cytokine.
Inventors then analyzed the mechanisms underlying the anti-melanoma effects of the tested immune-cytokines. Surprisingly, in vitro treatment of A375 or MM27 melanoma cells with soluble hTNFα or scFv-fused-hTNFα failed to induce cytotoxicity in vitro, as shown by the Trypan blue exclusion test (
Immuno-cytokines Modulate Host Inflammation within Melanoma Tumors.
Inventors next investigated putative mechanisms of in vivo toxicity of the three immune-cytokines. Large (50-70 mm2) MM27 xenograft tumors were injected with equimolar doses of each of the three immune-cytokines (IEOmAB1-scFv-TNFα; IEOmAB2- or IEOmAB3-hIgG-scFv-TNFα) and 24 hours later mice were sacrificed, tumors excised and evaluated for cell viability. All three immune-cytokines markedly reduced cell viability revealed by Trypan Blue analyses of cell suspensions compared to controls (e.g. PBS, soluble hTNFα, control-hIgG-scFv-TNFα, and control-scFv-hTNFα) (
Staining and scoring of immunohistochemical signal for immunocytokine probed healthy human tissue arrays was performed by an independent pathologist, without prior knowledge of the antibodies being used or the predicted tissue binding patterns. Each score is representative for each of the three human patient-derived specimens for each of the listed tissues. Binding was judged as positive, negative or background (non-specific) and scoring was validated by an independent pathologist technician not involved in the experiment. Immunocytokine-dependent signal was obtained in comparison to a hematoxylin-stained, immunocytokine-free tissue array. The only tissue found to have specific binding for IEOmAB1-scFv-hTNFα, IEOmAB2-scFv-hTNFα, IEOmAB3-scFv-hTNFα was the thymus. All other healthy human tissues gave non-specific binding or no detectable signal. The results would suggest that the 3 candidate antibodies are unlikely to have serious off-tumor binding to essential organs, thus rendering their tumor binding more specific and diminishing the likelihood of systemic collateral effects related to undesirable antibody binding.
Discussion
The use of tumor-targeting antibody therapies has proven a game-changer in cancer treatment. Whether functioning as stand-alone passive immunotherapies or providing the specificity for active immunotherapy approaches, tumor-specific antibodies are the lynchpin. Classical immunotherapy approach begins with the identification of an appropriate antigen, generation of monoclonal antibodies against it, evaluation of their anti-tumor effector function, and format optimization for clinical setting. Development can take years as many obstacles hinder the obtainment of the final product. Indeed, the discovery and validation of antibodies versus true tumor-associated antigens is a rate-limiting step in this process that hampers the application of immunotherapies to the majority of neoplasia (reviewed in Sanchez-Martin12).
Inventors have sought to adapt and streamline a robust platform for the discovery and pre-clinical validation of tumor-targeting antibodies in an unbiased, high-throughput manner. To maximize the capacity to select bona fide human antibodies, inventors used phage-antibody (scFv) synthetic library ETH2-Gold20 in an in vivo setting. In doing so, inventors maximized the possibility of selecting human antibodies targeting accessible antigens in the most relevant setting of a living, immune-competent animal. The in vivo setting provides the physiological selective pressure (immune editing) that shapes the genotype and phenotype of a viable tumor, which may be lost when relying upon cultured cells13,27,28. To instead minimize toxicity in the form of off-tumor binding, inventors have depleted the phage library both in- and ex-vivo versus healthy tissues. Screening steps were then implemented to assay tumor specificity ex vivo (flow cytometry) as well as determine tumor specificity in vivo (phage accumulation assays).
While the single steps of the screening workflow for anti-tumor therapeutic antibody-phages may be not novel, their combination as devised here has never been previously reported. Being unbiased towards the targeted tumor antigen it allows for the discovery of novel binders. Clearly, the possibility of cross-reactivity with normal tissues still remains, albeit, even conventional target-based immunotherapies against the best-characterized antigens have high attrition rates due to unforeseen off-tumor effects29,30. Anticipating the selection stages into immune-competent model organisms and then screening phage-antibody candidates for their tumor-binding properties in vitro and in vivo can minimize the risk of off-target effects. One could argue that the reliance of such screening platforms upon recombinant antibody fragments (such as scFvs) could create immunogenic moieties limiting their effectiveness31. However, CAR-T cell therapies containing tumor-targeting scFvs have been found in treated patients many years post-therapy, indicating that the scFv moiety is not necessarily immunogenic32. In addition, the use of chimeric antibodies, which is the current gold standard, is itself subject to such immunogenicity concerns33,34. Furthermore, it should be noted that the ETH2-Gold scFv is fully human, limiting potential immunogenicity inherent to murine-derived scFvs20. By combining in vivo panning and thorough healthy tissue depletion with simple screening steps to interrogate in vivo specificity, these concerns are largely ameliorated.
