RNA targeting of mutations via suppressor tRNAs and deaminases

Abstract
Aspects of the disclosure relate to a gene therapy approach for diseases, disorders, or conditions caused by mutation in the stop codon utilizing modified tRNA. At least 10-15% of all genetic diseases, including muscular dystrophy (e.g. Duchene muscular dystrophy), some cancers, beta thalassemia, Hurler syndrome, and cystic fibrosis, fall into this category. Not to be bound by theory, it is believed that this approach is safer than CRISPR approaches due to minimal off-target effects and the lack of genome level changes.
Description
SEQUENCE LISTING

The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Feb. 8, 2021, is named Sequence-Listing.txt and is 220,167 bytes in size.


BACKGROUND

Aspects of the disclosure relate to a gene therapy approach for diseases, disorders, or conditions caused by mutation in the stop codon using modified tRNA. At least 10-15% of all genetic diseases, including muscular dystrophy (e.g. Duchene muscular dystrophy), some cancers, beta thalassemia, Hurler syndrome, and cystic fibrosis, fall into this category. Not to be bound by theory, it is believed that this approach is safer than CRISPR or TALEN approaches due to minimal off-target effects and the lack of genome level changes.


SUMMARY

Aspects of the disclosure relate to a method for restoring expression of a protein comprising a point mutation in an RNA sequence encoding the protein in a subject in need thereof, the method comprising, or alternatively consisting essentially of, or yet further consisting of administering to the subject a vector encoding one or more tRNA having an anticodon sequence that recognizes a codon comprising the point mutation to the subject, optionally wherein the point mutation results in a premature stop codon, optionally wherein the point mutation results in a premature stop codon. In some embodiments, the point mutation results in a nonsense mutation having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the tRNA is an endogenous tRNA with a modified anticodon stem recognizing the codon comprising the point mutation. In further embodiments, the tRNA is charged with a serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In further embodiments, the vector further comprises a corresponding tRNA synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments involving an orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In further embodiments, the pyrrolysine is administered to the subject by introduction into the diet of the subject. In some embodiments, the vector encodes two tRNA having an anticodon sequence that recognizes the codon comprising the point mutation. In some embodiments, the protein is dystrophin. In a further aspect, the subject is a human and is optionally a pediatric patient.


Further method aspects relate to a treating a disease, disorder, or condition characterized by the presence of a point mutation in an RNA sequence encoding a protein associated with the disease, disorder, or condition in a subject in need thereof, the method comprising, or alternatively consisting essentially of, or yet further consisting of, administering to the subject a vector encoding one or more tRNA having an anticodon sequence that recognizes a codon comprising the point mutation to the subject, optionally wherein the point mutation results in a premature stop codon. In some embodiments, the point mutation results in a nonsense mutation having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the tRNA is an endogenous tRNA with a modified anticodon stem recognizing the codon comprising the point mutation. In further embodiments, the tRNA is charged with a serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In further embodiments, the vector further comprises a corresponding tRNA synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments involving an orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In further embodiments, the pyrrolysine is introduced in the diet of the subject. In some embodiments, the vector encodes two tRNA having an anticodon sequence that recognizes the codon comprising the point mutation. In some embodiments, the disease, disorder, or condition is selected from the group consisting of the diseases, disorders, and conditions listed in Table 1, optionally characterized by the presence of a nonsense mutation and/or a premature stop codon. In some embodiments, the protein is dystrophin. In further embodiments, the disease, disorder, or condition is muscular dystrophy. In still further embodiments, the disease disorder or condition is Duchenne muscular dystrophy. In some embodiments, the subject is a human and is optionally a pediatric patient.


Still further aspects disclosed herein relate to a vector encoding one or more tRNA having an anticodon sequence that recognizes a codon comprising a point mutation in an RNA sequence encoding a protein, optionally wherein the point mutation results in a premature stop codon. In some embodiments, the point mutation results in a nonsense mutation having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the tRNA is an endogenous tRNA with a modified anticodon stem recognizing the codon comprising the point mutation. In further embodiments, the tRNA is charged with a serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In further embodiments, the vector further comprises a corresponding tRNA synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments involving an orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In some embodiments, the vector encodes two tRNA having an anticodon sequence that recognizes the codon comprising the point mutation. In some embodiments, the vector is an AAV vector, optionally an AAV8 vector. In some embodiments, the protein is dystrophin. In a further aspect, the subject is a human and is optionally a pediatric patient.


In another aspect, the disclosure relates to a method for restoring expression of a protein comprising a point mutation in an RNA sequence encoding the protein in a subject in need thereof comprising administering one or more vectors encoding an ADAR based RNA editing system comprising one or more forward guide RNAs for the ADAR (“adRNAs”) and one or more corresponding reverse guide RNAs for the ADAR (“radRNAs”) to the subject, wherein the ADAR based RNA editing system specifically edits the point mutation. In some embodiments, the point mutation results in a nonsense mutation having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the ADAR based RNA editing system converts UAA to UIA and, optionally, further UIA to UII. In some embodiments, the ADAR based RNA editing system converts UAA to UAI. In some embodiments, optionally those involving nonsense or missense mutations, the RNA targeted in mRNA. In further embodiments, the one or more vector further encodes a tRNA that targets an amber codon. In some embodiments, the protein is dystrophin. In some embodiments, the point mutation results in a splice site or missense mutation having the DNA sequence CAG and the RNA sequence CAG. In some embodiments, the ADAR based RNA editing system converts CAG to CIG. In some embodiments, optionally those involving splice site mutations, the RNA targeted is pre-mRNA. In some embodiments, the protein is ornithine transcabamylase. In some embodiments, the ADAR based editing system further comprises ADAR1, ADAR2, the E488Q and E100Q mutants each thereof, a fusion protein comprising the catalytic domain of an ADAR and a domain which associates with an RNA hairpin motif, a fusion protein comprising the catalytic domain of an ADAR and a dead Cas9, or a fusion protein comprising the double stranded binding domain of an ADAR and an APOBEC. In further embodiments, the domain which associates with an RNA hairpin motif is selected from the group of an MS2 bacteriophage coat protein (MCP) and an N22 peptide. In some embodiments, the method further comprises administering an effective amount of an interferon to enhance endogenous ADAR1 expression. In still further embodiments, the interferon is interferon α. In some embodiments, the adRNA comprises one or more RNA hairpin motifs. In some embodiments, the one or more RNA hairpin motifs are selected from the group of an MS2 stem loop and a BoxB loop and/or are stabilized by replacing A-U with G-C. In some embodiments, the adRNA is stabilized through the incorporation of one or more of 2′-O-methyl, 2′-O-methyl 3′phosphorothioate, or 2′-O-methyl 3′thioPACE at either or both termini of the adRNA. In a further aspect, the subject is a human and is optionally a pediatric patient.


Further method aspects relate to a method of treating a disease, disorder, or condition characterized by the presence of a point mutation in an RNA sequence encoding a protein associated with the disease, disorder, or condition in a subject in need thereof, the method comprising, or alternatively consisting essentially of, or yet further consisting of, administering to the subject one or more vectors encoding an ADAR based RNA editing system comprising one or more forward guide RNAs for the ADAR (“adRNAs”) and one or more corresponding reverse guide RNAs for the ADAR (“radRNAs”) to the subject, wherein the ADAR based RNA editing system specifically edits the point mutation. In some embodiments, the point mutation results in a nonsense mutation having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the ADAR based RNA editing system converts UAA to UIA and, optionally, further UIA to UII. In some embodiments, the ADAR based RNA editing system converts UAA to UAI. In some embodiments, optionally those involving nonsense or missense mutations, the RNA targeted in mRNA. In further embodiments, the one or more vector further encodes a tRNA that targets an amber codon. In some embodiments, the protein is dystrophin. In some embodiments, the point mutation results in a splice site or missense mutation having the DNA sequence CAG and the RNA sequence CAG. In some embodiments, the ADAR based RNA editing system converts CAG to CIG. In some embodiments, optionally those involving splice site mutations, the RNA targeted is pre-mRNA. In some embodiments, the protein is ornithine transcabamylase. In some embodiments, the ADAR based editing system further comprises ADAR1, ADAR2, the E488Q and E100Q mutants each thereof, a fusion protein comprising the catalytic domain of an ADAR and a domain which associates with an RNA hairpin motif, a fusion protein comprising the catalytic domain of an ADAR and a dead Cas9, or a fusion protein comprising the double stranded binding domain of an ADAR and an APOBEC. In further embodiments, the domain which associates with an RNA hairpin motif is selected from the group of an MS2 bacteriophage coat protein (MCP) and an N22 peptide. In some embodiments, the method further comprises administering an effective amount of an interferon to enhance endogenous ADAR1 expression. In still further embodiments, the interferon is interferon α. In some embodiments, the adRNA comprises one or more RNA hairpin motifs. In some embodiments, the one or more RNA hairpin motifs are selected from the group of an MS2 stem loop and a BoxB loop and/or are stabilized by replacing A-U with G-C. In some embodiments, the adRNA is stabilized through the incorporation of one or more of 2′-O-methyl, 2′-O-methyl 3′phosphorothioate, or 2′-O-methyl 3′thioPACE at either or both termini of the adRNA. In some embodiments, the disease, disorder, or condition is selected from the group consisting of the diseases, disorders, and conditions listed in Table 1. In further embodiments, the protein is dystrophin and the disease, disorder, or condition is muscular dystrophy. In still further embodiments, the disease disorder or condition is Duchenne muscular dystrophy. In some embodiments, the subject is a human and is optionally a pediatric patient.


Additional aspects relate to a recombinant expression system comprising one or more vectors encoding an ADAR based RNA editing system comprising one or more forward guide RNAs for the ADAR (“adRNAs”) and one or more corresponding reverse guide RNAs for the ADAR (“radRNAs”) to the subject, wherein the ADAR based RNA editing system specifically edits a point mutation in an RNA sequence encoding a protein. In some embodiments, the point mutation results in a nonsense mutation having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the ADAR based RNA editing system converts UAA to UIA and, optionally, further UIA to UII. In some embodiments, the ADAR based RNA editing system converts UAA to UAI. In some embodiments, optionally those involving nonsense or missense mutations, the RNA targeted in mRNA. In further embodiments, the one or more vector further encodes a tRNA that targets an amber codon. In some embodiments, the protein is dystrophin. In some embodiments, the point mutation results in a splice site or missense mutation having the DNA sequence CAG and the RNA sequence CAG. In some embodiments, the ADAR based RNA editing system converts CAG to CIG. In some embodiments, optionally those involving splice site mutations, the RNA targeted is pre-mRNA. In some embodiments, the protein is ornithine transcabamylase. In some embodiments, the ADAR based editing system further comprises ADAR1, ADAR2, the E488Q and E100Q mutants each thereof, a fusion protein comprising the catalytic domain of an ADAR and a domain which associates with an RNA hairpin motif, a fusion protein comprising the catalytic domain of an ADAR and a dead Cas9, or a fusion protein comprising the double stranded binding domain of an ADAR and an APOBEC. In further embodiments, the domain which associates with an RNA hairpin motif is selected from the group of an MS2 bacteriophage coat protein (MCP) and an N22 peptide. In some embodiments, the adRNA comprises one or more RNA hairpin motifs. In some embodiments, the one or more RNA hairpin motifs are selected from the group of an MS2 stem loop and a BoxB loop and/or are stabilized by replacing A-U with G-C. In some embodiments, the adRNA is stabilized through the incorporation of one or more of 2′-O-methyl, 2′-O-methyl 3′phosphorothioate, or 2′-O-methyl 3′thioPACE at either or both termini of the adRNA. In a further aspect, the subject is a human and is optionally a pediatric patient.


Still further aspects relate to a composition comprising any one or more of the vectors disclosed herein and optionally one or more carriers, such as a pharmaceutically acceptable carrier. In some embodiments, the composition further comprises an effective amount of an interferon to enhance endogenous ADAR1 expression. In still further embodiments, the interferon is interferon α.


Some aspects disclosed herein relate to methods for restoring expression of a protein in a subject in need thereof, the method comprising, or alternatively consisting essentially of, or yet further consisting of, administering to the subject a tRNA having an anticodon sequence that recognizes a mutation in an RNA sequence encoding the protein or a vector encoding one or more of said tRNA to the subject. In some embodiments, the mutation is a nonsense mutation, optionally a premature stop codon. In some embodiments, the nonsense mutation is TAA in DNA and UAA in RNA. In some embodiments, the tRNA is a modified endogenous tRNA charged with a canonical amino acid. In some embodiments, the canonical amino acid is serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In some embodiments, the orthogonal tRNA has a corresponding synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments, the non-canonical amino acid is introduced or administered to the subject (e.g. through food), allowing for the induction of the orthogonal tRNA activity. In some embodiments, the non-canonical amino acid is pyrrolysine. In some embodiments, the tRNA targets an amber codon. In some embodiments, the tRNA targets an ochre codon. In some embodiments, the tRNA targets an opal codon. In some embodiments, the protein is dystrophin. In a further aspect, the subject is a human and is optionally a pediatric patient.


Further aspects disclosed herein relate to methods of a disease, disorder, or condition characterized by a protein deficiency in a subject in need thereof, the method comprising, or alternatively consisting essentially or, or yet further consisting of administering a tRNA having an anticodon sequence that recognizes a mutation in an RNA sequence encoding the protein or a vector encoding one or more of said tRNA to the subject. In some embodiments, the mutation is a nonsense mutation, optionally a premature stop codon. In some embodiments, the nonsense mutation is TAA in DNA and UAA in RNA. In some embodiments, the tRNA is a modified endogenous tRNA charged with a canonical amino acid. In some embodiments, the canonical amino acid is serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In some embodiments, the orthogonal tRNA has a corresponding synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments, the non-canonical amino acid is administered or introduced to the subject (e.g. through food), allowing for the induction of the orthogonal tRNA activity. In some embodiments, the non-canonical amino acid is pyrrolysine. In some embodiments, the tRNA targets an amber codon. In some embodiments, the tRNA targets an ochre codon. In some embodiments, the tRNA targets an opal codon. In some embodiments, the protein deficiency is a dystrophin deficiency. In some embodiments, the disease, disorder, or condition is muscular dystrophy. In some embodiments, the muscular dystrophy is Duchene muscular dystrophy. In a further aspect, the subject is a human and is optionally a pediatric patient.


Other aspects relate to a vector encoding one or more tRNA having an anticodon sequence that recognizes a mutation in an RNA sequence encoding the protein. In some embodiments, the mutation is a nonsense mutation, optionally a premature stop codon. In some embodiments, the nonsense mutation is TAA in DNA and UAA in RNA. In some embodiments, the tRNA is a modified endogenous tRNA charged with a canonical amino acid. In some embodiments, the canonical amino acid is serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In some embodiments, the orthogonal tRNA has a corresponding synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments, the vector further comprises the corresponding synthetase. In some embodiments, the non-canonical amino acid is introduced or administered to the subject (e.g. through food), allowing for the induction of the orthogonal tRNA activity. In some embodiments, the non-canonical amino acid is pyrrolysine. In some embodiments, the tRNA targets an amber codon. In some embodiments, the tRNA targets an ochre codon. In some embodiments, the tRNA targets an opal codon. In some embodiments, the protein is dystrophin. In some embodiments, the mutation is a nonsense mutation, optionally a premature stop codon. In some embodiments, the vector is an Adeno-Associated Virus (AAV) vector. In some embodiments, the AAV vector is an AAV8 vector.


Additional aspects of this disclosure relate to on-demand, in vivo production of therapeutic proteins, such as, but not limited to, (i) insulin; (ii) neutralizing antibodies for viruses (e.g. HIV, HCV, HPV, influenza) and bacteria (e.g. Staph Aureus; drug resistant strains). Such method aspects comprise administering to a subject a vector encoding the therapeutic protein with a mutation in its sequence and a tRNA having an anticodon sequence that recognizes the mutation in the RNA sequence encoding the therapeutic protein or a vector encoding one or more of said tRNA. Accordingly, any of the methods and vectors disclosed hereinabove relating to a tRNA having an anticodon sequence that recognizes a mutation in an RNA sequence encoding the protein or a vector encoding one or more of said tRNA may be applied to this aspect, as well.


Some aspects disclosed herein relate to methods for restoring expression of a protein in a subject in need thereof comprising administering an ADAR2 based RNA editing system comprising an ADAR2, one or more forward guide RNAs for the ADAR2 (“adRNAs”), and one or more corresponding reverse guide RNAs for the ADAR2 (“radRNAs”) to the subject, wherein the ADAR2 based RNA editing system specifically edits a mutation in an RNA sequence encoding the protein or one or more vectors encoding said ADAR2, adRNAs, radRNAs. In some embodiments, the ADAR2 based RNA editing system changes adenosine (A) to inosine (I), which is read during translation as guanosine (G). In some embodiments, the mutation is a nonsense mutation. In some embodiments, the nonsense mutation is TAA in DNA and UAA in RNA. In some embodiments, the ADAR2 based RNA editing system causes point mutations at one or more adenosines (A) in the nonsense mutation. In some embodiments, the ADAR2 based RNA editing system converts UAA to UIA (read as UGA). In further embodiments, the ADAR2 based RNA editing system converts UIA (read as UGA) to UAA (read as UGG). In some embodiments, the ADAR2 based RNA editing system converts UAA to UAI (read as UAG). In some embodiments, the method further comprises administering a tRNA, such as one disclosed hereinabove, that recognizes the codon encoded by the ADAR2 edited sequence. In some embodiments, the tRNA is a modified endogenous tRNA charged with a canonical amino acid. In some embodiments, the canonical amino acid is serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In some embodiments, the orthogonal tRNA has a corresponding synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments, the non-canonical amino acid is introduced to the subject (e.g. through food), allowing for the induction of the orthogonal tRNA activity. In some embodiments, the non-canonical amino acid is pyrrolysine. In some embodiments, the tRNA targets an amber codon. In some embodiments, the tRNA targets an ochre codon. In some embodiments, the tRNA targets an opal codon. In some embodiments, the protein deficiency is a dystrophin deficiency. In some embodiments, the disease, disorder, or condition is muscular dystrophy. In some embodiments, the muscular dystrophy is Duchene muscular dystrophy.


Further aspects disclosed herein relate to methods of a disease, disorder, or condition characterized by a protein deficiency in a subject in need thereof comprising administering an ADAR2 based RNA editing system comprising an ADAR2, one or more forward guide RNAs for the ADAR2 (“adRNAs”), and one or more corresponding reverse guide RNAs for the ADAR2 (“radRNAs”) to the subject, wherein the ADAR2 based RNA editing system specifically edits a mutation in an RNA sequence encoding the protein or one or more vectors encoding said ADAR2, adRNAs, radRNAs. In some embodiments, the ADAR2 based RNA editing system changes adenosine (A) to inosine (I), which is read during translation as guanosine (G). In some embodiments, the mutation is a nonsense mutation. In some embodiments, the nonsense mutation is TAA. In some embodiments, the ADAR2 based RNA editing system causes point mutations at one or more adenosines (A) in the nonsense mutation. In some embodiments, the ADAR2 based RNA editing system converts UAA to UIA (read as UGA). In further embodiments, the ADAR2 based RNA editing system converts UIA (read as UGA) to UII (read as UGG). In some embodiments, the ADAR2 based RNA editing system converts UAA to UAI (read as UAG). In some embodiments, the method further comprises administering a tRNA, such as one disclosed hereinabove, that recognizes the codon encoded by the ADAR2 edited sequence. In some embodiments, the tRNA is a modified endogenous tRNA charged with a canonical amino acid. In some embodiments, the canonical amino acid is serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In some embodiments, the orthogonal tRNA has a corresponding synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments, the non-canonical amino acid is introduced to the subject (e.g. through food), allowing for the induction of the orthogonal tRNA activity. In some embodiments, the non-canonical amino acid is pyrrolysine. In some embodiments, the tRNA targets an amber codon. In some embodiments, the tRNA targets an ochre codon. In some embodiments, the tRNA targets an opal codon. In some embodiments, the protein deficiency is a dystrophin deficiency. In some embodiments, the disease, disorder, or condition is muscular dystrophy. In some embodiments, the muscular dystrophy is Duchene muscular dystrophy.