The workflow proposed reverses the order of classical antibody generation steps exploiting phage bio-localization to rapidly determine which scFv molecules have the greatest tumor-specificity and the best chance at eliciting an acute or prolonged anti-tumor effect via its inherent, in vivo immunodominant aspects. This step can be performed without time-consuming purification methods or complex biochemistry. In a few days a phage-antibody clone can be produced, injected and evaluated. This allows for the funneling of candidate antibodies towards those with the highest chance of eliciting a specific anti-tumor immune response.
This rapid, yet rigorous screening approach allowed for the identification of several non-redundant scFv molecules targeting murine T-ALL. The production of those from bacterial cultures allowed testing their cross-reactivity versus a large number of human specimens and cell-lines. Inventors found that the majority ( 9/10) of candidate scFvs preselected for binding preferentially to tumor cells rather than to normal WT cells strongly labeled hT-ALL cells suggesting an important inter-species antigen conservation. Binding to hT-ALL samples and in vivo phage activity guided and streamlined the selection and identification of the lead candidate antibody (IEOmAB1) that was subsequently engineered as a TNFα-fused immuno-cytokine endowed with potent anti-leukemic and melanoma activity in vivo. As inventors wanted to determine the in vivo efficacy of our antibody candidates against growing human PDX tumors, inventors utilized the NSG immune-compromised mouse system. NSG mice lack both complement and natural killer cells, therefore antibody dependent cytotoxicity is ablated. Consequently, inventors chose to genetically conjugate present antibodies to proteinaceous immunotoxins to better mimic the tumoricidal effects observed in phage treatments. Interestingly, fusion of tumor-targeting antibodies to TNFα has already shown great promise in a clinical setting,35-37, however their application has been limited to direct tumor administration. This is the first description of systemically injected TNFα-antibody fusions able to elicit an anti-tumor effect in vivo as single agents.
Importantly, IEOmAB 1-scFv manifested durable, reproducible and significant delay in disease progression in 4 independent hT-ALL PDXs, when administered as phage. Inventors then treated the most aggressive of these cases, 03008, and found that TNFα-fused IEOmAB1-scFv significantly delayed the on-set of leukemia when given at an early stage (
Clinical trials of recombinant TNFα as a cancer treatment were often associated with serious general toxicities38,39, interfering with its clinical use. Importantly, IEOmAB1-scFv-hTNFα did not show notable toxicities, despite repeated intravenous boluses. Therefore, the dose administered was insufficient to trigger general toxicity, but sufficient to suppress tumor growth in mice. This likely occurs by the antibody-dependent anchoring of TNFα upon the plasma membrane increasing the local concentration above the threshold necessary to trigger either direct or indirect anti-tumor effects. Therefore, scFv-TNFα dependent cell death must be mediated by an antibody: antigen interaction whose affinity exceeds that of free TNFα for its receptor. Interestingly, inventors found 3 antibodies [hIgG IEOmAB3 hTNFα, hIgG IEOmAB2 hTNFα and IEOmAB1 hTNFα] that consistently labeled human tumor cells of neuro-ectodermal origin suggesting perhaps cross-reactivity with an exposed cancer/embryonic antigen (
Sequences
Included in the present invention are also nucleic acid or aa. sequences derived from the sequences shown below, e.g. functional fragments, mutants, derivatives, analogues, and sequences having a % of identity of at least 70% with the below sequences.
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSA
ISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKXX
XXDYWGQGTLVTVSS
GGGGSGGGGSGGGGSSELTQDPAVSVALGQTVRIT
underlined: library VH domain
bold: CDR3 heavy chain sequence
cursive: linker region
in block and not underlined: library VL domain
grey: CDR3 light chain sequence
XXXX: CDR3 sequences or mutations from the library backbone
In the below sequences, the sequences in bold correspond (from left to right) to DP47 Human heavy chain CDR1, DP47 Human Heavy Chain CDR2, DP47 Human Heavy Chain CDR3, DPL16 Human Lambda Light Chain CDR1, DPL16 Human Lambda Light Chain CDR2, DPL16 Human Lambda Light Chain CDR3.
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSVTRFDYWGQGTLVTVSSGGG
KNNRPSGIPYRFSGSSSGNTASLTITGAQAEDEADYYCNSSRGLARPVVVGGGTKLTVLG
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKTASILDYWGQGTLVTVSSGGGG
NNRPSGIPYRFSGSSSGNTASLTITGAQAEDEADYYCNSSPWHRTSVVFGGGTKLTVLG
ADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKVMGRNAFDYWGQGTLVTASSG
Schematic representation of antibody molecules according to the invention:
1. Mellman, I., Coukos, G. & Dranoff, G. Cancer immunotherapy comes of age. Nature 480, 480-489 (2011).
2. Khalil, D. N., Smith, E. L., Brentjens, R. J. & Wolchok, J. D. The future of cancer treatment: immunomodulation, CARs and combination immunotherapy. Nat Rev Clin Oncol 13, 394 (2016).
3. Corraliza-Gorjon, I., Somovilla-Crespo, B., Santamaria, S., Garcia-Sanz, J. A. & Kremer, L. New Strategies Using Antibody Combinations to Increase Cancer Treatment Effectiveness. Front Immunol 8, 1804 (2017).
4. Weiner, L. M., Surana, R. & Wang, S. Monoclonal antibodies: versatile platforms for cancer immunotherapy. Nat Rev Immunol 10, 317-327 (2010).
5. Garnacho, C., Albelda, S. M., Muzykantov, V. R. & Muro, S. Differential intra-endothelial delivery of polymer nanocarriers targeted to distinct PECAM-1 epitopes. J Control Release 130, 226-233 (2008).
6. Mennonna, D., et al. T cell neoepitope discovery in colorectal cancer by high throughput profiling of somatic mutations in expressed genes. Gut 66, 454-463 (2017).
7. Chen, Y. T., et al. Identification of cancer/testis-antigen genes by massively parallel signature sequencing. Proc Natl Acad Sci USA 102, 7940-7945 (2005).
8. Bassani-Sternberg, M. & Coukos, G. Mass spectrometry-based antigen discovery for cancer immunotherapy. Curr Opin Immunol 41, 9-17 (2016).
9. Turtoi, A., et al. Novel comprehensive approach for accessible biomarker identification and absolute quantification from precious human tissues. J Proteome Res 10, 3160-3182 (2011).
10. Dhanik, A., et al. In-silico discovery of cancer-specific peptide-HLA complexes for targeted therapy. BMC Bioinformatics 17, 286 (2016).
11. Mardis, E. R. Neoantigen Discovery in Human Cancers. Cancer J23, 97-101 (2017).
12. Sanchez-Martin, D., et al. Selection strategies for anticancer antibody discovery: searching off the beaten path. Trends Biotechnol 33, 292-301 (2015).
13. Uva, P., et al. Comparative Membranome expression analysis in primary tumors and derived cell lines. PLoS One 5, e11742 (2010).
14. Johannsen, M., et al. The tumour-targeting human L19-IL2 immunocytokine: preclinical safety studies, phase I clinical trial in patients with solid tumours and expansion into patients with advanced renal cell carcinoma. Eur J Cancer 46, 2926-2935 (2010).
15. Frenzel, A., Schirrmann, T & Hust, M. Phage display-derived human antibodies in clinical development and therapy. MAbs 8, 1177-1194 (2016).
16. Hunger, S. P., et al. Improved survival for children and adolescents with acute lymphoblastic leukemia between 1990 and 2005: a report from the children's oncology group. J Clin Oncol 30, 1663-1669 (2012).
17. Litzow, M. R. & Ferrando, A. A. How I treat T-cell acute lymphoblastic leukemia in adults. Blood 126, 833-841 (2015).
18. Kunz, J. B., et al. Pediatric T-cell lymphoblastic leukemia evolves into relapse by clonal selection, acquisition of mutations and promoter hypomethylation. Haematologica 100, 1442-1450 (2015).
19. Nguyen, K., et al. Factors influencing survival after relapse from acute lymphoblastic leukemia: a Children's Oncology Group study. Leukemia 22, 2142-2150 (2008).
20. Silacci, M., et al. Design, construction, and characterization of a large synthetic human antibody phage display library. Proteomics 5, 2340-2350 (2005).
21. Eriksson, F., et al. Tumor-specific bacteriophages induce tumor destruction through activation of tumor-associated macrophages. J Immunol 182, 3105-3111 (2009).
22. Meyer, L. H., et al. Early relapse in ALL is identified by time to leukemia in NOD/SCID mice and is characterized by a gene signature involving survival pathways. Cancer Cell 19, 206-217 (2011).
23. Brenner, D., Blaser, H. & Mak, T. W. Regulation of tumour necrosis factor signalling: live or let die. Nat Rev Immunol 15, 362-374 (2015).
24. Sarnat, H. B. & Flores-Sarnat, L. Embryology of the neural crest: its inductive role in the neurocutaneous syndromes. J Child Neurol 20, 637-643 (2005).