Other aspects relate to a recombinant expression system comprising one or more vectors encoding an ADAR2 based RNA editing system comprising one or more of an ADAR2, one or more forward guide RNAs for the ADAR2 (“adRNAs”), and one or more corresponding reverse guide RNAs for the ADAR2 (“radRNAs”), wherein the ADAR2 based RNA editing system specifically edits a mutation in an RNA sequence encoding a protein. In some embodiments, the ADAR2 changes adenosine (A) to inosine (I), which is read during translation as guanosine (G). In some embodiments, one adRNA/radRNA pair guides the conversion of UAA to UIA (read as UGA). In further embodiments, a second adRNA/radRNA pair guides the conversion of UIA (read as UGA) to UII (read as UGG). In some embodiments, one adRNA/radRNA pair guides the conversion of UAA to UAI (read as UAG). In some embodiments, the one or more vectors or an additional vector further encodes a tRNA, such as one disclosed hereinabove, that recognizes the codon encoded by the ADAR2 edited sequence. In some embodiments, the tRNA is a modified endogenous tRNA charged with a canonical amino acid. In some embodiments, the canonical amino acid is serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In some embodiments, the orthogonal tRNA has a corresponding synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments, the non-canonical amino acid is introduced to the subject (e.g. through food), allowing for the induction of the orthogonal tRNA activity. In some embodiments, the non-canonical amino acid is pyrrolysine. In some embodiments, the tRNA targets an amber codon. In some embodiments, the tRNA targets an ochre codon. In some embodiments, the tRNA targets an opal codon. In some embodiments, the protein is dystrophin. In some embodiments, the mutation is a nonsense mutation. In some embodiments, the vector is an Adeno-Associated Virus (AAV) vector. In some embodiments, the AAV vector is an AAV8 vector.


Additional aspects of this disclosure relate to on-demand, in vivo production of therapeutic proteins, such as, but not limited to, (i) insulin; (ii) neutralizing antibodies for viruses (e.g. HIV, HCV, HPV, influenza) and bacteria (e.g. Staph Aureus; drug resistant strains). Such method aspects comprise administering to a subject a vector encoding the therapeutic protein with a mutation in its sequence and an ADAR2 based RNA editing system comprising an ADAR2, one or more forward guide RNAs for the ADAR2 (“adRNAs”), and one or more corresponding reverse guide RNAs for the ADAR2 (“radRNAs”), wherein the ADAR2 based RNA editing system specifically edits a mutation in an RNA sequence encoding the protein or one or more vectors encoding said ADAR2, adRNAs, radRNAs. Accordingly, any of the methods and vectors disclosed hereinabove relating to an ADAR2 based RNA editing system specifically edits a mutation in an RNA sequence encoding the protein or a vector encoding one or more vectors encoding said ADAR2, adRNAs, radRNAs.












PARTIAL SEQUENCE LISTING















mU6, tRNA (U25C) Amber


(SEQ ID NO: 1)


tcccggggtttccgccaTTTTTTGGTACTGAGtCGCCCaGTCTCAGATAGATCCGACGCCGCC





ATCTCTAGGCCCGCGCCGGCCCCCTCGCACAGACTTGTGGGAGAAGCTCGGCTAC





TCCCCTGCCCCGGTTAATTTGCATATAATATTTCCTAGTAACTATAGAGGCTTAAT





GTGCGATAAAAGACAGATAATCTGTTCTTTTTAATACTAGCTACATTTTACATGA





TAGGCTTGGATTTCTATAAGAGATACAAATACTAAATTATTATTTTAAAAAACAG





CACAAAAGGAAACTCACCCTAACTGTAAAGTAATTGTGTGTTTTGAGACTATAAA





TATCCCTTGGAGAAAAGCCTTGTTTGggaaacctgatcatgtagatcgaaCggactCTAaatccgttcagc





cgggttagattcccggggtttccgccaTTTTTTCCTAGACCCAGCTTTCTTGTACAAAGTTGG





mU6, tRNA (U25C) Ochre


(SEQ ID NO: 2)


tcccggggtttccgccaTTTTTTGGTACTGAGtCGCCCaGTCTCAGATAGATCCGACGCCGCC





ATCTCTAGGCCCGCGCCGGCCCCCTCGCACAGACTTGTGGGAGAAGCTCGGCTAC





TCCCCTGCCCCGGTTAATTTGCATATAATATTTCCTAGTAACTATAGAGGCTTAAT





GTGCGATAAAAGACAGATAATCTGTTCTTTTTAATACTAGCTACATTTTACATGA





TAGGCTTGGATTTCTATAAGAGATACAAATACTAAATTATTATTTTAAAAAACAG





CACAAAAGGAAACTCACCCTAACTGTAAAGTAATTGTGTGTTTTGAGACTATAAA





TATCCCTTGGAGAAAAGCCTTGTTTGggaaacctgatcatgtagatcgaaCggactTTAaatccgttcagc





cgggttagattcccggggtttccgccaTTTTTTCCTAGACCCAGCTTTCTTGTACAAAGTTGG





mU6, tRNA (U25C) Opal


(SEQ ID NO: 3)


tcccggggtttccgccaTTTTTTGGTACTGAGtCGCCCaGTCTCAGATAGATCCGACGCCGCC





ATCTCTAGGCCCGCGCCGGCCCCCTCGCACAGACTTGTGGGAGAAGCTCGGCTAC





TCCCCTGCCCCGGTTAATTTGCATATAATATTTCCTAGTAACTATAGAGGCTTAAT





GTGCGATAAAAGACAGATAATCTGTTCTTTTTAATACTAGCTACATTTTACATGA





TAGGCTTGGATTTCTATAAGAGATACAAATACTAAATTATTATTTTAAAAAACAG





CACAAAAGGAAACTCACCCTAACTGTAAAGTAATTGTGTGTTTTGAGACTATAAA





TATCCCTTGGAGAAAAGCCTTGTTTGggaaacctgatcatgtagatcgaaCggactTCAaatccgttcagc





cgggttagattcccggggtttccgccaTTTTTTCCTAGACCCAGCTTTCTTGTACAAAGTTGG





MmPylRS (AfIII)


(SEQ ID NO: 4)


CAGCCTCCGGACTCTAGAGGATCGAACCCTTAAGgccaccATGGATAAGAAACCTTT





GAACACTCTCATTAGTGCGACAGGGCTCTGGATGTCCCGAACGGGGACTATACA





CAAGATAAAACACCATGAGGTCTCAAGGAGCAAAATCTATATCGAGATGGCATG





CGGCGACCATCTTGTGGTAAATAATAGTAGGTCCTCCAGGACGGCAAGAGCACT





CCGACATCACAAGTACAGAAAAACCTGCAAACGGTGTAGGGTATCCGACGAAGA





CTTGAACAAATTTTTGACTAAGGCCAACGAGGATCAAACTTCTGTCAAAGTGAAA





GTGGTTTCTGCTCCTACCCGAACTAAGAAGGCCATGCCCAAGTCCGTGGCAAGGG





CACCCAAGCCACTCGAAAATACTGAGGCCGCTCAGGCCCAACCATCCGGTAGTA





AGTTCAGTCCAGCCATACCCGTAAGTACCCAAGAATCTGTCAGTGTGCCGGCCTC





AGTTTCCACATCTATAAGTTCAATTTCTACAGGAGCGACGGCCTCCGCCCTCGTC





AAGGGTAACACAAACCCGATAACTTCTATGAGTGCCCCCGTACAGGCATCCGCA





CCAGCACTGACGAAGTCTCAAACTGATAGGCTGGAAGTGCTCTTGAATCCGAAG





GACGAGATATCTCTTAACTCCGGTAAACCTTTCCGGGAGCTGGAAAGTGAACTTC





TCAGCCGGCGAAAAAAAGACCTCCAGCAAATTTACGCAGAGGAAAGGGAGAAC





TATCTGGGGAAGTTGGAACGAGAGATCACCCGATTCTTTGTCGATCGCGGATTTT





TGGAGATTAAAAGCCCAATTCTCATCCCCCTTGAATATATCGAACGAATGGGAAT





CGACAATGATACGGAGTTGTCCAAGCAGATTTTCCGCGTAGACAAGAACTTTTGT





CTTCGACCCATGCTCGCTCCGAACCTCTACAATTACTTGAGAAAGTTGGACAGAG





CGCTCCCGGACCCGATCAAGATATTTGAGATCGGTCCTTGTTATAGAAAGGAGAG





TGATGGAAAAGAACACCTCGAAGAGTTCACGATGCTGAACTTCTGCCAAATGGG





TTCTGGCTGCACACGGGAGAATCTCGAAAGCATCATTACAGATTTCCTTAACCAT





CTGGGGATAGACTTTAAAATAGTGGGTGACAGCTGTATGGTATACGGAGATACC





TTGGACGTAATGCACGGGGATCTTGAGCTTTCCTCCGCCGTGGTTGGACCTATAC





CGTTGGACCGGGAGTGGGGAATCGACAAACCGTGGATAGGCGCCGGTTTCGGCC





TTGAAAGACTCCTCAAAGTCAAGCATGATTTCAAAAACATAAAACGGGCTGCTC





GCTCCGAATCTTATTACAACGGTATAAGTACGAACCTGTGATAATAGCTTAAGGG





TTCGATCCCTACtGGTTAGTAATGAGTTTA





tRNAs


Amber suppression:


(SEQ ID NO: 5)


ggaaacctgatcatgtagatcgaatggactctaaatccgttcagccgggttagattcccggggtttccgcca





Amber suppression (2):


(SEQ ID NO: 6)


ggggggtggatcgaatagatcacacggactctaaattcgtgcaggcgggtgaaactcccgtactccccgcca





Ochre suppression


(SEQ ID NO: 7)


ggaaacctgatcatgtagatcgaatggactttaaatccgttcagccgggttagattcccggggtttccgcca 





Opal suppression:


(SEQ ID NO: 8)


ggaaacctgatcatgtagatcgaatggacttcaaatccgttcagccgggttagattcccggggtttccgcca 





Synthetase:


(SEQ ID NO: 9)


ATGGATAAAAAACCATTAGATGTTTTAATATCTGCGACCGGGCTCTGGATGTCCA





GGACTGGCACGCTCCACAAAATCAAGCACCATGAGGTCTCAAGAAGTAAAATAT





ACATTGAAATGGCGTGTGGAGACCATCTTGTTGTGAATAATTCCAGGAGTTGTAG





AACAGCCAGAGCATTCAGACATCATAAGTACAGAAAAACCTGCAAACGATGTAG





GGTTTCGGACGAGGATATCAATAATTTTCTCACAAGATCAACCGAAAGCAAAAA





CAGTGTGAAAGTTAGGGTAGTTTCTGCTCCAAAGGTCAAAAAAGCTATGCCGAA





ATCAGTTTCAAGGGCTCCGAAGCCTCTGGAAAATTCTGTTTCTGCAAAGGCATCA





ACGAACACATCCAGATCTGTACCTTCGCCTGCAAAATCAACTCCAAATTCGTCTG





TTCCCGCATCGGCTCCTGCTCCTTCACTTACAAGAAGCCAGCTTGATAGGGTTGA





GGCTCTCTTAAGTCCAGAGGATAAAATTTCTCTAAATATGGCAAAGCCTTTCAGG





GAACTTGAGCCTGAACTTGTGACAAGAAGAAAAAACGATTTTCAGCGGCTCTAT





ACCAATGATAGAGAAGACTACCTCGGTAAACTCGAACGTGATATTACGAAATTTT





TCGTAGACCGGGGTTTTCTGGAGATAAAGTCTCCTATCCTTATTCCGGCGGAATA





CGTGGAGAGAATGGGTATTAATAATGATACTGAACTTTCAAAACAGATCTTCCGG





GTGGATAAAAATCTCTGCTTGAGGCCAATGCTTGCCCCGACTCTTTACAACTATC





TGCGAAAACTCGATAGGATTTTACCAGGCCCAATAAAAATTTTCGAAGTCGGACC





TTGTTACCGGAAAGAGTCTGACGGCAAAGAGCACCTGGAAGAATTTACTATGGT





GAACTTCTGTCAGATGGGTTCGGGATGTACTCGGGAAAATCTTGAAGCTCTCATC





AAAGAGTTTCTGGACTATCTGGAAATCGACTTCGAAATCGTAGGAGATTCCTGTA





TGGTCTTTGGGGATACTCTTGATATAATGCACGGGGACCTGGAGCTTTCTTCGGC





AGTCGTCGGGCCAGTTTCTCTTGATAGAGAATGGGGTATTGACAAACCATGGATA





GGTGCAGGTTTTGGTCTTGAACGCTTGCTCAAGGTTATGCACGGCTTTAAAAACA





TTAAGAGGGCATCAAGGTCCGAATCTTACTATAATGGGATTTCAACCAATCTGTA





A





EGFP:


(SEQ ID NO: 10)


atggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaagttca





gcgtgtccggcgagggcgagggcgatgccacctacggcaagctgaccctgaagttcatctgcaccaccggcaagctgcccgtgcc





ctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgctaccccgaccacatgaagcagcacgacttcttcaa





gtccgccatgcccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactacaagacccgcgccgaggtgaagt





tcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacggcaacatcctggggcacaagctgga





gtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaagatccgccacaacat





cgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgcccgacaacca





ctacctgagcacccagtccgccctgagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgccgccg





ggatcactctcggcatggacgagctgtacaagtaa





EGFP Amber:


(SEQ ID NO: 11)


Atggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaagttca





gcgtgtccggcgagggcgagggcgatgccacctagggcaagctgaccctgaagttcatctgcaccaccggcaagctgcccgtgcc





ctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgctaccccgaccacatgaagcagcacgacttcttcaa





gtccgccatgcccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactacaagacccgcgccgaggtgaagt





tcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacggcaacatcctggggcacaagctgga





gtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaagatccgccacaacat





cgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgcccgacaacca





ctacctgagcacccagtccgccctgagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgccgccg





ggatcactctcggcatggacgagctgtacaagtaatga





EGFP Ochre:


(SEQ ID NO: 12)


atggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaagttca





gcgtgtccggcgagggcgagggcgatgccacctaaggcaagctgaccctgaagttcatctgcaccaccggcaagctgcccgtgcc





ctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgctaccccgaccacatgaagcagcacgacttcttcaa





gtccgccatgcccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactacaagacccgcgccgaggtgaagt





tcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacggcaacatcctggggcacaagctgga





gtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaagatccgccacaacat





cgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgcccgacaacca





ctacctgagcacccagtccgccctgagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgccgccg





ggatcactctcggcatggacgagctgtacaagtaatga





EGFP Opal:


(SEQ ID NO: 13)


Atggtgagcaagggcgaggagctgttcaccggggtggtgcccatcctggtcgagctggacggcgacgtaaacggccacaagttca





gcgtgtccggcgagggcgagggcgatgccacctgaggcaagctgaccctgaagttcatctgcaccaccggcaagctgcccgtgcc





ctggcccaccctcgtgaccaccctgacctacggcgtgcagtgcttcagccgctaccccgaccacatgaagcagcacgacttcttcaa





gtccgccatgcccgaaggctacgtccaggagcgcaccatcttcttcaaggacgacggcaactacaagacccgcgccgaggtgaagt





tcgagggcgacaccctggtgaaccgcatcgagctgaagggcatcgacttcaaggaggacggcaacatcctggggcacaagctgga





gtacaactacaacagccacaacgtctatatcatggccgacaagcagaagaacggcatcaaggtgaacttcaagatccgccacaacat





cgaggacggcagcgtgcagctcgccgaccactaccagcagaacacccccatcggcgacggccccgtgctgctgcccgacaacca





ctacctgagcacccagtccgccctgagcaaagaccccaacgagaagcgcgatcacatggtcctgctggagttcgtgaccgccgccg





ggatcactctcggcatggacgagctgtacaagtaatga





MbPylRS


(SEQ ID NO: 14)


        10         20         30         40         50


MDKKPLDVLI SATGLWMSRT GTLHKIKHHE VSRSKIYIEM ACGDHLVVNN





        60         70         80         90        100


SRSCRTARAF RHHKYRKTCK RCRVSDEDIN NFLTRSTESK NSVKVRVVSA





       110        120        130        140        150


PKVKKAMPKS VSRAPKPLEN SVSAKASTNT SRSVPSPAKS TPNSSVPASA





       160        170        180        190        200


PAPSLTRSQL DRVEALLSPE DKISLNMAKP FRELEPELVT RRKNDFQRLY





       210        220        230        240        250


TNDREDYLGK LERDITKFFV DRGFLEIKSP ILIPAEYVER MGINNDTELS





       260        270        280        290        300


KQIFRVDKNL CLRPMLAPTL YNYLRKLDRI LPGPIKIFEV GPCYRKESDG





       310        320        330        340        350


KEHLEEFTMV NECQMGSGCT RENLEALIKE FLDYLEIDFE IVGDSCMVYG





       360        370        380        390        400


DTLDIMHGDL ELSSAVVGPV SLDREWGIDK PWIGAGFGLE RLLKVMHGFK





       410


NIKRASRSES YYNGISTNIL





MmPylRS (uniprot)


(SEQ ID NO: 15)


        10         20         30         40         50


MDKKPLNTLI SATGLWMSRT GTIHKIKHHE VSRSKIYIEM ACGDHLVVNN





        60         70         80         90        100


SRSSRTARAL RHHKYRKTCK RCRVSDEDLN KFLTKANEDQ TSVKVKVVSA





       110        120        130        140        150


PTRTKKAMPK SVARAPKPLE NTEAAQAQPS GSKFSPAIPV STQESVSVPA





       160        170        180        190        200


SVSTSISSIS TGATASALVK GNTNPITSMS APVQASAPAL TKSQTDRLEV





       210        220        230        240        250


LLNPKDEISL NSGKPFRELE SELLSRRKKD LQQIYAEERE NYLGKLEREI





       260        270        280        290        300


TRFFVDRGFL EIKSPILIPL EYIERMGIDN DTELSKQIFR VDKNFCLRPM





       310        320        330        340        350


LAPNLYNYLR KLDRALPDPI KIFEIGPCYR KESDGKEHLE EFTMLNFCQM





       360        370        380        390        400


GSGCTRENLE SIITDFLNHL GIDFKIVGDS CMVYGDTLDV MHGDLELSSA





       410        420        430        440        450


VVGPIPLDRE WGIDKPWIGA GFGLERLLKV KHDFKNIKRA ARSESYYNGI





STNL





PylT* (Amber)


(SEQ ID NO: 16)


ggaaacctgatcatgtagatcgaaCggactCTAaatccgttcagccgggttagattcccggggtttccgcca





TTTTTT





PylT* (Ochre)


(SEQ ID NO: 17)


ggaaacctgatcatgtagatcgaaCggactTTAaatccgttcagccgggttagattcccggggtttccgcca





TTTTTT





PylT* (Opal)


(SEQ ID NO: 18)


ggaaacctgatcatgtagatcgaaCggactTCAaatccgttcagccgggttagattcccggggtttccgcca





TTTTTT





Mouse U6 primers


(SEQ ID NO: 19)


tcccggggtttccgccaTTTTTTGGTACTGAGtCGCCCaGTCTCAGAT 





(SEQ ID NO: 20)


CAAACAAGGCTTTTCTCCAAGGGATAT





tRNA (U25C) Amber F:


(SEQ ID NO: 21)



CCTTGGAGAAAAGCCTTGTTTGggaaacctgatcatgtagatcgaacggactCTAaatccgttcagccggg






Common reverse:


PylT


(SEQ ID NO: 22)


ggaaacctgatcatgtagatcgaatggactCTAaatccgttcagccgggttagattcccggggtttccgcca





PylT* (U25C)


(SEQ ID NO: 23)


ggaaacctgatcatgtagatcgaaCggactCTAaatccgttcagccgggttagattcccggggtttccgcca





1. Arg tRNA (opal) (E-Cadherin paper)


(SEQ ID NO: 24)


GGCCGCGTGGCCTAATGGATAAGGCGTCTGACTcustom character GATCAGAAGATTGCAG





GTTCGAGTCCTGCCGCGGTCG





2. Arg tRNA (opal) (Xeroderma paper)


(SEQ ID NO: 25)


GACCACGTGGCCTAATGGATAAGGCGTCTGACTcustom character GATCAGAAGATTGAGG





GTTCGAATCCCTTCGTGGTTA





3. Serine tRNA (amber)


(SEQ ID NO: 26)


GTAGTCGTGGCCGAGTGGTTAAGGCGATGGACTcustom character AATCCATTGGGGTTTCC





CCGCGCAGGTTCGAATCCTGCCGACTACG





4. Leucine tRNA (amber)


(SEQ ID NO: 27)


GTCAGGATGGCCGAGTGGTCTAAGGCGCCAGACTcustom character GTTCTGGTCTCCAATG





GAGGCGTGGGTTCGAATCCCACTTCTGACA 





Forward:


(SEQ ID NO: 28)



TTGTGGAAAGGACGAAACACC






Reverse:


(SEQ ID NO: 29)



ACAAGAAAGCTGGGTCTAGGCTAGCAAAAAA






tRNA_Leu_Am_F (overlaps with vector,


bold; anti-codon sequences, bold underline):


(SEQ ID NO: 30)


TTGTGGAAAGGACGAAACACCGGTCAGGATGGCCGAGTGGTCTAAGGCGCCAG





ACTcustom character GTTCTGGTCTCCAATGG





tRNA_Leu_Oc_F (overlaps with vector,


bold; anti-codon sequences, bold underline):


(SEQ ID NO: 31)



TTGTGGAAAGGACGAAACACCGGTCAGGATGGCCGAGTGGTCTAAGGCGCCAG






ACTcustom character GTTCTGGTCTCCAATGG 





tRNA_Leu_Op_F (overlaps with vector, 


bold; anti-codon sequences, bold underline):


(SEQ ID NO: 32)



TTGTGGAAAGGACGAAACACCGGTCAGGATGGCCGAGTGGTCTAAGGCGCCAG






ACTcustom character GTTCTGGTCTCCAATGG 





tRNA_Leu_R (overlaps with vector, 


bold; anti-codon sequences, bold underline):


(SEQ ID NO: 33)



ACAAGAAAGCTGGGTCTAGGCTAGCAAAAAATGTCAGAAGTGGGATTCGAAC






CCACGCCTCCATTGGAGACCAGAAC 





tRNA_Ser_Am_F (overlaps with vector, 


bold; anti-codon sequences, bold underline):


(SEQ ID NO: 34)



TTGTGGAAAGGACGAAACACCGGTAGTCGTGGCCGAGTGGTTAAGGCGATGGA






CTcustom character AATCCATTGGGGTTTCC 





tRNA_Ser_Oc_F (overlaps with vector, 


bold; anti-codon sequences, bold underline):


(SEQ ID NO: 35)



TTGTGGAAAGGACGAAACACCGGTAGTCGTGGCCGAGTGGTTAAGGCGATGGA






CTcustom character AATCCATTGGGGTTTCC 





tRNA_Ser_Op_(overlaps with vector, 


bold; anti-codon sequences, bold underline)F:


(SEQ ID NO: 36)



TTGTGGAAAGGACGAAACACCGGTAGTCGTGGCCGAGTGGTTAAGGCGATGGA






CTcustom character AATCCATTGGGGTTTCC 





tRNA_Ser_R (overlaps with vector, 


bold; anti-codon sequences, bold underline):


(SEQ ID NO: 37)



ACAAGAAAGCTGGGTCTAGGCTAGCAAAAAACGTAGTCGGCAGGATTCGAAC






CTGCGCGGGGAAACCCCAATGGATT 





tRNA_Arg_Am_F (overlaps with vector, 


bold; anti-codon sequences, bold underline):


(SEQ ID NO: 38)



TTGTGGAAAGGACGAAACACCGGACCACGTGGCCTAATGGATAAGGCGTCTGA






CTcustom character GATCAGAAGATTGAGGGTT 





tRNA_Arg_Oc_F (overlaps with vector, 


bold; anti-codon sequences, bold underline):


(SEQ ID NO: 39)



TTGTGGAAAGGACGAAACACCGGACCACGTGGCCTAATGGATAAGGCGTCTGA






CTcustom character GATCAGAAGATTGAGGGTT 





tRNA_Arg_Op_F (overlaps with vector, 


bold; anti-codon sequences, bold underline):


(SEQ ID NO: 40)



TTGTGGAAAGGACGAAACACCGGACCACGTGGCCTAATGGATAAGGCGTCTGA






CTcustom character GATCAGAAGATTGAGGGTT 





tRNA_Arg_R (overlaps with vector, 


bold; anti-codon sequences, bold underline):


(SEQ ID NO: 41)



ACAAGAAAGCTGGGTCTAGGCTAGCAAAAAATAACCACGAAGGGATTCGAAC






CCTCAATCTTCTGATC 





mU6_tRNA_ser_oc:


(SEQ ID NO: 42)


GTACTGAGtCGCCCaGTCTCAGATAGATCCGACGCCGCCATCTCTAGGCCCGCGCC





GGCCCCCTCGCACAGACTTGTGGGAGAAGCTCGGCTACTCCCCTGCCCCGGTTAA





TTTGCATATAATATTTCCTAGTAACTATAGAGGCTTAATGTGCGATAAAAGACAG





ATAATCTGTTCTTTTTAATACTAGCTACATTTTACATGATAGGCTTGGATTTCTAT





AAGAGATACAAATACTAAATTATTATTTTAAAAAACAGCACAAAAGGAAACTCA





CCCTAACTGTAAAGTAATTGTGTGTTTTGAGACTATAAATATCCCTTGGAGAAAA





GCCTTGTTTGGTAGTCGTGGCCGAGTGGTTAAGGCGATGGACTTTAAATCCATTG





GGGTTTCCCCGCGCAGGTTCGAATCCTGCCGACTACGTTTTTT





mU6_tRNA_ser_oc_Nhe1_insert_F:


(SEQ ID NO: 43)


AATCCTGCCGACTACGTTTTTTGTACTGAGtCGCCCAGTCT





adRNA (premature stop codon target,


bold; edited bases, bold underline):


Sequential edits:


(SEQ ID NO: 44)


TTTGAAAGAGCAATAAAAT





(SEQ ID NO: 45)


CTTTGAAAGAGCAATAGAA 





Dual edits:


(SEQ ID NO: 46)


TTTGAAAGAGCAATAAAAT 





radRNA (premature stop codon target, 


bold; edited bases, bold underline):


Sequential edits:


(SEQ ID NO: 47)


AtaaAATGGCTTCAACTAT 





(SEQ ID NO: 48)


AAtagAATGGCTTCAACTA 





Dual edits:


(SEQ ID NO: 49)


AAtaaAATGGCTTCAACTA 





OTC target (edited bases, bold):


(SEQ ID NO: 50)


TCACAGACACCGCTCAGTTTGT 





Optimization of the length of adRNA and distance of the edit from the


ADAR2 recruiting domain (Length of adRNA-distance of edit from ADAR2


recruiting domain):


16-5: 


(SEQ ID NO: 51)


atgccaccTGGggcaa 





16-6: 


(SEQ ID NO: 52)


tgccaccTGGggcaag 





16-7: 


(SEQ ID NO: 53)


gccaccTGGggcaagc 





18-6: 


(SEQ ID NO: 54)


gatgccaccTGGggcaag 





20-6: 


(SEQ ID NO: 55)


gcgatgccaccTGGggcaag 





ADAR2 recruiting region v1:


(SEQ ID NO: 56)


GGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCA





CCT 





ADAR2 recruiting region v2:


(SEQ ID NO: 57)


GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCAC





Hairpin (3′) (FIG. 8): 


(SEQ ID NO: 58)


GGGCCCTCTTCAGGGCCCTCTAGA 





Hairpin (3′) (FIG. 10): 


(SEQ ID NO: 59)


atcgccctgaaaag 





Toe hold (5′): 


(SEQ ID NO: 60)


gccaccTGGgg 





List of suppressor tRNA sequences:








Suppressor



tRNAs
Sequence (5′ to 3′)





Serine
GTAGTCGTGGCCGAGTGGTTAAGGCGATGGACTNNNAATCCATTGG



GGTTTCCCCGCGCAGGTTCGAATCCTGCCGACTACG (SEQ ID NO: 61)





Leucine
GTCAGGATGGCCGAGTGGTCTAAGGCGCCAGACTNNNGTTCTGGTC



TCCAATGGAGGCGTGGGTTCGAATCCCACTTCTGACA (SEQ ID NO: 62)





Arginine
GACCACGTGGCCTAATGGATAAGGCGTCTGACTNNNGATCAGAAG



ATTGAGGGTTCGAATCCCTTCGTGGTTA (SEQ ID NO: 63)











NNN-anticodon



In endogenous tRNA, the tRNA is modified to recognize the codon comprising the point


mutation by including the complementary sequence at the NNN position noted herein above.


As clarified in more detail below, the NNN sequences in amber, ochre, and opal tRNA are as


follows: Amber: NNN = CTA; Ochre: NNN = TCA; Opal: NNN = TTA.


List of primers for next generation sequencing (NGS) analyses.








Name
Sequence (5′ to 3′)





NGS_DMD_F1
GTGTTACTGAATATGAAATAATGGAGGA (SEQ ID NO: 64)





NGS_DMD_R1
ATTTCTGGCATATTTCTGAAGGTG (SEQ ID NO: 65)





NGS_DMD_F2
CTCTCTGTACCTTATCTTAGTGTTACTGA (SEQ ID NO: 66)





NGS_DMD_R2
CTCTTCAAATTCTGACAGATATTTCTGGC (SEQ ID NO: 67)





NGS_OTC_F
ACCCTTCCTTTCTTACCACACA (SEQ ID NO: 68)





NGS_OTC_R
CAGGGTGTCCAGATCTGATTGTT (SEQ ID NO: 69)





NGS_OTC_R2
CTTCTCTTTTAAACTAACCCATCAGAGTT (SEQ ID NO: 70)










List of adRNA antisense sequences and corresponding ADAR2 recruiting


scaffold used for in vivo RNA editing studies. In some embodiments, the recruiting scaffold


v2 - disclosed in preceding paragraph, is used with these sequences.











Name
adRNA antisense sequence (3′ to 5′)





OTC

TGTCTGTGGCGAG

C

CAAACA (SEQ ID NO: 71)






DMD

ACTTTCTCGTTA

CC

TTACCG (SEQ ID NO: 72)












MCP-Linker-ADAR1-NLS (optional sequence in brackets)



(SEQ ID NO: 73)



MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA







QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS







AIAANSGIYGGSGSGAGSGS
PAGGGAPGSGGGS
KAERMGFTEVTPVTGASLRRTML







LLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSE







DMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAK







DSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFEN







PKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGA







LLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRV







SIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFK







KLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLKDMGYGNWISKPQEEKNF







YLCPVGSGSGSGPKKRKV[AA]* 







MCP-Linker-ADAR2 (optional sequence in brackets)



(SEQ ID NO: 74)


MGPKKKRKVAAGSGSGSMASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSN






SRSQAYKVTCSVRQSSAQKRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNME







LTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY
GGSGGSGGS
MLHLDQTP







SRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTD







VKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDD






QKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEEPADRHPNRKARGQ






LRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVE







PIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNF







SVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITK







PNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLT[P]*







N22p-Linker-ADAR1-NLS (optional sequence in brackets)



(SEQ ID NO: 75)



MGNARTRRRERRAEKQAQWKAANGGGGTSGSGSGS
PAGGGAPGSGGGS
KAER







MGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTLTNSF







QPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRR







GFIRFLYSELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKS







CSDRAMESTESRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRT







MSCSDKILRWNVLGLQGALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSA







FEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVD







GPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLK







DMGYGNWISKPQEEKNFYLCPVGSGSGSGPKKRKV[AA]* 






Nuclear Localization Sequence-Linker-N22p-Linker-ADAR2 (optional


sequence in brackets)


(SEQ ID NO: 76)


[MG]PKKKRKVAAGSGSGSMGNARTRRRERRAEKQAQWKAANGGGGTSGSGSG






S
PAGGGAPGSGGGS
MLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTD







NFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAE







IISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDAR







IFSPHEPILEEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTM







SCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLY







TLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHA







LYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGA







WVEKPTEQDQFSLT[P]*







MCP-Linker-ADAR1 (E1008Q)-NLS (optional sequence in brackets)



(SEQ ID NO: 77)



MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA







QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS







AIAANSGIYGGSGSGAGSGS
PAGGGAPGSGGGSKAERMGFTEVTPVTGASLRRTML







LLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSE







DMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAK







DSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFEN







PKQGKLRTKVENGQGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGA







LLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRV







SIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFK







KLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLKDMGYGNWISKPQEEKNF







YLCPVGSGSGSGPKKRKV[AA]*






Nuclear Localization Sequence-Linker-MCP-Linker-ADAR2 (E488Q)


(optional sequence in brackets)


(SEQ ID NO: 78)


[MG]PKKKRKVAAGSGSGSMASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISS






NSRSQAYKVTCSVRQSSAQKRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNM







ELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY
GGSGGSGGS
MLHLDQT







PSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGT







DVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKD







DQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEEPADRHPNRKARG







QLRTKIESGQGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIF







VEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAP







NFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKI







TKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLT[P]*







N22p-Linker-ADAR1 (E1008Q) (optional sequence in brackets)



(SEQ ID NO: 79)



MGNARTRRRERRAEKQAQWKAANGGGGTSGSGSGS
PAGGGAPGSGGGS
KAER







MGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTLTNSF







QPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRR







GFIRFLYSELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKS







CSDRAMESTESRHYPVFENPKQGKLRTKVENGQGTIPVESSDIVPTWDGIRLGERLRT







MSCSDKILRWNVLGLQGALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSA







FEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVD







GPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLK







DMGYGNWISKPQEEKNFYLCPVGSGSGSGPKKRKV[AA]*






Nuclear Localization Sequence-Linker-N22p-Linker-ADAR2 (E488Q)


(SEQ ID NO: 80)


[MG]PKKKRKVAAGSGSGSMGNARTRRRERRAEKQAQWKAANGGGGTSGSGSG






S
PAGGGAPGSGGGS
MLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTD







NFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAE







IISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDAR







IFSPHEPILEEPADRHPNRKARGQLRTKIESGQGTIPVRSNASIQTWDGVLQGERLLTM







SCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLY







TLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHA







LYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGA







WVEKPTEQDQFSLT[P]*






Nuclear Localization Sequence-Linker-MCP-Linker-hAPOPEC1


(SEQ ID NO: 81)


[MG]PKKKRKVAAGSGSGSMASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISS






NSRSQAYKVTCSVRQSSAQKRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNM







ELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY
GGSGGSGGS
MTSEKGP







STGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEV







NFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWH







MDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMM







LYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSV







AWR*






Nuclear Localization Sequence-Linker-MCP-Linker-rAPOBEC1


(SEQ ID NO: 82)


[MG]PKKKRKVAAGSGSGSMASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISS






NSRSQAYKVTCSVRQSSAQKRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNM







ELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY
GGSGGSGGS
MSSETGP







VAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTNKHVEV







NFIEKFTTERYFCPNTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHAD







PRNRQGLRDLISSGVTIQIMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLE







LYCIILGLPPCLNILRRKQPQLTFFTIALQSCHYQRLPPHILWATGLK*







dsRBD-Linker-rAPOBEC1



(SEQ ID NO: 83)



MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRP







LEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAP







LFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLS







VNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPAS







LAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDG







QFFEGSGRNKKLAKARAAQSALAAIFN
GGSGGSGGS
MSSETGPVAVDPTLRRRIEP







HEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTNKHVEVNFIEKFTTERYFCP







NTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHADPRNRQGLRDLISS







GVTIQIMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILGLPPCLNI







LRRKQPQLTFFTIALQSCHYQRLPPHILWATGLK*







dsRBD-Linker-hAPOBEC1



(SEQ ID NO: 84)



MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPGRKRP







LEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQTGPVHAP







LFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLS







VNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSFSSSGDLSLSASPVPAS







LAQPPLPVLPPFPPPSGKINPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDG







QFFEGSGRNKKLAKARAAQSALAAIFN
GGSGGSGGS
MTSEKGPSTGDPTLRRRIEP







WEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFH







PSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDL







VNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLP







PCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR*







MCP-Linker-ADAR1-NES



(SEQ ID NO: 85)



MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA







QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS







AIAANSGIYGGSGSGAGSGS
PAGGGAPGSGGGS
KAERMGFTEVTPVTGASLRRTML







LLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTLTNSFQPSLLGRKILAAIIMKKDSE







DMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAK







DSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFEN







PKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGA







LLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRV







SIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVDGPRNELSRVSKKNIFLLFK







KLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLKDMGYGNWISKPQEEKNF







YLCPVGSGSGSLPPLERLTL* 







MCP-Linker-ADAR2-NLS



(SEQ ID NO: 86)



MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA







QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS







AIAANSGIYGGSGSGAGSGS
PAGGGAPGSGGGS
QLHLPQVLADAVSRLVLGKFGDL







TDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCH







AEIISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGD







ARIFSPHEPILEEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLL







TMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPP







LYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCK







HALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLG







AWVEKPTEQDQFSLTGSGSGSPKKKRKV* 






MCP-Linker-ADAR2-NES


(SEQ ID NO: 87)



MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA







QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS







AIAANSGIYGGSGSGAGSGS
PAGGGAPGSGGGS
QLHLPQVLADAVSRLVLGKFGDL







TDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCH







AEIISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGD







ARIFSPHEPILEEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLL







TMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPP







LYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCK







HALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLG







AWVEKPTEQDQFSLTGSGSGSLPPLERLTL* 







MCP-Linker-rAPOBEC1-NLS



(SEQ ID NO: 88)



MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA







QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS







AIAANSGIYGGSGSGAGSGS
PAGGGAPGSGGGSSGSETPGTSESATPES
MSSETGPVA







VDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTNKHVEVNFI







EKFT







TERYFCPNTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHADPRNRQG







LRDLISSGVTIQIMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILG







LPPCLNILRRKQPQLTFFTIALQSCHYQRLPPHILWATGLKGSGSGSPKKKRKV*







MCP-Linker-rAPOBEC1-NES



(SEQ ID NO: 89)



MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA







QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS







AIAANSGIYGGSGSGAGSGS
PAGGGAPGSGGGSSGSETPGTSESATPES
MSSETGPVA







VDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSIWRHTSQNTNKHVEVNFI







EKFTTERYFCPNTRCSITWFLSWSPCGECSRAITEFLSRYPHVTLFIYIARLYHHADPR







NRQGLRDLISSGVTIQIMTEQESGYCWRNFVNYSPSNEAHWPRYPHLWVRLYVLEL







YCIILGLPPCLNILRRKQPQLTFFTIALQSCHYQRLPPHILWATGLKGSGSGSLPPLERL






TL* 






MCP-Linker-hAPOBEC1-NLS



(SEQ ID NO: 90)



MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA







QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS







AIAANSGIYGGSGSGAGSGS
PAGGGAPGSGGGSSGSETPGTSESATPES
MTSEKGPST







GDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNF







IKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMD







QQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLY







ALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWRGS






GSGSPKKKRKV* 






MCP-Linker-hAPOBEC1-NES



(SEQ ID NO: 91)



MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSA







QNRKYTIKVEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPS







AIAANSGIYGGSGSGAGSGS
PAGGGAPGSGGGSSGSETPGTSESATPES
MTSEKGPST







GDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIWRSSGKNTTNHVEVNF







IKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLVIYVARLFWHMD







QQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWMMLY







ALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWRGS







GSGSLPPLERLTL*






Alternate spacer (can be used in place of GGSGGSGGS


(SEQ ID NO: 92)):