25. Bossi, D., et al. In Vivo Genetic Screens of Patient-Derived Tumors Revealed Unexpected Frailty of the Transformed Phenotype. Cancer Discov 6, 650-663 (2016).
26. Kratochvill, F., et al. TNF Counterbalances the Emergence of M2 Tumor Macrophages. Cell Rep 12, 1902-1914 (2015).
27. DuPage, M., Mazumdar, C., Schmidt, L. M., Cheung, A. F. & Jacks, T. Expression of tumour-specific antigens underlies cancer immunoediting. Nature 482, 405-409 (2012).
28. Teng, G., et al. MicroRNA-155 is a negative regulator of activation-induced cytidine deaminase. Immunity 28, 621-629 (2008).
29. Morgan, R. A., et al. Cancer regression and neurological toxicity following anti-MAGE-A3 TCR gene therapy. J Immunother 36, 133-151 (2013).
30. Linette, G. P., et al. Cardiovascular toxicity and titin cross-reactivity of affinity-enhanced T cells in myeloma and melanoma. Blood 122, 863-871 (2013).
31. Pavlinkova, G., et al. Effects of humanization and gene shuffling on immunogenicity and antigen binding of anti-TAG-72 single-chain Fvs. Int J Cancer 94, 717-726 (2001).
32. Porter, D. L., et al. Chimeric antigen receptor T cells persist and induce sustained remissions in relapsed refractory chronic lymphocytic leukemia. Sci Transl Med 7, 303ra139 (2015).
33. Schmidt, E., Hennig, K., Mengede, C., Zillikens, D. & Kromminga, A Immunogenicity of rituximab in patients with severe pemphigus. Clin Immunol 132, 334-341 (2009).
34. Harding, F. A., Stickler, M. M., Razo, J. & DuBridge, R. B. The immunogenicity of humanized and fully human antibodies: residual immunogenicity resides in the CDR regions. MAbs 2, 256-265 (2010).
35. Danielli, R., et al. Armed antibodies for cancer treatment: a promising tool in a changing era. Cancer Immunol Immunother 64, 113-121 (2015).
36. Danielli, R., et al. Intralesional administration of L19-IL2/L19-TNF in stage III or stage IVM1a melanoma patients: results of a phase II study. Cancer Immunol Immunother 64, 999-1009 (2015).
37. Bauer, S., et al. Sequential cancer immunotherapy: targeted activity of dimeric TNF and IL-8. Cancer Immun 9, 2 (2009).
38. Roberts, N. J., Zhou, S., Diaz, L. A., Jr. & Holdhoff, M. Systemic use of tumor necrosis factor alpha as an anticancer agent. Oncotarget 2, 739-751 (2011).
39. Chapman, P. B., et al. Clinical pharmacology of recombinant human tumor necrosis factor in patients with advanced cancer. J Clin Oncol 5, 1942-1951 (1987).
40. Monegal, A., et al Immunological applications of single-domain llama recombinant antibodies isolated from a naïve library. Protein Eng Des Sel 22, 273-280 (2009).
41. Massa, P. E., Paniccia, A., Monegal, A., de Marco, A. & Rescigno, M. Salmonella engineered to express CD20-targeting antibodies and a drug-converting enzyme can eradicate human lymphomas. Blood 122, 705-714 (2013).
42. Gibson, D. G., et al. Enzymatic assembly of DNA molecules up to several hundred kilobases. Nat Methods 6, 343-345 (2009).
43. Longo, P. A., Kavran, J. M., Kim, M. S. & Leahy, D. J. Transient mammalian cell transfection with polyethylenimine (PEI). Methods Enzymol 529, 227-240 (2013).
44. Rich, J. T., et al. A practical guide to understanding Kaplan-Meier curves. Otolaryngol Head Neck Surg 143, 331-336 (2010).
45. Heitjan, D. F., Manni, A. & Santen, R. J. Statistical analysis of in vivo tumor growth experiments. Cancer Res 53, 6042-6050 (1993).
46. Madenci A. L., et al. The role of thymectomy in the treatment of juvenile myasthenia gravis: a systematic review. Pediatr Surg Int 33, 683-694 (2017).
47. Rider D. A., et al. A Human CD4 Monoclonal Antibody for the Treatment of T-Cell Lymphoma Combines Inhibition of T-Cell Signaling by a Dual Mechanism with Potent Fc-Dependent Effector Activity. Cancer Res 67, 9945-9953 (2007).
Number | Date | Country | Kind |
---|---|---|---|
18178526.2 | Jun 2018 | EP | regional |
Filing Document | Filing Date | Country | Kind |
---|---|---|---|
PCT/EP2019/066217 | 6/19/2019 | WO | 00 |