(SEQ ID NO: 93)



SGSETPGTSESATPES 






3XNLS-4x1N-cdADAR2


(SEQ ID NO: 94)



MPKKKRKVDPKKKRKVDPKKKRKVGSYPYDVPDYAGSNARTRRRERRAEKQA







QWKAANGGGGSGGGGSGGGGSNARTRRRERRAEKQAQWKAANGGGGSGGG







GSGGGGSNARTRRRERRAEKQAQWKAANGGGGSGGGGSGGGGSNARTRRRE







RRAEKQAQWKAAN
LHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGDLTD







NFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAE







IISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDAR







IFSPHEPILEEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTM







SCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLY







TLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHA







LYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGA







WVEKPTEQDQFSLTP






N22p-hAPOBEC1


(SEQ ID NO: 95)



MPKKKRKVDGSGNARTRRRERRAEKQAQWKAANGGGGTSGSGSGSPAGGGA







PGSGGGS
MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKI







WRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHP






GVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGD






EAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPH







ILLATGLIHPSVAWR






3XNLS-4x1N-hAPOBEC1


(SEQ ID NO: 96)



MPKKKRKVDPKKKRKVDPKKKRKVGSYPYDVPDYAGSNARTRRRERRAEKQA







QWKAANGGGGSGGGGSGGGGSNARTRRRERRAEKQAQWKAANGGGGSGGG







GSGGGGSNARTRRRERRAEKQAQWKAANGGGGSGGGGSGGGGSNARTRRRE







RRAEKQAQWKAAN
MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIK







WGMSRKIWRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAI







REFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNF







VNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNC







HYQTIPPHILLATGLIHPSVAWR






C-terminal ADAR2 (residues 1-138 deleted)


(SEQ ID NO: 97)


MLRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGS





NGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYDFLS





ESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFNLHLDQTPSRQPI





PSEGLQLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKDA





KVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYLNNKDDQKRS





IFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILEEPADRHPNRKARGQLRTKI





ESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFS





SIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNW





TVGDSAIEVINATTGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVY





HESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLTP* 





MS2-RNA:


Single:


(SEQ ID NO: 98)


NNNNNNNNNNNNNNNNNNNNggccAACATGAGGATCACCCATGTCTGCAGggcc





Dual:


(SEQ ID NO: 99)


aACATGAGGATCACCCATGTcNNNNNNNNNNNNNNNNNNNNaACATGAGGATCA





CCCATGTc 





BoxB RNA:


Single:


(SEQ ID NO: 100)


NNNNNNNNNNNNNNNNNNNNgggccctgaagaagggccc 





Dual:


(SEQ ID NO: 101)


ggGCCCTGAAGAAGGGCccNNNNNNNNNNNNNNNNNNNNggGCCCTGAAGAAGG





GCcc 





PP7-RNA:


(SEQ ID NO: 102)


NNNNNNNNNNNNNNNNNNNNccggagcagacgatatggcgtcgctccgg 





Dual Hairpin RNA:


(SEQ ID NO: 103)


TGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACNNNNNNNNNN





NNNNNNNNNNGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCA





C 





A-U to G-C substitutions in adRNA


v1:


(SEQ ID NO: 104)


GGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACCTcustom character





v2:


(SEQ ID NO: 105)


GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACcustom character





v3:


(SEQ ID NO: 106)


GTGGAAcustom character AGcustom character Acustom character AACAATATGCTAAATGTTGTTcustom character Tcustom character GTcustom character TCCCACcustom charactercustom character





v4:


(SEQ ID NO: 107)


GGGTGGAAcustom character AGcustom character Acustom character AACAATATGCTAAATGTTGTTcustom character Tcustom character GTcustom character TCCCACCTcustom charactercustom character





v5:


(SEQ ID NO: 108)


GGTGAAcustom character AGcustom character Acustom character AACAATATGCTAAATGTTGTTcustom character Tcustom character GTcustom character TCCACCcustom charactercustom character





v6:


(SEQ ID NO: 109)


GGTGAAcustom character AGcustom character Acustom character AACAATATGCTAAATGTTGTTcustom character Tcustom character GTcustom character TCCACCcustom charactercustom character





v7:


(SEQ ID NO: 110)


GTGGAAcustom character AGcustom character Acustom character AACAATAcustom character GCTAAAcustom character GTTGTTcustom character Tcustom character GTcustom character TCCCACcustom charactercustom character





v8:


(SEQ ID NO: 111)


GGGTGGAAcustom character AGcustom character Acustom character AACAATAcustom character GCTAAAcustom character GTTGTTcustom character Tcustom character GTcustom character TCCCACCTcustom charactercustom character





v9:


(SEQ ID NO: 112)


GGTGAAcustom character AGcustom character Acustom character AACAATAcustom character GCTAAAcustom character GTTGTTcustom character Tcustom character GTcustom character TCCACCcustom charactercustom character





v10:


(SEQ ID NO: 113)


GGTGAAcustom character AGcustom character Acustom character AACAATAcustom character GCTAAAcustom character GTTGTTcustom character Tcustom character GTcustom character TCCACCcustom charactercustom character





v11:


(SEQ ID NO: 114)


GGTGTCGAGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCTCGACACCcustom character





v12:


(SEQ ID NO: 115)


GGTGTCGAGAAcustom character AGcustom character Acustom character AACAATATGCTAAATGTTGTTcustom character Tcustom character GTcustom character TCCTCGACACCcustom character





v13:


(SEQ ID NO: 116)


GGTGTCGAGAAcustom character AGcustom character Acustom character AACAATAcustom character GCTAAAcustom character GTTGTTcustom character Tcustom character GTcustom character TCCTCGACACCcustom character






dCas9Cj-NES-Linker-cdADAR2(E488Q)



(SEQ ID NO: 117)



MARILAFAIGISSIGWAFSENDELKDCGVRIFTKVENPKTGESLALPRRLARSAR







KRLARRKARLNHLKHLIANEFKLNYEDYQSFDESLAKAYKGSLISPYELRFRAL







NELLSKQDFARVILHIAKRRGYDDIKNSDDKEKGAILKAIKQNEEKLANYQSVG







EYLYKEYFQKFKENSKEFTNYRNKKESYERCIAQSFLKDELKLIFIREFGFSF







SKKFEEEVLSVAFYKRALKDFSHLVGNCSFFTDEKRAPKNSPLAFMFVALTRIIN







LLNNLKINTEGILYTKDDLNALLNEVLKNGTLTYKQTKKLLGLSDDYEFKGEKG







TYFIEFKKYKEFIKALGEHNLSQDDLNEIAKDITLIKDEIKLKKALAKYDLNQNQ







IDSLSKLEFKDHLNISFKALKLVTPLMLEGKKYDEACNELNLKVAINEDKKDFL







PAFNETYYKDEVTNPVVLRAIKEYRKVLNALLKKYGKVHKINIELAREVGKNHS







QRAKIEKEQNENYKAKKDAELECEKLGLKINSKNILKLRLFKEQKEFCAYSGEK







IKISDLQDEKMLEIDAIYPYSRSFDDSYMNKVLVFTKQNQEKLNQTPFEAFGNDS







AKWQKIEVLAKNLPTKKQKRILDKNYKDKEQKNFKDRNLNDTRYIARLVLNYT







KDYLDFLPLSDDENTKLNDTQKGSKVHVEAKSGMLTSALRHTWGFSAKDRNN







HLHHAIDAVHAYANNSIVKAFSDFKKEQESNSAELYAKKISELDYKNKRKFFEPF







SGFRQKVLDKIDEIFVSKPERKKPSGALHEETFRKEEEFYQSYGGKEGVLKALE







LGKIRKVNGKIVKINGDMFRVDIFKHKKTNKFYAVPIYTMDFALKVLPNKAVAR







SKKGEIKDWILMDENYEFCFSLYKDSLILIQTKDMQEPEFVYYNAFTSSTVSLIVS







KHDNKFETLSKNQKILFKNANEKEVIAKSIGIQNLKVFEKYIVSALGEVTKAEFR







QREDFKKSGLPPLERLTLGSGGGGSQLHLPQVLADAVSRLVLGKFGDLTDNFSSPH







ARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSL







LRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEP







ILEEPADRHPNRKARGQLRTKIESGQGTIPVRSNASIQTWDGVLQGERLLTMSCSDKI







ARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPL







LSGISNAEARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRW







MRVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAWVEKPT







EQDQFSLT






Single and dual ADAR2 recruiting domain:


Single:


(SEQ ID NO: 118)



GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACACAAACC






GAGCGGTGTCTGT 





Dual 1:


(SEQ ID NO: 119)



GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACCAAACCG






AGCGGTGTCTGTGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTAT






CCCAC 






Dual 2:


(SEQ ID NO: 120)



GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACTACAAAC







CGAGCGGTGTCTGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTAT







CCCAC 






Dual 3:


(SEQ ID NO: 121)



GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACTTTACAAA






CCGAGCGGTGTCGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATC






CCAC 






Dual 4:


(SEQ ID NO: 122)



GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACGTTTTACA






AACCGAGCGGTGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTAT






CCCAC 






Dual 5:


(SEQ ID NO: 123)



GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCACAAGTTTTA






CAAACCGAGCGGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTAT






CCCAC













BRIEF DESCRIPTION OF THE DRAWINGS


FIG. 1 is a schematic of the vector constructs developed for the delivery of the modified endogenous or orthogonal tRNA.



FIG. 2A-B show suppression efficiencies of the tRNA constructs: (FIG. 2A) Relative efficiencies of the suppressor tRNAs derived from arginine, serine and leucine towards the amber, ochre and opal stop codons; Representative images showing the restoration of GFP expression in the presence of the Ser tRNAAmber (FIG. 2B) Comparison of the suppression efficiencies of the single or dual pyrrolysyl tRNAs towards amber, ochre and opal stop codons in the presence of 2 mM UAA; Representative images showing the relative GFP restoration using single and dual pyrrolysyl tRNAAmber in the presence of 2 mM UAA.



FIG. 3 shows the GFP reporter results for dystrophin with various tRNA and amino acids.



FIG. 4 shows the results of the dystrophin restoration experiments performed in mdx mice.



FIG. 5 shows sequences used to generate the ADAR2 constructs (SEQ ID NOS 164-166, respectively, in order of appearance).



FIG. 6 shows non-limiting examples of RNA level point mutations to a codon that can be made by ADAR2.



FIG. 7 shows exemplary schematics of constructs that may be used in an ADAR2 based RNA editing system.



FIG. 8 shows the results of optimization of the length of adRNA and distance of the edit from the ADAR2 recruiting domain. The first number in the shorthand for each category on the Y-axis is the length of adRNA and the second number (following the dash) is the distance of edit from ADAR2 recruiting domain. 20-6 with ADAR2 recruiting region v2 gave us the best results.



FIG. 9 shows in vitro restoration of GFP expression using the editing systems described herein.



FIG. 10 shows the results of optimization of hairpins with mismatches (SEQ ID NOS 167-172, respectively, in order of appearance). The first number in the shorthand for each category on the Y-axis is the number of mismatches and the second number is the number of bases it is from the target. For example, 13 is 1 mismatch, 3 bases away from the target.



FIG. 11 shows the results of varying lengths of toe hold, guide RNA sequences with no mismatches to the target.



FIG. 12A-C show results of (FIG. 12A) immunostaining, (FIG. 12B) Western blot, and (FIG. 12C) in vitro OTC mRNA editing assays (SEQ ID NOS 173-174, respectively, in order of appearance).



FIG. 13 is a Western blot that shows the restoration of dystrophin expression using suppressor tRNA, in comparison with the Cas9 based approaches.



FIG. 14 shows normalized dystrophin mRNA levels.



FIG. 15 shows results of immunostaining.



FIG. 16A-D shows in vitro suppression and editing of stop codons in GFP reporter mRNA: (FIG. 16A) Activity of arginine, serine and leucine suppressor tRNAs targeting amber, ochre and opal stop codons (n=3 independent replicates). (FIG. 16B) Orthogonal tRNA/aaRS (MbPylRS) based suppression of amber, ochre and opal stop codons in the presence of one or two copies of the pyrrolysyl-tRNA delivered via an AAV vector and in the presence of 1 mM Nε-Boc-L-Lysine (n=3 independent replicates) (p-values 0.022, 0.002, 0.027 respectively). (FIG. 16C) ADAR2 based RNA editing efficiencies of amber and ochre stop codons, in one-step, two-steps, or in combination with suppressor tRNAs (n=3 independent replicates). (FIG. 16D) ADAR2 based RNA editing efficiencies of amber and ochre stop codons in the presence of one or two copies of the adRNA, delivered via an AAV vector (n=3 or 6 independent replicates) (p-values 0.0003, 0.0001, 0.0015 respectively).



FIG. 17A-E shows in vivo RNA targeting in mouse models of human disease: (FIG. 17A) Schematic of the DNA and RNA targeting approaches to restore dystrophin expression in mdx mice: (i) a dual gRNA-CRISPR based approach leading to in frame excision of exon 23; (ii) tRNA suppression of the ochre codon; and (iii) ADAR2 based editing of the ochre codon. (FIG. 17B) Immunofluorescence staining for dystrophin and nNOS in controls and treated samples (scale bar: 250 μm). (FIG. 17C) In vivo TAA→TGG/TAG/TGA RNA editing efficiencies in corresponding treated adult mdx mice (n=3 or 4 mice). (FIG. 17D) Schematic of the OTC locus in spfash mice which have a G→A point mutation at a donor splice site or missense in the last nucleotide of exon 4, and approach for correction of mutant OTC mRNA via ADAR2 mediated RNA editing (FIG. 17E) In vivo A→G RNA editing efficiencies in corresponding treated adult spfash mice (n=3 or 4 mice).



FIG. 18A-B show in vitro tRNA suppression evaluation and optimization: (FIG. 18A) Specificity of modified serine suppressor tRNAs for ochre and opal stop codons (n=3 independent replicates). (FIG. 18B) Ochre stop codon suppression efficiency utilizing three different aaRS: MbPylRS, MmPylRS and AcKRS, and two or four copies of the pyrroysyl-tRNA, or serine suppressor tRNA, all delivered using an AAV vector. MbPylRS, MmPylRS: 1 mM Nε-Boc-L-Lysine; AcKRS: 1 or 10 mM NE-Acetyl-L-Lysine (n=3 independent replicates).



FIG. 19A-C shows in vitro ADAR2 mediated site-specific RNA editing evaluation and optimization: (FIG. 19A) GFP expression is restored when adRNA/radRNA has two mismatches corresponding to the two adenosines in the ochre stop codon. Presence of a single mismatch results in the formation of an amber or opal stop codon (n=3 independent replicates) (SEQ ID NOS 175-179, respectively, in order of appearance). (FIG. 19B) Panel of adRNA designs used (SEQ ID NOS 180-181, respectively, in order of appearance). (FIG. 19C) Optimization of adRNA antisense region using adRNA design 1: length and distance from the ADAR2 recruiting region were systematically varied, and editing efficiency calculated as a ratio of Sanger peak heights G/(A+G) (n=3 independent replicates) (SEQ ID NOS 182-206, respectively, in order of appearance).



FIG. 20A-C shows in vivo targeting of dystrophin mRNA via suppressor tRNAs: (FIG. 20A) Progressively increasing restoration of dystrophin expression over time in mdx mice treated with AAV8-dual-serine-ochre-tRNA. (FIG. 20B) UAA inducible nNOS localization in mdx mice treated with AAV8-dual-pyrrolysine-ochre-tRNA-MbPylRS. (FIG. 20C) Western blot for dystrophin shows partial recovery of dystrophin expression in the mdx mice treated with a serine tRNA ochre, the pyrrolysyl-tRNA ochre and administered with the UAA, as well as in Cas9/gRNAs treated samples.



FIG. 21A-D show in vitro and in vivo editing of dystrophin and OTC mRNA: (FIG. 21A) Representative Sanger sequencing plot showing 12.7% editing of the ochre stop codon (TAA→TGG) in a fragment of the mdx dystrophin mRNA expressed in HEK 293T cells (quantified using NGS) (SEQ ID NOS 207-208, respectively, in order of appearance). (FIG. 21B) Representative example of in vivo RNA editing analyses of treated mdx mouse (quantified using NGS) (SEQ ID NOS 209-216, respectively, in order of appearance). (FIG. 21C) Representative Sanger sequencing plot showing 29.7% correction of the point mutation in a fragment of the spfash OTC mRNA expressed in HEK 293T cells (quantified using NGS) (SEQ ID NOS 217-218, respectively, in order of appearance). (FIG. 21D) Representative example of in vivo RNA editing analyses of treated spfash mouse (quantified using NGS) (SEQ ID NOS 219-226, respectively, in order of appearance).



FIG. 22A-B show in vitro editing efficiency of ADAR2-E488Q. ADAR2-E488Q enables higher efficiency than the ADAR2 in the in vitro editing of: (FIG. 22A) a fragment of spfash OTC mRNA expressed in HEK293T cells (n=3 independent replicates) (p-value 0.037), and (FIG. 22B) a fragment of mdx dystrophin mRNA expressed in HEK293T cells (n=3 independent replicates) (p-values 0.048, 0.012 respectively). Efficiency was calculated as a ratio of Sanger peak heights G/(A+G).



FIG. 23A-D show schematics of (FIG. 23A) MCP or N22 fusions with ADAR1 or ADAR2, (FIG. 23B) recruitment of APOBEC by adRNA, (FIG. 23C) a more general adRNA architecture, and (FIG. 23D) the structure of the v2 adRNA scaffold after folding (SEQ ID NO: 227).



FIG. 24A-B show schematics of optional embodiments in which (FIG. 24A) endogenous ADAR2 can be used in the methods disclosed herein in tissues with high endogenous ADAR2, e.g., brain, lung, and spleen and (FIG. 24B) ADAR1 and/or ADAR2 levels can be increased in tissues with low levels of endogenous ADAR1 and ADAR2. Clockwise from the left, (1) delivery of adRNA and ADAR2 would result in high levels of RNA editing, (2) delivery of adRNA alone is likely to bring about little or no editing due to the low levels of endogenous ADAR1 and ADAR2, (3) treatment of cells with IFNs will lead to an increase in the ADAR1 (p150) levels but is unlikely to bring about any editing of the RNA target in the absence of the adRNA; (4) treatment of cells with IFNs with the addition of adRNA will lead to elevated levels of ADAR1 (p150) and in the presence of adRNA, is likely to lead to high levels of target RNA editing, (5) treatment of cells with IFNs with the addition of adRNA and ADAR2 will lead to elevated levels of ADAR1 expression, and high levels of RNA editing.



FIG. 25 shows the rate of UAA to UAG conversion. The UAA is converted to UAG via ADAR2 based editing and addition of suppressor tRNA targeting the UAG stop codon led to partial restoration of GFP expression



FIG. 26 shows the results of in vivo RNA editing in the mdx mouse model of muscular dystrophy.



FIG. 27 shows the resulting edited sequences resulting from use of the promiscuous C-terminal ADAR2 (SEQ ID NOS 228-264, respectively, in order of appearance).



FIG. 28 shows editing efficiency of the stabilized scaffolds (SEQ ID NOS 104-113, respectively, in order of appearance).



FIG. 29 shows the fraction of edited mRNA with single versus dual ADAR2 recruiting domains and the corresponding sequences (SEQ ID NOS 118-123, respectively, in order of appearance).



FIG. 30 shows the fraction of edited mRNA with various MCP-ADAR scaffolds (SEQ ID NOS 265-269, respectively, in order of appearance).



FIG. 31 shows alternative splice variants of OTC and is taken from Hodges, P. E. & Rosenberg, L. E. The spfash mouse: a missense mutation in the ornithine transcarbamylase gene also causes aberrant mRNA splicing. Proc. Natl. Acad. Sci. U S. A. 86, 4142-4146 (1989) (SEQ ID NOS 270-275, respectively, in order of appearance).





DETAILED DESCRIPTION

Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art to which this invention belongs. All nucleotide sequences provided herein are presented in the 5′ to 3′ direction. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods, devices, and materials are now described. All technical and patent publications cited herein are incorporated herein by reference in their entirety. Nothing herein is to be construed as an admission that the invention is not entitled to antedate such disclosure by virtue of prior invention.


The practice of the present technology will employ, unless otherwise indicated, conventional techniques of tissue culture, immunology, molecular biology, microbiology, cell biology, and recombinant DNA, which are within the skill of the art. See, e.g., Sambrook and Russell eds. (2001) Molecular Cloning: A Laboratory Manual, 3rd edition; the series Ausubel et al. eds. (2007) Current Protocols in Molecular Biology; the series Methods in Enzymology (Academic Press, Inc., N.Y.); MacPherson et al. (1991) PCR 1: A Practical Approach (IRL Press at Oxford University Press); MacPherson et al. (1995) PCR 2: A Practical Approach; Harlow and Lane eds. (1999) Antibodies, A Laboratory Manual; Freshney (2005) i Culture of Animal Cells: A Manual of Basic Technique, 5th edition; Gait ed. (1984) Oligonucleotide Synthesis; U.S. Pat. No. 4,683,195; Hames and Higgins eds. (1984) Nucleic Acid Hybridization; Anderson (1999) Nucleic Acid Hybridization; Hames and Higgins eds. (1984) Transcription and Translation; Immobilized Cells and Enzymes (IRL Press (1986)); Perbal (1984) A Practical Guide to Molecular Cloning; Miller and Calos eds. (1987) Gene Transfer Vectors for Mammalian Cells (Cold Spring Harbor Laboratory); Makrides ed. (2003) Gene Transfer and Expression in Mammalian Cells; Mayer and Walker eds. (1987) Immunochemical Methods in Cell and Molecular Biology (Academic Press, London); and Herzenberg et al. eds (1996) Weir's Handbook of Experimental Immunology.


The terminology used in the description herein is for the purpose of describing particular embodiments only and is not intended to be limiting of the invention. All publications, patent applications, patents and other references mentioned herein are incorporated by reference in their entirety.


All numerical designations, e.g., pH, temperature, time, concentration, and molecular weight, including ranges, are approximations which are varied (+) or (−) by increments of 1.0 or 0.1, as appropriate or alternatively by a variation of +/−15%, or alternatively 10% or alternatively 5% or alternatively 2%. It is to be understood, although not always explicitly stated, that all numerical designations are preceded by the term “about”. It also is to be understood, although not always explicitly stated, that the reagents described herein are merely exemplary and that equivalents of such are known in the art.


Unless the context indicates otherwise, it is specifically intended that the various features of the invention described herein can be used in any combination. Moreover, the disclosure also contemplates that in some embodiments, any feature or combination of features set forth herein can be excluded or omitted. To illustrate, if the specification states that a complex comprises components A, B and C, it is specifically intended that any of A, B or C, or a combination thereof, can be omitted and disclaimed singularly or in any combination.


Unless explicitly indicated otherwise, all specified embodiments, features, and terms intend to include both the recited embodiment, feature, or term and biological equivalents thereof.


Definitions

As used in the specification and claims, the singular form “a”, “an” and “the” include plural references unless the context clearly dictates otherwise. For example, the term “a polypeptide” includes a plurality of polypeptides, including mixtures thereof.


The term “about,” as used herein when referring to a measurable value such as an amount or concentration and the like, is meant to encompass variations of 20%, 10%, 5%, 1%, 0.5%, or even 0.1% of the specified amount.


As used herein, the term “comprising” is intended to mean that the compositions and methods include the recited elements, but do not exclude others. “Consisting essentially of” when used to define compositions and methods, shall mean excluding other elements of any essential significance to the combination for the intended use. Thus, a composition consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives, and the like. “Consisting of” shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions of this invention. Embodiments defined by each of these transition terms are within the scope of this invention.


A “subject” of diagnosis or treatment is a cell or an animal such as a mammal, or a human. Non-human animals subject to diagnosis or treatment and are those subject to infections or animal models, for example, simians, murines, such as, rats, mice, chinchilla, canine, such as dogs, leporids, such as rabbits, livestock, sport animals, and pets.


The term “protein”, “peptide” and “polypeptide” are used interchangeably and in their broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics. The subunits may be linked by peptide bonds. In another embodiment, the subunit may be linked by other bonds, e.g., ester, ether, etc. A protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise a protein's or peptide's sequence. As used herein the term “amino acid” refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics. As used herein, the term “fusion protein” refers to a protein comprised of domains from more than one naturally occurring or recombinantly produced protein, where generally each domain serves a different function. In this regard, the term “linker” refers to a protein fragment that is used to link these domains together—optionally to preserve the conformation of the fused protein domains and/or prevent unfavorable interactions between the fused protein domains which may compromise their respective functions.


The terms “polynucleotide” and “oligonucleotide” are used interchangeably and refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides or analogs thereof. Polynucleotides can have any three-dimensional structure and may perform any function, known or unknown. The following are non-limiting examples of polynucleotides: a gene or gene fragment (for example, a probe, primer, EST or SAGE tag), exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, RNAi, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes and primers. A polynucleotide can comprise modified nucleotides, such as methylated nucleotides and nucleotide analogs. If present, modifications to the nucleotide structure can be imparted before or after assembly of the polynucleotide. The sequence of nucleotides can be interrupted by non-nucleotide components. A polynucleotide can be further modified after polymerization, such as by conjugation with a labeling component. The term also refers to both double- and single-stranded molecules. Unless otherwise specified or required, any embodiment of this invention that is a polynucleotide encompasses both the double-stranded form and each of two complementary single-stranded forms known or predicted to make up the double-stranded form.


A polynucleotide is composed of a specific sequence of four nucleotide bases: adenine (A); cytosine (C); guanine (G); thymine (T); and uracil (U) for thymine when the polynucleotide is RNA. In some embodiments, the polynucleotide may comprise one or more other nucleotide bases, such as inosine (I), a nucleoside formed when hypoxanthine is attached to ribofuranose via a β-N9-glycosidic bond, resulting in the chemical structure:




embedded image



Inosine is read by the translation machinery as guanine (G). The term “polynucleotide sequence” is the alphabetical representation of a polynucleotide molecule. This alphabetical representation can be input into databases in a computer having a central processing unit and used for bioinformatics applications such as functional genomics and homology searching.


As used herein, “expression” refers to the process by which polynucleotides are transcribed into mRNA and/or the process by which the transcribed mRNA is subsequently being translated into peptides, polypeptides, or proteins. If the polynucleotide is derived from genomic DNA, expression may include splicing of the mRNA in a eukaryotic cell.


The terms “equivalent” or “biological equivalent” are used interchangeably when referring to a particular molecule, biological, or cellular material and intend those having minimal homology while still maintaining desired structure or functionality.


The term “encode” as it is applied to polynucleotides refers to a polynucleotide which is said to “encode” a polypeptide if, in its native state or when manipulated by methods well known to those skilled in the art, it can be transcribed and/or translated to produce the mRNA for the polypeptide and/or a fragment thereof. The antisense strand is the complement of such a nucleic acid, and the encoding sequence can be deduced therefrom.


As used herein, the term “functional” may be used to modify any molecule, biological, or cellular material to intend that it accomplishes a particular, specified effect.


As used herein, the terms “treating,” “treatment” and the like are used herein to mean obtaining a desired pharmacologic and/or physiologic effect. The effect may be prophylactic in terms of completely or partially preventing a disease, disorder, or condition or sign or symptom thereof, and/or may be therapeutic in terms of a partial or complete cure for a disorder and/or adverse effect attributable to the disorder.


“Administration” can be effected in one dose, continuously or intermittently throughout the course of treatment. Methods of determining the most effective means and dosage of administration are known to those of skill in the art and will vary with the composition used for therapy, the purpose of the therapy, the target cell being treated, and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician. Suitable dosage formulations and methods of administering the agents are known in the art. Route of administration can also be determined and method of determining the most effective route of administration are known to those of skill in the art and will vary with the composition used for treatment, the purpose of the treatment, the health condition or disease stage of the subject being treated, and target cell or tissue. Non-limiting examples of route of administration include oral administration, nasal administration, injection, and topical application.


The term “effective amount” refers to a quantity sufficient to achieve a desired effect. In the context of therapeutic or prophylactic applications, the effective amount will depend on the type and severity of the condition at issue and the characteristics of the individual subject, such as general health, age, sex, body weight, and tolerance to pharmaceutical compositions. In the context of an immunogenic composition, in some embodiments the effective amount is the amount sufficient to result in a protective response against a pathogen. In other embodiments, the effective amount of an immunogenic composition is the amount sufficient to result in antibody generation against the antigen. In some embodiments, the effective amount is the amount required to confer passive immunity on a subject in need thereof. With respect to immunogenic compositions, in some embodiments the effective amount will depend on the intended use, the degree of immunogenicity of a particular antigenic compound, and the health/responsiveness of the subject's immune system, in addition to the factors described above. The skilled artisan will be able to determine appropriate amounts depending on these and other factors.


In the case of an in vitro application, in some embodiments the effective amount will depend on the size and nature of the application in question. It will also depend on the nature and sensitivity of the in vitro target and the methods in use. The skilled artisan will be able to determine the effective amount based on these and other considerations. The effective amount may comprise one or more administrations of a composition depending on the embodiment.


The term “Cas9” refers to a CRISPR associated endonuclease referred to by this name (for example, UniProtKB G3ECR1 (CAS9_STRTR)) as well as dead Cas9 or dCas9, which lacks endonuclease activity (e.g., with mutations in both the RuvC and HNH domain). The term “Cas9” may further refer to equivalents of the referenced Cas9 having at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% identity thereto, including but not limited to other large Cas9 proteins. In some embodiments, the Cas9 is derived from Campylobacter jejuni or another Cas9 orthologue 1000 amino acids or less in length.


The term “vector” refers to a polynucleotide (usually DNA) used to artificially carry foreign genetic material to another cell where it can be replicated or expressed. Non-limiting exemplary vectors include plasmids, viral vectors, cosmids, and artificial chromosomes. Such vectors may be derived from a variety of sources, including bacterial and viral sources. A non-limiting exemplary viral source for a plasmid is adeno-associated virus.


As used herein, the term “recombinant expression system” refers to a genetic construct or constructs for the expression of certain genetic material formed by recombination; the term “construct” in this regard is interchangeable with the term “vector” as defined herein.


The term “adeno-associated virus” or “AAV” as used herein refers to a member of the class of viruses associated with this name and belonging to the genus dependoparvovirus, family Parvoviridae. Multiple serotypes of this virus are known to be suitable for gene delivery; all known serotypes can infect cells from various tissue types. At least 11, sequentially numbered, are disclosed in the prior art. Non-limiting exemplary serotypes useful for the purposes disclosed herein include any of the 11 serotypes, e.g., AAV2 and AAV8.


The term “lentivirus” as used herein refers to a member of the class of viruses associated with this name and belonging to the genus lentivirus, family Retroviridae. While some lentiviruses are known to cause diseases, other lentivirus are known to be suitable for gene delivery. See, e.g., Tomas et al. (2013) Biochemistry, Genetics and Molecular Biology: “Gene Therapy—Tools and Potential Applications,” ISBN 978-953-51-1014-9, DOI: 10.5772/52534.


As used herein the term “restoring” in relation to expression of a protein refers to the ability to establish expression of full length protein where previously protein expression was truncated due to mutation.


The term “mutation” as used herein, refers to an alteration to a nucleic acid sequence encoding a protein relative to the consensus sequence of said protein. “Missense” mutations result in the substitution of one codon for another; “nonsense” mutations change a codon from one encoding a particular amino acid to a stop codon. Nonsense mutations often result in truncated translation of proteins. “Silent” mutations are those which have no effect on the resulting protein. As used herein the term “point mutation” refers to a mutation affecting only one nucleotide in a gene sequence. “Splice site mutations” are those mutations present pre-mRNA (prior to processing to remove introns) resulting in mistranslation and often truncation of proteins from incorrect delineation of the splice site.


“Messenger RNA” or “mRNA” is a nucleic acid molecule that is transcribed from DNA and then processed to remove non-coding sections known as introns. The resulting mRNA is exported from the nucleus (or another locus where the DNA is present) and translated into a protein. The term “pre-mRNA” refers to the strand prior to processing to remove non-coding sections.


“Transfer ribonucleic acid” or “tRNA” is a nucleic acid molecule that helps translate mRNA to protein. tRNA have a distinctive folded structure, comprising three hairpin loops; one of these loops comprises a “stem” portion that encodes an anticodon. The anticodon recognizes the corresponding codon on the mRNA. Each tRNA is “charged with” an amino acid corresponding to the mRNA codon; this “charging” is accomplished by the enzyme tRNA synthetase. Upon tRNA recognition of the codon corresponding to its anticodon, the tRNA transfers the amino acid with which it is charged to the growing amino acid chain to form a polypeptide or protein. Endogenous tRNA can be charged by endogenous tRNA synthetase. Accordingly, endogenous tRNA are typically charged with canonical amino acids. Orthogonal tRNA, derived from an external source, require a corresponding orthogonal tRNA synthetase. Such orthogonal tRNAs may be charged with both canonical and non-canonical amino acids. In some embodiments, the amino acid with which the tRNA is charged may be detectably labeled to enable detection in vivo. Techniques for labeling are known in the art and include, but are not limited to, click chemistry wherein an azide/alkyne containing unnatural amino acid is added by the orthogonal tRNA/synthetase pair and, thus, can be detected using alkyne/azide comprising fluorophore or other such molecule.


The term “stop codon” intends a three nucleotide contiguous sequence within messenger RNA that signals a termination of translation. Non-limiting examples include in RNA, UAG, UAA, UGA and in DNA TAG, TAA or TGA. Unless otherwise noted, the term also includes nonsense mutations within DNA or RNA that introduce a premature stop codon, causing any resulting protein to be abnormally shortened. tRNA that correspond to the various stop codons are known by specific names: amber (UAG), ochre (UAA), and opal (UGA).


“Canonical amino acids” refer to those 20 amino acids found naturally in the human body shown in the table below with each of their three letter abbreviations, one letter abbreviations, structures, and corresponding codons:














non-polar, aliphatic residues











Glycine
Gly
G


embedded image


GGU GGC GGA GGG





Alanine
Ala
A


embedded image


GCU GCC GCA GCG





Valine
Val
V


embedded image


GUU GUC GUA GUG





Leucine
Leu
L


embedded image


UUA UUG CUU CUC CUA CUG





Isoleucine
Ile
I


embedded image


AUU AUC AUA





Proline
Pro
P


embedded image


CCU CCC CCA CCG










aromatic residues











Phenylalanine
Phe
F


embedded image


UUU UUC





Tyrosine
Tyr
Y


embedded image


UAU UAC





Tryptophan
Trp
W


embedded image


UGG










polar, non-charged residues











Serine
Ser
S


embedded image


UCU UCC UCA UCG AGU AGC





Threonine
Thr
T


embedded image


ACU ACC ACA ACG





Cysteine
Cys
C


embedded image


UGU UGC





Methionine
Met
M


embedded image


AUG





Asparagine
Asn
N


embedded image


AAU AAC





Glutamine
Gln
Q


embedded image


CAA CAG










positively charged residues











Lysine
Lys
K


embedded image


AAA AAG





Arginine
Arg
R


embedded image


CGU CGC CGA CGG AGA AGG





Histidine
His
H


embedded image


CAU CAC










negatively charged residues











Aspartate
Asp
D


embedded image


GAU GAC





Glutamate
Glu
E


embedded image


GAA GAG









The term “non-canonical amino acids” refers to those synthetic or otherwise modified amino acids that fall outside this group, typically generated by chemical synthesis or modification of canonical amino acids (e.g. amino acid analogs). The present disclosure employs proteinogenic non-canonical amino acids in some of the methods and vectors disclosed herein. A non-limiting exemplary non-canonical amino acid is pyrrolysine (Pyl or O), the chemical structure of which is provided below:




embedded image



Inosine (I) is another exemplary non-canonical amino acid, which is commonly found in tRNA and is essential for proper translation according to “wobble base pairing.” The structure of inosine is provided above.


The term “ADAR” as used herein refers to an adenosine deaminase that can convert adenosines (A) to inosines (I) in an RNA sequence. ADAR1 and ADAR2 are two exemplary species of ADAR that are involved in mRNA editing in vivo. Non-limiting exemplary sequences for ADAR1 may be found under the following reference numbers: HGNC: 225; Entrez Gene: 103; Ensembl: ENSG 00000160710; OMIM: 146920; UniProtKB: P55265; and GeneCards: GC01M154554, as well as biological equivalents thereof. Non-limiting exemplary sequences for ADAR2 may be found under the following reference numbers: HGNC: 226; Entrez Gene: 104; Ensembl: ENSG00000197381; OMIM: 601218; UniProtKB: P78563; and GeneCards: GC21P045073, as well as biological equivalents thereof. Further non-limited exemplary sequences of the catalytic domain are provided hereinabove. The forward and reverse RNA used to direct site-specific ADAR editing are known as “adRNA” and “radRNA,” respectively. The catalytic domains of ADAR1 and ADAR2 are comprised in the sequences provided herein below.









ADAR1 catalytic domain:


(SEQ ID NO: 124)


KAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAML





SHRCFNTLTNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGD





SLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNSQTAKDSIFEPAKGGE





KLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFENPKQ





GKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLG





LQGALLTHFLQPIYLKSVTLGYLFSQGHLTRAICCRVTRDGSAFEDGLRH





PFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYDLEILDGTRGTVD





GPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKN





YFKKGLKDMGYGNWISKPQEEKNFYLCPV





ADAR2 catalytic domain:


(SEQ ID NO: 125)


QLHLPQVLADAVSRLVLGKFGDLTDNFSSPHARRKVLAGVVMTTGTDVKD





AKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYTQLELYL





NNKDDQKRSIFQKSERGGFRLKENVQFHLYISTSPCGDARIFSPHEPILE





EPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMS





CSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRIS





NIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDSAIEVINAT





TGKDELGRASRLCKHALYCRWMRVHGKVPSHLLRSKITKPNVYHESKLAA





KEYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSLT






The double stranded RNA binding domains (dsRBD) of an ADAR is comprised in the sequence provided herein below.









ADAR dsRBD:


(SEQ ID NO: 126)


MDIEDEENMSSSSTDVKENRNLDNVSPKDGSTPGPGEGSQLSNGGGGGPG





RKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYTLLSQ





TGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASE





AHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAEPPFYVGSNGDDSF





SSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPVMILNELRPGLKYD





FLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALAAIFN






It is appreciated that further mutations can be made to the sequence of the ADAR and/or its various domains. For example, Applicants have generated E488Q and E1008Q mutants of both ADAR1 and ADAR2, as well as a “promiscuous” variant of ADAR2—resulting from a C-terminal deletion. This “promiscuous” variant is known as such because it demonstrated promiscuity in edited reads with several As close to a target sequence showing an A to G conversion (verified across 2 different loci). The sequence of this variant is provided herein below.









“Promiscuous” ADAR2 variant:


(SEQ ID NO: 127)


MLRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKAE





PPFYVGSNGDDSFSSSGDLSLSASPVPASLAQPPLPVLPPFPPPSGKNPV





MILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKAR





AAQSALAAIFNLHLDQTPSRQPIPSEGLQLHLPQVLADAVSRLVLGKFGD





LTDNFSSPHARRKVLAGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRG





LALNDCHAEIISRRSLLRFLYTQLELYLNNKDDQKRSIFQKSERGGFRLK





ENVQFHLYISTSPCGDARIFSPHEPILEEPADRHPNRKARGQLRTKIESG





EGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFV





EPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNA





EARQPGKAPNFSVNWTVGDSAIEVINATTGKDELGRASRLCKHALYCRWM





RVHGKVPSHLLRSKITKPNVYHESKLAAKEYQAAKARLFTAFIKAGLGAW





VEKPTEQDQFSLTP*







Not to be bound by theory, a C-terminal deletion in ADAR1 may produce the same or similar effect.


The term “deficiency” as used herein refers to lower than normal (physiologically acceptable) levels of a particular agent. In context of a protein, a deficiency refers to lower than normal levels of the full length protein.


The term “dystrophin” as used herein refers to the protein corresponding with that name and encoded by the gene Dmd; a non-limiting example of which is found under UniProt Reference Number P11532 (for humans) and P11531 (for mice).


The term “ornithine transcarbamylase” or “OTC” as used herein refers to the protein corresponding with that name and encoded by the gene Otc; a non-limiting example of which is found under UniProt Reference Number P00480 (for humans) and P11725 (for mice). OTC deficiency is an X-linked genetic condition resulting in high concentrations of ammonia in blood. In some cases, OTC deficiency is caused by a G→A splice site mutation in the donor splice site of exon 4 that results in mis-splicing of the pre-mRNA. This mutation results in the formation of a protein that either is elongated or bears a point mutation. There is a 15-20 fold reduction in the OTC protein levels. The FIG. 31 (taken from Hodges, P. E. & Rosenberg, L. E. The spfash mouse: a missense mutation in the ornithine transcarbamylase gene also causes aberrant mRNA splicing. Proc. Natl. Acad. Sci. U.S.A. 86, 4142-4146 (1989)) shows the alternative forms produced. The sequences thereof are provided below:









OTC pre-mRNA (wild type):


(SEQ ID NO: 128)


. . . CTCACAGACACCGCTCGGTTTGTAAAACTTTTCTTC . . . 





OTC pre-mRNA(mutant):


(SEQ ID NO: 129)


. . . CTCACAGACACCGCTCcustom characterGTTTGTAAAACTTTTCTTC . . . 





OTC mRNA (incorrectly spliced, mutant):


(SEQ ID NO: 130)


. . . CTCACAGACACCGCTCAGTTTGTAAAACTTTTCTTC . . . 





OTC mRNA (correctly spliced, mutant):


(SEQ ID NO: 131)


. . . CTCACAGACACCGCTCATGTCTTATCTAGCATGACA . . . 





OTC mRNA (correctly spliced, wild type):


(SEQ ID NO: 132)


. . . CTCACAGACACCGCTCGTGTCTTATCTAGCATGACA . . . 







As shown above, a correct splice variant may be produced when the mutation is present; however, such production results in a missense mutation, which also can contribute to OTC deficiency.


The terms “hairpin,” “hairpin loop,” “stem loop,” and/or “loop” used alone or in combination with “motif” is used in context of an oligonucleotide to refer to a structure formed in single stranded oligonucleotide when sequences within the single strand which are complementary when read in opposite directions base pair to form a region whose conformation resembles a hairpin or loop.


As used herein, the term “domain” refers to a particular region of a protein or polypeptide and is associated with a particular function. For example, “a domain which associates with an RNA hairpin motif” refers to the domain of a protein that binds one or more RNA hairpin. This binding may optionally be specific to a particular hairpin. For example, the M2 bacteriophage coat protein (MCP) is capable of specifically binding to particular stem-loop structures, including but not limited to the MS2 stem loop. See, e.g. Peabody, D. S., “The RNA binding site of bacteriophage MS2 coat protein.” EMBO J. 12(2):595-600 (1993); Corrigan and Chubb, “Biophysical Methods in Cell Biology” Methods in Cell Biology (2015). Similarly, λ N220—referred to herein as “N22 peptide” is capable of specifically binding to particular stem-loop structures, including but not limited to BoxB stem loops. See, e.g., Cilley and Williamson, “Analysis of bacteriophage N protein and peptide binding to boxB RNA using polyacrylamide gel coelectrophoresis (PACE).” RNA 3(1):57-67 (1997). The sequences of both MCP and MS2 stem loop and N22 peptide and BoxB loop are provided hereinabove in context of fusion proteins with an ADAR (MCP, N22 peptide) and use in adRNA (MS2 stem loop, BoxB loop), respectively.


The term “APOBEC” as used herein refers to any protein that falls within the family of evolutionarily conserved cytidine deaminases involved in mRNA editing—catalyzing a C to U conversion—and equivalents thereof. In some aspects, the term APOBEC refers to any one of APOBEC1, APOBEC2, APOBEC3A, APOBEC3B, APOBEC3C, APOBEC3E, APOBEC3F, APOBEC3G, APOBEC3H, APOBEC4, or equivalents each thereof. Non-limiting exemplary sequences of fusion proteins comprising one or more APOBEC domains are provided herein both fused to an ADAR domain or fused to alternative domains to render them suitable for use in an RNA editing system. To this end, APOBECs can be considered an equivalent of ADAR—catalyzing editing albeit by a different conversion. Thus, not to be bound by theory, Applicants believe that all embodiments contemplated herein for use with an ADAR based editing system may be adapted for use in an APOBEC based RNA editing system.


As used herein, the term “interferon” refers to a group of signaling proteins known to be associated with the immune response. In context of this application, the interferons of interest are those that result in enhanced expression of an ADAR. The correlation between interferon α and ADAR1 is well known, and, thus, the present disclosure contemplates use of interferon α as a means of increasing endogenous ADAR1 expression. Commercial sources of isolated or recombinant interferon α include but are not limited to Sigma-Aldrich, R&D Systems, Abcam, and Thermo Fisher Scientific. Alternatively, interferon α may be produced using a known vector and given protein sequence, e.g. Q6QNB6 (human IFNA).


It is to be inferred without explicit recitation and unless otherwise intended, that when the present disclosure relates to a polypeptide, protein, polynucleotide or antibody, an equivalent or a biologically equivalent of such is intended within the scope of this disclosure. As used herein, the term “biological equivalent thereof” is intended to be synonymous with “equivalent thereof” when referring to a reference protein, antibody, polypeptide or nucleic acid, intends those having minimal homology while still maintaining desired structure or functionality. Unless specifically recited herein, it is contemplated that any polynucleotide, polypeptide or protein mentioned herein also includes equivalents thereof. For example, an equivalent intends at least about 70% homology or identity, or at least 80% homology or identity and alternatively, or at least about 85%, or alternatively at least about 90%, or alternatively at least about 95%, or alternatively 98% percent homology or identity and exhibits substantially equivalent biological activity to the reference protein, polypeptide or nucleic acid. Alternatively, when referring to polynucleotides, an equivalent thereof is a polynucleotide that hybridizes under stringent conditions to the reference polynucleotide or its complement.


Applicants have provided herein the polypeptide and/or polynucleotide sequences for use in gene and protein transfer and expression techniques described below. It should be understood, although not always explicitly stated that the sequences provided herein can be used to provide the expression product as well as substantially identical sequences that produce a protein that has the same biological properties. These “biologically equivalent” or “biologically active” polypeptides are encoded by equivalent polynucleotides as described herein. They may possess at least 60%, or alternatively, at least 65%, or alternatively, at least 70%, or alternatively, at least 75%, or alternatively, at least 80%, or alternatively at least 85%, or alternatively at least 90%, or alternatively at least 95% or alternatively at least 98%, identical primary amino acid sequence to the reference polypeptide when compared using sequence identity methods run under default conditions. Specific polypeptide sequences are provided as examples of particular embodiments. Modifications to the sequences to amino acids with alternate amino acids that have similar charge. Additionally, an equivalent polynucleotide is one that hybridizes under stringent conditions to the reference polynucleotide or its complement or in reference to a polypeptide, a polypeptide encoded by a polynucleotide that hybridizes to the reference encoding polynucleotide under stringent conditions or its complementary strand. Alternatively, an equivalent polypeptide or protein is one that is expressed from an equivalent polynucleotide.


“Hybridization” refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues. The hydrogen bonding may occur by Watson-Crick base pairing, Hoogstein binding, or in any other sequence-specific manner. The complex may comprise two strands forming a duplex structure, three or more strands forming a multi-stranded complex, a single self-hybridizing strand, or any combination of these. A hybridization reaction may constitute a step in a more extensive process, such as the initiation of a PC reaction, or the enzymatic cleavage of a polynucleotide by a ribozyme.


Examples of stringent hybridization conditions include: incubation temperatures of about 25° C. to about 37° C.; hybridization buffer concentrations of about 6×SSC to about 10×SSC; formamide concentrations of about 0% to about 25%; and wash solutions from about 4×SSC to about 8×SSC. Examples of moderate hybridization conditions include: incubation temperatures of about 40° C. to about 50° C.; buffer concentrations of about 9×SSC to about 2×SSC; formamide concentrations of about 30% to about 50%; and wash solutions of about 5×SSC to about 2×SSC. Examples of high stringency conditions include: incubation temperatures of about 55° C. to about 68° C.; buffer concentrations of about 1×SSC to about 0.1×SSC; formamide concentrations of about 55% to about 75%; and wash solutions of about 1×SSC, 0.1×SSC, or deionized water. In general, hybridization incubation times are from 5 minutes to 24 hours, with 1, 2, or more washing steps, and wash incubation times are about 1, 2, or 15 minutes. SSC is 0.15 M NaCl and 15 mM citrate buffer. It is understood that equivalents of SSC using other buffer systems can be employed.


“Homology” or “identity” or “similarity” refers to sequence similarity between two peptides or between two nucleic acid molecules. Homology can be determined by comparing a position in each sequence which may be aligned for purposes of comparison. When a position in the compared sequence is occupied by the same base or amino acid, then the molecules are homologous at that position. A degree of homology between sequences is a function of the number of matching or homologous positions shared by the sequences. An “unrelated” or “non-homologous” sequence shares less than 40% identity, or alternatively less than 25% identity, with one of the sequences of the present invention.


MODES OF CARRYING OUT THE DISCLOSURE

Point mutations underlie many genetic diseases. In this regard, while programmable DNA nucleases have been used to repair mutations, their use for gene therapy poses multiple challenges: one, efficiency of homologous recombination is typically low in cells; two, an active nuclease presents a risk of introducing permanent off-target mutations; and three, prevalent programmable nucleases typically comprise elements of non-human origin raising the potential of in vivo immunogenicity. In light of these, approaches to instead directly target RNA, and use of molecular machinery native to the host would be highly desirable. Towards this, Applicants have engineered and optimized two complementary approaches, referred together hereon as tRiAD, based on the use of tRNAs in codon suppression and adenosine deaminases in RNA editing. Specifically, by delivering modified endogenous tRNAs or the RNA editing enzyme ADAR and an associated guiding RNA (adRNA) via adeno-associated viruses, Applicants enabled premature stop codon read-through and correction in the mdx mouse model of muscular dystrophy that harbors a nonsense mutation in the dystrophin gene. Additionally, Applicants engineered ADAR2 mediated correction of a point mutation in liver RNA of the spfash mouse model of ornithine transcarbamylase (OTC) deficiency. Taken together, the results disclosed herein establish the use of suppressor tRNAs and ADAR2 for in vivo RNA targeting, and this integrated tRiAD approach is robust, genomically scarless, and potentially non-immunogenic, as it utilizes effector RNAs and human proteins.


Aspects of the disclosure relate to a tRNA based protein editing system optionally alone or in combination with an ADAR based RNA editing system comprising one or more forward guide RNAs for the ADAR (“adRNAs”) and one or more corresponding reverse guide RNAs for the ADAR (“radRNAs”) to the subject, wherein the ADAR based RNA editing system specifically edits a point mutation in an RNA sequence encoding a gene.


The tRNA based protein editing system may comprise endogenous modified tRNA and/or orthogonal tRNA in order to prevent off target editing of proteins. In this regard, systems for the control of these tRNA are disclosed herein below.


The adRNA architecture for use in the ADAR based RNA editing system is relatively simple, comprising a RNA targeting domain, complementary to the target and, optionally, one or two recruiting domains (also referred to as aptamers) that recruit RNA binding domains of various proteins. The optional recruiting domains are positioned at the 5′ and/or 3′ ends of the RNA targeting domain. A schematic of adRNA bound to its mRNA target is provided in FIG. 23C. In some embodiments, the adRNA features an A-C mismatch, which prompts editing function of the ADAR. A similar framework can be used to target pre-mRNA, prior to intron processing by adapting the scaffold to target the pre-mRNA present in the nucleus. This approach is taken in the non-limiting exemplary methods involving OTC deficiency—involving a splice site mutation, whereas an mRNA editing approach is taken in the non-limiting exemplary methods involving dystrophin deficiency—involving a nonsense mutation.


Applicants tested a series of scaffolds, shown in FIG. 19C, to recruit RNA binding domains of the ADARs. The sequences provided in the figure represent the recruiting domain and the italicized Ns represent the nucleotides complimentary to the target. The C is the mismatch that prompts the editing function. Sequences of varying length and mismatch position may be tested to determine the best adRNA for the desired target. For example, residues in the recruiting domain of the adRNAs generated by Applicants were modified as follows (5′-3′):









(SEQ ID NO: 104)


v1: GGGTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCA





CCTcustom character





(SEQ ID NO: 105)


v2: GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCAC






custom character






(SEQ ID NO: 106)


v3: GTGGAAGAGGAGAACAATATGCTAAATGTTGTTCTCGTCTCCCAC






custom character
custom character






(SEQ ID NO: 107)


v4: GGGTGGAAGAGGAGAACAATATGCTAAATGTTGTTCTCGTCTCCCA





CCTcustom charactercustom character





(SEQ ID NO: 108)


v5: GGTGAAGAGGAGAACAATATGCTAAATGTTGTTCTCGTCTCCACC






custom character
custom character






(SEQ ID NO: 109)


v6: GGTGAAGAGGAGAACAATATGCTAAATGTTGTTCTCGTCTCCACC






custom character
custom character






(SEQ ID NO: 110)


v7: GTGGAAGAGGAGAACAATAGGCTAAACGTTGTTCTCGTCTCCCAC






custom character
custom character






(SEQ ID NO: 111)


v8: GGGTGGAAGAGGAGAACAATAGGCTAAACGTTGTTCTCGTCTCCCA





CCTcustom charactercustom character





(SEQ ID NO: 112)


v9: GGTGAAGAGGAGAACAATAGGCTAAACGTTGTTCTCGTCTCCACC






custom character
custom character






(SEQ ID NO: 113)


v10: GGTGAAGAGGAGAACAATAGGCTAAACGTTGTTCTCGTCTCCACC






custom character
custom character






(SEQ ID NO: 114)


v11: GGTGTCGAGAATAGTATAACAATATGCTAAATGTTGTTATAGTAT





CCTCGACACCcustom character





(SEQ ID NO: 115)


v12: GGTGTCGAGAAGAGGAGAACAATATGCTAAATGTTGTTCTCGTCT





CCTCGACACCcustom character





(SEQ ID NO: 116)


v13: GGTGTCGAGAAGAGGAGAACAATAGGCTAAACGTTGTTCTCGTCT





CCTCGACACCcustom character






The structure of V2 after folding is provided as FIG. 23D. And the corresponding radRNAs were generated as follows:









(SEQ ID NO: 133)



custom character TCCACCCTATGATATTGTTGTAA






ATCGTATAACAATATGATAAGGTGGG





(SEQ ID NO: 134)



custom character CACCCTATGATATTGTTGTAA






ATCGTATAACAATATGATAAGGTG





(SEQ ID NO: 135)



custom character CACCCTCTGCTCTTGTTGTA






AATCGTATAACAAGAGGAGAAGGTG





(SEQ ID NO: 136)



custom character TCCACCCTCTGCTCTTGTTGTAA






ATCGTATAACAAGAGGAGAAGGTGGG





(SEQ ID NO: 137)



custom character CCACCTCTGCTCTTGTTGTA






AATCGTATAACAAGAGGAGAAGTGG





(SEQ ID NO: 138)



custom character CCACCTCTGCTCTTGTTGT






AAATCGTATAACAAGAGGAGAAGTGG





(SEQ ID NO: 139)



custom character CACCCTCTGCTCTTGTTGCA






AATCGGATAACAAGAGGAGAAGGTG





(SEQ ID NO: 140)



custom character TCCACCCTCTGCTCTTGTTGCAA






ATCGGATAACAAGAGGAGAAGGTGGG





(SEQ ID NO: 141)



custom character CCACCTCTGCTCTTGTTGCA






AATCGGATAACAAGAGGAGAAGTGG





(SEQ ID NO: 142)



custom character CCACCTCTGCTCTTGTTGCA






AATCGGATAACAAGAGGAGAAGTGG





(SEQ ID NO: 143)



custom character CCACAGCTCCTCTGCTCTTGTTGC






AAATCGGATAACAAGAGGAGAAGAGCTGTGG





(SEQ ID NO: 144)



custom character CCACAGCTCCTCTGCTCTTGTTGT






AAATCGTATAACAAGAGGAGAAGAGCTGTGG





(SEQ ID NO: 145)



custom character CCACAGCTCCTATGATATTGTTGT






AAATCGTATAACAATATGATAAGAGCTGTGG






A schematic of the resulting adRNA and radRNA pairings to the target mRNA is shown in FIG. 16C.


An alternative scaffold framework was also applied by Applicants using two ADAR recruiting domains (black font) on either side of the targeting domain while varying the position of the C mismatch in the targeting domain (italicized Ns).











(SEQ ID NO: 146)




TGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCAC









custom character
custom character
GTGGAATAGTATAACAATATGCTA









AATGTTGTTATAGTATCCCAC







These non-limiting exemplary scaffolds provide a template for the engineering of adRNA and radRNA for particular targets and may be optimized based on comparative efficacy studies carried out according to the exemplary methods disclosed herein.


In some embodiments, the ADAR based editing system further comprises ADAR1, ADAR2, the E488Q and E100Q mutants each thereof, a fusion protein comprising the catalytic domain of an ADAR and a domain which associates with an RNA hairpin motif, a fusion protein comprising the catalytic domain of an ADAR and a dead Cas9, or a fusion protein comprising the double stranded binding domain of an ADAR and an APOBEC. In further embodiments, the domain which associates with an RNA hairpin motif is selected from the group of an MS2 bacteriophage coat protein (MCP) and an N22 peptide. In some embodiments, the adRNA comprises one or more RNA hairpin motifs. In some embodiments, the one or more RNA hairpin motifs are selected from the group of an MS2 stem loop and a BoxB loop.


Not to be bound by theory, Applicants believe the double stranded RNA binding motif from ADARs may bind to several double stranded RNA sequences and could thus have possible off target effects. To avoid such effects, Applicants contemplate the use of exogenous protein domains to recognize RNA hairpin motifs in the adRNA. Both ADAR1 and ADAR2 consist of RNA binding domains and a catalytic domain that catalyzes the conversion of adenosine to inosine. The catalytic domain can be uncoupled from the RNA binding domain. Our aim is to achieve high editing efficiency of the targeted adenosine while reducing off target effects and thus are exploring alternative RNA binding domains. Applicants have fused the catalytic domain of the ADAR1 or ADAR2 to different RNA binding domains such as the MCP, N22 or a dead CjCas9 (or other RNA targeting CRISPRs such as from SaCas9, CRISPR-Cas13 etc.). Upon the addition of appropriate guide RNAs (adRNAs), the fusion proteins are recruited to the target, further catalyzing an adenosine to inosine change. The dead CjCas9 (and other CRISPRs by extension) in this case basically serves as a RNA binding domain that can in turn be tethered to effectors.


The domains are fused to the ADAR catalytic domain to generate ADAR specifically targeting the particular adRNA comprising the RNA hairpin motifs. For example, Applicants have used a MS2 bacteriophage coat protein (MCP) fused to either the catalytic domain of ADAR1 or ADAR2 and their respective mutants E488Q and E1008Q, while using a MS2 stem loop on the RNA to recruit the fusion protein (FIG. 23A). Analogous to this system, Applicants have also utilized a N22 peptide fused to the catalytic domains of ADAR1 or ADAR2 (and their mutants) while making use of a boxB aptamer to recruit the fusion protein. Thus, one or two copies of ADAR may be recruited based on the addition of single or dual hairpins (MS2/BoxB loops) (FIG. 23A). PP7 hairpins are also contemplated for use in the same manner.


A non-limiting framework sequence for the recruitment of MCP-based fusion proteins, where the C mismatch may be varied within the targeting domain, is provided herein below (with the lower case letters representing those linkers that help stabilize the underlined hairpins):


Single Recruiting Domain (Underlined):









(SEQ ID NO: 98)



custom character ggccAACATGAGGATCACCCATGT






CTGCAGggcc







Two Recruiting Domains (Underlined):











(SEQ ID NO: 99)



aACATGAGGATCACCCATGTccustom character a









ACATGAGGATCACCCATGT
c








An analogous non-limiting framework sequence is provided for the N22-based fusion proteins:


Single Recruiting Domain (Underlined):











(SEQ ID NO: 100)




custom character

gccctgaagaagggc

custom character








Two Recruiting Domains (Underlined):









(SEQ ID NO: 101)



custom character

GCCCTGAAGAAGGGC

custom character

GCCCTGAA









GAAGGGC

custom character







Another approach is to recruitment domains in the adRNA associated with Cas9 and couple a dead Cas9 to the ADAR catalytic domain, thus, rendering the same effect of specific recruitment. A non-limiting framework sequence for the recruitment is provided for Cas9-based fusion proteins:









(SEQ ID NO: 147)


Psp dCas13a recruitment (mismatch position can be


varied)


CAACATTATCGGGGAGTTTTGACCTCCAAGGTGTTGcustom character






custom character
custom character
custom character






Cj dCas9 recruitment (mismatch position can be


varied)


(SEQ ID NO: 148)



custom character
custom character gttttagtccctgaaaagggactaaaat






aaagagtttgcgggactctgcggggttacaatcccctaaaaccgcttttt





tt






APOBECs also have RNA editing function (FIG. 23B). Thus, they may be used in the alternative or in addition to the ADAR based editing system. For example, Applicants have created MCP/N22 peptide fusions with APOBECs to engineer targeted C→T RNA editing. In addition, Applicants have fused the double stranded RNA binding domains (dsRBD) of the ADAR2 with APOBECs as a result of which the APOBECs can be recruited by the adRNA.


The addition of Nuclear Localization Signals (NLS) to the fusion protein could help target nuclear RNA (i.e. pre-mRNA) while addition of Nuclear Export Signals (NES) to the fusion protein could help target cytoplasmic RNA in any of the embodiments disclosed herein. This method is useful when editing for splice site mutations, which result in incorrect processing of introns in the pre-mRNA and, thus, results in incorrect mRNA for translation. OTC deficiency is example where targeting pre-mRNA with adRNA scaffolds can be useful, since the majority of aberrant OTC expression comes from the splice site mutation resulting in a truncated OTC protein. Further addition of RNA localization tags to the adRNA will enable targeting RNA in specific cellular compartments.


In further embodiments where the adRNA comprises one or more RNA hairpin motifs, the one or more RNA hairpin motifs are stabilized by replacing A-U with G-C. In some embodiments, the adRNA is stabilized through the incorporation of one or more of 2′-O-methyl, 2′-O-methyl 3′phosphorothioate, or 2′-O-methyl 3′thioPACE at either or both termini of the adRNA.


More generally, can be appreciated that the RNA targeting domains of adRNAs are designed such that they are complementary to the target mRNA while containing C mismatch at the position of the target adenosine. The recruiting domains of the adRNA are constant. BY way of non-limiting example:


Example Target: OTC mRNA (Mutation Underlined)









(SEQ ID NO: 149)


5′-AAAGTCTCACAGACACCGCTCAGTTTGTAAAACTTTTCTTC-3′







adRNA v2 (Targeting Domain Length 20 bp, Mismatch Position after 6 Bases):









(SEQ ID NO: 149)


5′-AAAGTCTCACAGACACCGCTCAGTTTGTAAAACTTTTCTTC-3′





(SEQ ID NO: 150)


5′-GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCA





Ccustom charactercustom character -3′







adRNA v2 (Targeting Domain Length 21 bp, Mismatch Position after 6 Bases):









(SEQ ID NO: 149)


5′-AAAGTCTCACAGACACCGCTCAGTTTGTAAAACTTTTCTTC-3′





(SEQ ID NO: 151)


5′-GTGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCA





Ccustom charactercustom character -3′







radRNA v2 (Targeting Domain Length 20 bp, Mismatch Position after 6 Bases):









(SEQ ID NO: 149)


3′-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5′





(SEQ ID NO: 152)


5′-custom character CACCCTATGATATTGTTGTAAATC





GTATAACAATATGATAAGGTG-3′







adRNA Dual (Targeting Domain Length 20 bp, Mismatch Position after 5, 14 Bases):









(SEQ ID NO: 149)


3′-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5′





(SEQ ID NO: 153)


5′-TGGAATAGTATAACAATATGCTAAATGTTGTTATAGTATCCCAC






custom character
custom character GTGGAATAGTATAACAATATGCTAAAT






GTTGTTATAGTATCCCAC-3′







adRNA MS2 (Targeting Domain Length 20 bp, Mismatch Position after 14 Bases)









(SEQ ID NO: 149)


3′-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5′





(SEQ ID NO: 154)


5′-custom characterAACATGAGGATCACCCATGT






custom character -3′








adRNA MS2 Dual (Targeting Domain Length 20 bp, Mismatch Position after 5, 14 Bases)









(SEQ ID NO: 149)


3′-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5′





(SEQ ID NO: 155)


5′-aACATGAGGATCACCCATGTccustom characteraAC






ATGAGGATCACCCATGTc-3′








adRNA BoxB (Targeting Domain Length 20 bp, Mismatch Position after 14 Bases)









(SEQ ID NO: 149)


3′-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5′





(SEQ ID NO: 156)


5′-custom charactercustom charactergccctgaagaagggccc-3′







adRNA BoxB Dual (Targeting Domain Length 20 bp, Mismatch Position after 5, 14 Bases)









(SEQ ID NO: 149)


3′-CTTCTTTTCAAAATGTTTGACTCGCCACAGACACTCTGAAA-5′





(SEQ ID NO: 157)


5′-ggGCCCTGAAGAAGGGCcccustom characterggGCC






CTGAAGAAGGGCcc-3′







A coordinate or alternate approach to preventing off-target effects is to make use of endogenous ADAR. ADAR2 is highly expressed in tissues such as the brain, lung and spleen while ADAR1 is ubiquitously expressed with general expression levels being higher than ADAR1. Thus, Applicants propose two avenues in order to engineer RNA editing by endogenous ADARs. First, ADAR1 expression can be stimulated by molecules such as interferons, e.g., interferon α. Second, scaffolds may be engineered specifically for recruiting ADAR1 and are carrying out experiments with the v1-v13 scaffolds as well as some chemically modified scaffolds disclosed herein above. Making use of the endogenous ADARs as opposed to overexpression could help limit the off-target effects.


Recombinant Expression Systems and Vectors


Aspects of the disclosure relate to vectors and recombinant expression systems.


For example, some aspects relate to a vector encoding one or more tRNA having an anticodon sequence that recognizes a codon comprising a point mutation in an RNA sequence encoding a protein, optionally wherein the point mutation results in a premature stop codon. In some embodiments, the point mutation results in a nonsense mutation having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the tRNA is an endogenous tRNA with a modified anticodon stem recognizing the codon comprising the point mutation. In further embodiments, the tRNA is charged with a serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In further embodiments, the vector further comprises a corresponding tRNA synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments involving an orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In some embodiments, the vector encodes two tRNA having an anticodon sequence that recognizes the codon comprising the point mutation. In some embodiments, the vector is an AAV vector, optionally an AAV8 vector. In some embodiments, the protein is dystrophin.


Further aspects relate to a recombinant expression system comprising one or more vectors encoding an ADAR based RNA editing system comprising one or more forward guide RNAs for the ADAR (“adRNAs”) and one or more corresponding reverse guide RNAs for the ADAR (“radRNAs”) to the subject, wherein the ADAR based RNA editing system specifically edits a point mutation in an RNA sequence encoding a protein. In some embodiments, the point mutation results in a nonsense mutation, optionally a premature stop codon, having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the ADAR based RNA editing system converts UAA to UIA and, optionally, further UIA to UII. In some embodiments, the ADAR based RNA editing system converts UAA to UAI. In some embodiments, the point mutation results in a splice site or missense mutation having the DNA sequence CAG and the RNA sequence CAG. In some embodiments, the ADAR based RNA editing system converts CAG to CIG. In further embodiments, the one or more vector further encodes a tRNA that targets an amber codon. In some embodiments, the ADAR based editing system further comprises ADAR1, ADAR2, the E488Q and E100Q mutants each thereof, a fusion protein comprising the catalytic domain of an ADAR and a domain which associates with an RNA hairpin motif, a fusion protein comprising the catalytic domain of an ADAR and a dead Cas9, or a fusion protein comprising the double stranded binding domain of an ADAR and an APOBEC. In further embodiments, the domain which associates with an RNA hairpin motif is selected from the group of an MS2 bacteriophage coat protein (MCP) and an N22 peptide. In some embodiments, the adRNA comprises one or more RNA hairpin motifs. In some embodiments, the one or more RNA hairpin motifs are selected from the group of an MS2 stem loop and a BoxB loop and/or are stabilized by replacing A-U with G-C. In some embodiments, the adRNA is stabilized through the incorporation of one or more of 2′-O-methyl, 2′-O-methyl 3′phosphorothioate, or 2′-O-methyl 3′thioPACE at either or both termini of the adRNA.


In general methods of packaging genetic material such as RNA into one or more vectors is well known in the art. For example, the genetic material may be packaged using a packaging vector and cell lines and introduced via traditional recombinant methods.


In some embodiments, the packaging vector may include, but is not limited to retroviral vector, lentiviral vector, adenoviral vector, and adeno-associated viral vector (optionally AAV8). The packaging vector contains elements and sequences that facilitate the delivery of genetic materials into cells. For example, the retroviral constructs are packaging plasmids comprising at least one retroviral helper DNA sequence derived from a replication-incompetent retroviral genome encoding in trans all virion proteins required to package a replication incompetent retroviral vector, and for producing virion proteins capable of packaging the replication-incompetent retroviral vector at high titer, without the production of replication-competent helper virus. The retroviral DNA sequence lacks the region encoding the native enhancer and/or promoter of the viral 5′ LTR of the virus, and lacks both the psi function sequence responsible for packaging helper genome and the 3′LTR, but encodes a foreign polyadenylation site, for example the SV40 polyadenylation site, and a foreign enhancer and/or promoter which directs efficient transcription in a cell type where virus production is desired. The retrovirus is a leukemia virus such as a Moloney Murine Leukemia Virus (MMLV), the Human Immunodeficiency Virus (HIV), or the Gibbon Ape Leukemia virus (GALV). The foreign enhancer and promoter may be the human cytomegalovirus (HCMV) immediate early (IE) enhancer and promoter, the enhancer and promoter (U3 region) of the Moloney Murine Sarcoma Virus (MMSV), the U3 region of Rous Sarcoma Virus (RSV), the U3 region of Spleen Focus Forming Virus (SFFV), or the HCMV IE enhancer joined to the native Moloney Murine Leukemia Virus (MMLV) promoter.


The retroviral packaging plasmid may consist of two retroviral helper DNA sequences encoded by plasmid based expression vectors, for example where a first helper sequence contains a cDNA encoding the gag and pol proteins of ecotropic MMLV or GALV and a second helper sequence contains a cDNA encoding the env protein. The Env gene, which determines the host range, may be derived from the genes encoding xenotropic, amphotropic, ecotropic, polytropic (mink focus forming) or 10A1 murine leukemia virus env proteins, or the Gibbon Ape Leukemia Virus (GALV env protein, the Human Immunodeficiency Virus env (gp160) protein, the Vesicular Stomatitus Virus (VSV) G protein, the Human T cell leukemia (HTLV) type I and II env gene products, chimeric envelope gene derived from combinations of one or more of the aforementioned env genes or chimeric envelope genes encoding the cytoplasmic and transmembrane of the aforementioned env gene products and a monoclonal antibody directed against a specific surface molecule on a desired target cell. Similar vector based systems may employ other vectors such as sleeping beauty vectors or transposon elements.


The resulting packaged expression systems may then be introduced via an appropriate route of administration, discussed in detail with respect to the method aspects disclosed herein.


Compositions


Further aspects relate to a composition comprising any one or more of the vectors disclosed herein. In some embodiments, the composition further comprises an effective amount of an interferon to enhance endogenous ADAR1 expression. In still further embodiments, the interferon is interferon α.


Briefly, pharmaceutical compositions of the present disclosure including but not limited to any one of the claimed compositions may comprise a target cell population as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients.


Examples of well-known carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses and magnetite. The nature of the carrier can be either soluble or insoluble for purposes of the disclosure. Those skilled in the art will know of other suitable carriers for binding antibodies, or will be able to ascertain such, using routine experimentation.


Such compositions may also comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. Compositions of the present disclosure may be formulated for oral, intravenous, topical, enteral, and/or parenteral administration. In certain embodiments, the compositions of the present disclosure are formulated for intravenous administration.


Administration of the compositions can be effected in one dose, continuously or intermittently throughout the course of treatment. Methods of determining the most effective means and dosage of administration are known to those of skill in the art and will vary with the composition used for therapy, the purpose of the therapy and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician. Suitable dosage formulations and methods of administering the agents are known in the art. In a further aspect, the cells and composition of the disclosure can be administered in combination with other treatments.


The vectors, recombinant expression systems, and/or compositions are administered to the host using methods known in the art. This administration of the compositions of the disclosure can be done to generate an animal model of the desired disease, disorder, or condition for experimental and screening assays.


Briefly, pharmaceutical compositions of the present disclosure including but not limited to any one of the claimed compositions may comprise one or more vectors or recombinant expression systems as described herein, in combination with one or more pharmaceutically or physiologically acceptable carriers, diluents or excipients. Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; adjuvants (e.g., aluminum hydroxide); and preservatives. Compositions of the present disclosure may be formulated for oral, intravenous, topical, enteral, and/or parenteral administration. In certain embodiments, the compositions of the present disclosure are formulated for intravenous administration.


Pharmaceutical compositions of the present disclosure may be administered in a manner appropriate to the disease, disorder, or condition to be treated or prevented. The quantity and frequency of administration will be determined by such factors as the condition of the patient, and the type and severity of the patient's disease, although appropriate dosages may be determined by clinical trials.


Methods of Restoring Protein Expression


Aspects of the disclosure relate to methods of restoring protein expression.


For example, some aspects of the disclosure relate to a method for restoring expression of a protein comprising a point mutation in an RNA sequence encoding the protein in a subject in need thereof comprising administering a vector encoding one or more tRNA having an anticodon sequence that recognizes a codon comprising the point mutation to the subject, optionally wherein the point mutation results in a premature stop codon. In some embodiments, the point mutation results in a nonsense mutation having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the tRNA is an endogenous tRNA with a modified anticodon stem recognizing the codon comprising the point mutation. In further embodiments, the tRNA is charged with a serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In further embodiments, the vector further comprises a corresponding tRNA synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments involving an orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In further embodiments, the pyrrolysine is introduced in the diet of the subject. In some embodiments, the vector encodes two tRNA having an anticodon sequence that recognizes the codon comprising the point mutation. In some embodiments, the protein is dystrophin.


Other aspects relate to a recombinant expression system comprising one or more vectors encoding an ADAR based RNA editing system comprising one or more forward guide RNAs for the ADAR (“adRNAs”) and one or more corresponding reverse guide RNAs for the ADAR (“radRNAs”) to the subject, wherein the ADAR based RNA editing system specifically edits a point mutation in an RNA sequence encoding a protein. In some embodiments, the point mutation results in a nonsense mutation, optionally a premature stop codon, having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the ADAR based RNA editing system converts UAA to UIA and, optionally, further UIA to UM In some embodiments, the ADAR based RNA editing system converts UAA to UAI. In some embodiments, optionally those involving nonsense or missense mutations, the RNA targeted in mRNA. In further embodiments, the one or more vector further encodes a tRNA that targets an amber codon. In some embodiments, the protein is dystrophin. In some embodiments, the point mutation results in a splice site or missense mutation having the DNA sequence CAG and the RNA sequence CAG. In some embodiments, the ADAR based RNA editing system converts CAG to CIG. In some embodiments, optionally those involving splice site mutations, the RNA targeted is pre-mRNA. In some embodiments, the ADAR based editing system further comprises ADAR1, ADAR2, the E488Q and E100Q mutants each thereof, a fusion protein comprising the catalytic domain of an ADAR and a domain which associates with an RNA hairpin motif, a fusion protein comprising the catalytic domain of an ADAR and a dead Cas9, or a fusion protein comprising the double stranded binding domain of an ADAR and an APOBEC. In further embodiments, the domain which associates with an RNA hairpin motif is selected from the group of an MS2 bacteriophage coat protein (MCP) and an N22 peptide. In some embodiments, the adRNA comprises one or more RNA hairpin motifs. In some embodiments, the one or more RNA hairpin motifs are selected from the group of an MS2 stem loop and a BoxB loop and/or are stabilized by replacing A-U with G-C. In some embodiments, the adRNA is stabilized through the incorporation of one or more of 2′-O-methyl, 2′-O-methyl 3′phosphorothioate, or 2′-O-methyl 3′thioPACE at either or both termini of the adRNA.


In either case, the assessment of whether protein expression is “restored” is achieved through any means of protein quantification when compared to a baseline. The baseline may optionally be calculated based on a prior level in the subject or as the normal level in the population, adjusted for the subject's age, ethnicity, and other relevant demographic information. Techniques of quantifying protein expression are well known in the art and may, optionally, utilize a control or a threshold value for comparison to the baseline value. Methods known in the art for such studies include but are not limited to qRTPCR, ELISA, Western blot, protein immunostaining, spectroscopy and/or spectrometry based methods, and other assays typically conducted to determine the amount of protein expression in a sample from the subject. Alternatively, the “restoration” effect may be determined based on a clinical outcome. For example, aberrant dystrophin levels are linked to muscular dystrophy symptoms. Thus, the restoration of expression may be outwardly determined based on clinical signals such as a reduction or reversal of these symptoms. For dystrophin, improvement in muscle strength can be one such indicator. Thus, physicians may carry out strength measurements to determine outcome. Another example is ornithine transcarbamylase (OTC); aberrant OTC levels are a result of a rare X-linked genetic disorder resulting in excessive accumulation of ammonia in the blood (due to nitrogen accumulation). Thus, a relevant clinical outcome would be a decrease in ammonia in a biological sample, such as blood or urine. Similarly, clinical signals associated with and expression of proteins downstream of the protein of interest may be relevant indicators of “restoration” where the protein of interest is involved in a particular pathway.


Methods of Treatment


Point mutations are implicated in a number of diseases, disorders, and conditions. Non-limiting examples are provided in Table 1 below.










TABLE 1





Protein/Disease, Disorder, or Condition
Associated Point Mutation















G to A point mutations or premature stop codons











Dihydropyrimidine dehydrogenase deficiency
NM_000110.3(DPYD):c.1905 + 1G > A


Noonan syndrome
NM_005633.3(SOS1):c.2536G > A (p.Glu846Lys)


Lynch syndrome
NM_000251.2(MSH2):c.212-1G > A


Breast-ovarian cancer, familial 1
NM_007294.3(BRCA1):c.963G > A (p.Trp321Ter)


Cystic fibrosis
NM_000492.3(CFTR):c.57G > A (p.Trp19Ter)


Anemia, due to G6PD deficiency
NM_000402.4(G6PD):c.292G > A (p.Va198Met)


AVPR2 Nephrogenic diabetes insipidus, X-linked
NM_000054.4(AVPR2):c.878G > A (p.Trp293Ter)


FANCC Fanconi anemia, complementation group C
NM_000054.4(AVPR2):c.878G > A (p.Trp293Ter)


FANCC Fanconi anemia, complementation group C
NM_000136.2(FANCC):c.1517G > A (p.Trp506Ter)


IL2RG X-linked severe combined
NM_000206.2(IL2RG):c.710G > A (p.Trp237Ter)


immunodeficiency



F8 Hereditary factor VIII deficiency disease
NM_000132.3(F8):c.3144G > A (p.Trp1048Ter)


LDLR Familial hypercholesterolemia
NM_000527.4(LDLR):c.1449G > A (p.Trp483Ter)


CBS Homocystinuria due to CBS deficiency
NM_000071.2(CBS):c.162G > A (p.Trp54Ter)


HBB betaThalassemia
NM_000518.4(HBB):c.114G > A (p.Trp38Ter)


ALDOB Hereditary fructosuria
NM_000035.3(ALDOB):c.888G > A (p.Trp296Ter)


DMD Duchenne muscular dystrophy
NM_004006.2(DMD):c.3747G > A (p.Trp1249Ter)


SMAD4 Juvenile polyposis syndrome
NM_005359.5(SMAD4):c.906G > A (p.Trp302Ter)


BRCA2 Familial cancer of breast|Breast-ovarian
NM_000059.3(BRCA2):c.582G > A (p.Trp194Ter)


cancer, familial 2



GRIN2A Epilepsy, focal, with speech disorder and
NM_000833.4(GRIN2A):c.3813G > A (p.Trp1271Ter)


with or without mental retardation



SCN9A Indifference to pain, congenital, autosomal
NM_002977.3(SCN9A):c.2691G > A (p.Trp897Ter)


recessive



TARDBP Amyotrophic lateral sclerosis type 10
NM_007375.3(TARDBP):c.943G > A (p.Ala315Thr)


CFTR Cystic fibrosis|Hereditary pancreatitis|not
NM_000492.3(CFTR):c.3846G > A (p.Trp1282Ter)


provided|ataluren response - Efficacy



UBE3A Angelman syndrome
NM_130838.1(UBE3A):c.2304G > A (p.Trp768Ter)


SMPD1 Niemann-Pick disease, type A
NM_000543.4(SMPD1):c.168G > A (p.Trp56Ter)


USH2A Usher syndrome, type 2A
NM_206933.2(USH2A):c.9390G > A (p.Trp3130Ter)


MEN1 Hereditary cancer-predisposing syndrome
NM_130799.2(MEN1):c.1269G > A (p.Trp423Ter)


C8orf37 Retinitis pigmentosa 64
NM_177965.3(C8orf37):c.555G > A (p.Trp185Ter)


MLH1 Lynch syndrome
NM_000249.3(MLH1):c.1998G > A (p.Trp666Ter)


TSC2 Tuberous sclerosis 2|Tuberous sclerosis
NM_000548.4(TSC2):c.2108G > A (p.Trp703Ter)


syndrome 46



NF1 Neurofibromatosis, type 1
NM_000267.3(NF1):c.7044G > A (p.Trp2348Ter)


MSH6 Lynch syndrome
NM_000179.2(MSH6):c.3020G > A (p.Trp1007Ter)


SMN1 Spinal muscular atrophy, type II|Kugelberg-
NM_000344.3(SMN1):c.305G > A (p.Trp102Ter)


Welander disease



SH3TC2 Charcot-Marie-Tooth disease, type 4C
NM_024577.3(SH3TC2):c.920G > A (p.Trp307Ter)


DNAH5 Primary ciliary dyskinesia
NM_001369.2(DNAH5):c.8465G > A (p.Trp2822Ter)


MECP2 Rett syndrome
NM_004992.3(MECP2):c.311G > A (p.Trp104Ter)


ADGRV1 Usher syndrome, type 2C
NM_032119.3(ADGRV1):c.7406G > A



(p.Trp2469Ter)


AHI1 Joubert syndrome 3
NM_017651.4(AHI1):c.2174G > A (p.Trp725Ter)


PRKN Parkinson disease 2
NM_004562.2(PRKN):c.1358G > A (p.Trp453Ter)


COL3A1 Ehlers-Danlos syndrome, type 4
NM_000090.3(COL3A1):c.3833G > A (p.Trp1278Ter)


BRCA1 Familial cancer of breast|Breast-ovarian
NM_007294.3(BRCA1):c.5511G > A (p.Trp1837Ter)


cancer, familial 1



MYBPC3 Primary familial hypertrophic
NM_000256.3(MYBPC3):c.3293G > A


cardiomyopathy
(p.Trp1098Ter)


APC Familial adenomatous polyposis 1
NM_000038.5(APC):c.1262G > A (p.Trp421Ter)


BMPR2 Primary pulmonary hypertension
NM_001204.6(BMPR2):c.893G > A (p.W298*)










T to C point mutations











Wilson disease
NM_000053.3(ATP7B):c.3443T > C (p.Ile1148Thr)


Leukodystrophy, hypomyelinating, 2
NM_020435.3(GJC2):c.857T > C (p.Met286Thr)


Alport syndrome, X-linked recessive
NM_000495.4(COL4A5):c.438 + 2T > C


Leigh disease
NC_012920.1:m.9478T > C


Gaucher disease, type 1
NM_001005741.2(GBA):c.751T > C (p.Tyr251His)


Renal dysplasia, retinal pigmentary dystrophy,
NM_014714.3(IFT140):c.4078T > C (p.Cys1360Arg)


cerebellar ataxia and skeletal dysplasia



Marfan syndrome
NM_000138.4(FBN1):c.3793T > C (p.Cys1265Arg)


Deficiency of UDPglucose-hexose-1-phosphate
NM_000155.3(GALT):c.482T > C (p.Leu161Pro)


uridylyltransferase



Familial hypercholesterolemia
NM_000527.4(LDLR):c.694 + 2T > C


Episodic pain syndrome, familial, 3
NM_001287223.1(SCN11A):c.1142T > C



(p.Ile381Thr)


Navajo neurohepatopathy
NM_002437.4(MPV17):c.186 + 2T > C


Congenital muscular dystrophy, LMNA-related
NM_170707.3(LMNA):c.1139T > C (p.Leu380Ser)


Hereditary factor VIII deficiency disease
NM_000132.3(F8):c.5372T > C (p.Met1791Thr)


Insulin-dependent diabetes mellitus secretory
NM_014009.3(FOXP3):c.970T > C (p.Phe324Leu)


diarrhea syndrome



Hereditary factor IX deficiency disease
NM_000133.3(F9):c.1328T > C (p.Ile443Thr)


Familial cancer of breast, Breast-ovarian cancer,
NM_000059.3(BRCA2):c.316 + 2T > C


familial 2, Hereditary cancerpredisposing syndrome



Cardiac arrhythmia
NM_000238.3(KCNH2):c.1945 + 6T > C


Tangier disease
NM_005502.3(ABCA1):c.4429T > C (p.Cys1477Arg)


Dilated cardiomyopathy 1AA
NM_001103.3(ACTN2):c.683T > C (p.Met228Thr)


Mental retardation 3, X-linked
NM_005334.2(HCFC1):c.-970T > C


Limb-girdle muscular dystrophy, type 2B
NM_003494.3(DYSF):c.1284 + 2T > C


Macular dystrophy, vitelliform, 5
NM_016247.3(IMPG2):c.370T > C (p.Phe124Leu)


Retinitis pigmentosa
NM_000322.4(PRPH2):c.736T > C (p.Trp246Arg)









Further non-limiting examples include Ornithine Transcarbamylase Deficiency, Nougaret night blindness, Usher syndrome, Atrial Fibrillation, Duchenne Muscular Dystrophy, Wilson disease, hereditary tyrosinemia, and some cancers carrying a A→G mutation in genes such as B-catenin.


Thus, aspects of this disclosure relate to the treatment of certain diseases, disorders, and conditions involving point mutations.


For example, some method aspects relate to a treating a disease, disorder, or condition characterized by the presence of a point mutation in an RNA sequence encoding a protein associated with the disease, disorder, or condition in a subject in need thereof comprising administering a vector encoding one or more tRNA having an anticodon sequence that recognizes a codon comprising the point mutation to the subject, optionally wherein the point mutation results in a premature stop codon. In some embodiments, the point mutation results in a nonsense mutation having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the tRNA is an endogenous tRNA with a modified anticodon stem recognizing the codon comprising the point mutation. In further embodiments, the tRNA is charged with a serine. In some embodiments, the tRNA is an orthogonal tRNA charged with a non-canonical amino acid. In further embodiments, the vector further comprises a corresponding tRNA synthetase. In some embodiments, the corresponding synthetase is E. coli Glutaminyl-tRNA synthetase. In some embodiments involving an orthogonal tRNA, the non-canonical amino acid is pyrrolysine. In further embodiments, the pyrrolysine is introduced in the diet of the subject. In some embodiments, the vector encodes two tRNA having an anticodon sequence that recognizes the codon comprising the point mutation. In some embodiments, the disease, disorder, or condition is selected from the group consisting of the diseases, disorders, and conditions listed in Table 1, optionally characterized by the presence of a nonsense mutation and/or a premature stop codon. In some embodiments, the protein is dystrophin. In further embodiments, the disease, disorder, or condition is muscular dystrophy. In still further embodiments, the disease disorder or condition is Duchenne muscular dystrophy.


Additional method aspects relate to a method of treating a disease, disorder, or condition by the presence of a point mutation in an RNA sequence encoding a protein associated with the disease, disorder, or condition in a subject in need thereof comprising administering one or more vectors encoding an ADAR based RNA editing system comprising one or more forward guide RNAs for the ADAR (“adRNAs”) and one or more corresponding reverse guide RNAs for the ADAR (“radRNAs”) to the subject, wherein the ADAR based RNA editing system specifically edits the point mutation. In some embodiments, the point mutation results in a nonsense mutation, optionally a premature stop codon, having the DNA sequence TAA and the RNA sequence UAA. In some embodiments, the ADAR based RNA editing system converts UAA to UIA and, optionally, further UIA to UII. In some embodiments, the ADAR based RNA editing system converts UAA to UAI. In some embodiments, optionally those involving nonsense or missense mutations, the RNA targeted in mRNA. In further embodiments, the one or more vector further encodes a tRNA that targets an amber codon. In some embodiments, the protein is dystrophin. In some embodiments, the point mutation results in a splice site or missense mutation having the DNA sequence CAG and the RNA sequence CAG. In some embodiments, the ADAR based RNA editing system converts CAG to CIG. In some embodiments, optionally those involving splice site mutations, the RNA targeted is pre-mRNA. In some embodiments, the ADAR based editing system further comprises ADAR1, ADAR2, the E488Q and E100Q mutants each thereof, a fusion protein comprising the catalytic domain of an ADAR and a domain which associates with an RNA hairpin motif, a fusion protein comprising the catalytic domain of an ADAR and a dead Cas9, or a fusion protein comprising the double stranded binding domain of an ADAR and an APOBEC. In further embodiments, the domain which associates with an RNA hairpin motif is selected from the group of an MS2 bacteriophage coat protein (MCP) and an N22 peptide. In some embodiments, the method further comprises administering an effective amount of an interferon to enhance endogenous ADAR1 expression. In still further embodiments, the interferon is interferon α. In some embodiments, the adRNA comprises one or more RNA hairpin motifs. In some embodiments, the one or more RNA hairpin motifs are selected from the group of an MS2 stem loop and a BoxB loop and/or are stabilized by replacing A-U with G-C. In some embodiments, the adRNA is stabilized through the incorporation of one or more of 2′-O-methyl, 2′-O-methyl 3′phosphorothioate, or 2′-O-methyl 3′thioPACE at either or both termini of the adRNA. In some embodiments, the disease, disorder, or condition is selected from the group consisting of the diseases, disorders, and conditions listed in Table 1. In further embodiments, the protein is dystrophin and the disease, disorder, or condition is muscular dystrophy. In still further embodiments, the disease disorder or condition is Duchenne muscular dystrophy.


An ordinary skilled artisan will appreciate that the doses and route of administration employed in these methods may vary based on the subject and the disease, disorder, or condition to be treated. Based on knowledge in the art such suitable doses and routes may be selected based on the subject's age, ethnicity, and other relevant demographic factors.


Kits


In one particular aspect, the present disclosure provides kits for performing any of the methods disclosed herein as well as instructions for carrying out the methods of the present disclosure and/or administering the vectors, recombinant expression systems, and compositions disclosed herein.


The kit can also comprise agents necessary for the preservation of those components comprised therein, e.g., a buffering agent, a preservative or a protein-stabilizing agent. The kit can further comprise components necessary for detecting the detectable-label, e.g., an enzyme or a substrate. The kit can also contain a control sample or a series of control samples, which can be assayed and compared to the test sample. Each component of the kit can be enclosed within an individual container and all of the various containers can be within a single package, along with instructions for interpreting the results of the assays performed using the kit. The kits of the present disclosure may contain a written product on or in the kit container. The written product describes how to use the reagents contained in the kit.


As amenable, these suggested kit components can be packaged in a manner customary for use by those of skill in the art. For example, these suggested kit components may be provided in solution or as a liquid dispersion or the like.


EXAMPLES

The following examples are non-limiting and illustrative of procedures which can be used in various instances in carrying the disclosure into effect. Additionally, all reference disclosed herein are incorporated by reference in their entirety.


Example 1—Design of tRNA Constructs

The tRNA constructs were designed along the lines of the schematics in FIG. 1 to recognize the nonsense mutation TAA. Both modified endogenous and orthogonal tRNA were generated. The constructs were validated in vitro using a GFP harboring nonsense mutation. It was determined that two copies of the tRNA should be include in each AAV vector for both modified endogenous and orthogonal tRNAs. MbPyl sythetase was selected for use with the orthogonal tRNA. The AAV vectors were generated comprising the tRNA and GFP (as well as the synthetase, where orthogonal tRNA was used). The sequences used in these constructs are provided in the Sequence Listing above.


Example 2—Restoration of Full Length Dystrophin in Mdx Mice

The anticodon stem of the human serine tRNA is modified such that it recognizes the nonsense codon (TAA). No endogenous tRNA can recognize a stop codon and translation terminates when the ribosome reaches a stop codon. Mdx mice bear a nonsense mutation (TAA) in the gene coding for dystrophin as a result of which they lack full length dystrophin expression. AAVs are used to deliver two copies of the modified tRNAs into the mouse muscle which in turn allows for the stop codon read-through enabling the expression of full length dystrophin.


The calf muscles of mdx mice were injected with 1E12 particles of AAV8 carrying 2 copies of the modified serine tRNA and a GFP gene. These mice were then sacrificed after a month and the calf muscles were harvested. The muscles were sectioned and stained with an antibody against dystrophin. A clear restoration of dystrophin expression was noticed. In addition, the muscle morphology improved too.


Applicants have, thus, demonstrated activity of our vectors in vitro using a GFP gene harboring a stop codon. In addition Applicants have demonstrated restoration of dystrophin expression in mdx mouse muscles. Within a span of one month after injecting the mdx mice with AAVs carrying two copies of the serine tRNA, Applicants observed restoration of dystrophin expression in the calf muscle via Immunohistochemistry. Applicants also noted an improved muscle morphology.


This experiment is repeated with the orthogonal tRNA, introducing the pyrrolysine through the mouse feed, and is again replicated with both tRNAs in a larger population of mice.


Example 3—Diet Regulable Production of Therapeutic Proteins

Applicants aim at achieving on-demand, in vivo production of therapeutics such as (i) insulin; (ii) neutralizing antibodies for viruses (e.g. HIV, HCV, HPV, influenza) and bacteria (e.g. Staph aureus; drug resistant strains) by the skeletal muscle.


The desired transgenes are delivered to the muscle via AAVs (or lentiviruses) along with an orthogonal tRNA/tRNA synthetase pair. These transgenes contain a premature termination codon (stop codon) that will prevent the full length protein from being expressed. For an on demand synthesis of the therapeutics, an appropriate unnatural amino acid is consumed in the diet, which in turn is incorporated by the orthogonal tRNA/tRNA synthetase at the premature termination site, enabling synthesis of the desired therapeutics.


Example 4—ADAR2 Based RNA Editing

Applicants suspected that ADAR2 (adenosine deaminase that acts on RNA) to correct mutations at the mRNA level. Applicants used Adeno-Associated Viruses to deliver the ADAR2 and a adRNA (forward ADAR2 guide) or radRNA (reverse ADAR2 guide) that direct the enzyme to the mutation in an attempt to restore the expression of dystrophin in the mdx mouse models of DMD, by editing the nonsense mutation. Applicants also applied this technology to the mouse model of the metabolic disorder Ornithine Transcarbamylase (OTC) deficiency.


As compared to nucleases, ADARs make site specific Adenosine to Inosine (A→I) changes in the mRNA with Inosine being read as a Guanosine (G) during translation and are thereby safe from creating permanent off target effects. Also, since they make edits at the mRNA level, the altered proteins are expressed only transiently. The use of nucleases in adult OTC-deficient mice led to large deletions that proved to be lethal to the animals. The use of ADARs might circumvent this problem. This could be a readily translatable solution for several disorders characterized by point mutations. In addition, the origin of the ADAR2 is human, thereby minimizing the immune response generated by the body against it. Applicants also combine the idea of tRNA suppression with ADAR2 based RNA editing. In addition, Applicants designed hairpin loops (3′ overlap) and toe-holds (5′ overlap) that help improve the specificity of the adRNA/radRNA. Applicants also go on to optimize the lengths of the adRNA for efficient A→I editing as well as the ADAR2 recruiting domain of the adRNA/radRNA.


Existing studies have made use of nucleases such as Cas9 to delete the mutated region of the Dystrophin/OTC genes and replaced it with a functional copy, for the treatment of DMD or OTC deficiency caused by a point mutation. For DMD, existing therapies include the use of corticosteroids that delay the symptoms of the disorder. Other strategies include the premature stop codon read-through by making use of drugs such as Ataluren or Gentamycin. Another strategy is that of exon skipping which results in a truncated protein, however able to reduce the severity of the DMD phenotype. Another approach is the delivery of a u-dystrophin gene. Clinical trials for OTC deficiency have been attempted making use of adenoviral vectors to deliver OTC cDNA in patients. Other avenues for treatment include use of sodium phenylbutyrate which helps increase the waste nitrogen excretion.


The use of ADAR2 as an engineered RNA editing enzyme has been demonstrated only in vitro.


Applicants utilized adRNAs and radRNAs comprised of two domains, one complementary to the target sequence and the other an ADAR2 recruiting domain. Applicants utilized AAVs to deliver these adRNAs/radRNAs along with the ADAR2 enzyme. Mdx mice bear a nonsense mutation (TAA) in the gene coding for dystrophin. Applicants packaged two copies of the adRNAs/radRNAs or a combination of adRNA/radRNA+tRNA along with the ADAR2 enzyme into the AAV and deliver it into the Tibialis Anterior (TA) muscle. Applicants utilized three alternative strategies to restore dystrophin expression:


(1) adRNAs/radRNAs that can edit both the adenosines in the ‘TAA’ to inosines;


(2) a sequential approach whereby the first adRNA/radRNA converts TAA→TGA and the next adRNA/radRNA converts it to TGG, restoring expression; and


(3) a combination of adRNAs/radRNAs and a tRNA whereby the adRNA/radRNA converts the TAA into TAG and the tRNA suppression of the amber codon (TAG) restores dystrophin expression.


Applicants also delivered two copies of the adRNA targeting the OTC G→A mutation in spf-ash mice along with the ADAR2 to the liver via retro-orbital injections.


The system works by editing an Adenosine to Inosine which is read as a Guanosine during translation. This can be used to correct point mutations as well as restore expression by editing premature stop codons. In FIG. 6: A. An Amber stop codon can be converted to a tryptophan codon by a single edit. B. Ochre stop codon—both edits made in a single step. C. Ochre stop codon—Sequential editing. D. Ochre stop codon—ADAR2 editing in combination with suppressor tRNA.


The following 10 steps represent the workflow to test these constructs:

    • 1. Design and clone ADAR2 constructs—adRNA and radRNA.
    • 2. In vitro validation of constructs using a GFP harboring a nonsense mutation.
    • 3. Modification of constructs—decision to clone two copies of the adRNA/radRNA. Creation of vectors harboring one copy of a adRNA/radRNA and a copy of a serine suppressor tRNA.
    • 4. Generation of AAV8 vectors carrying ADAR2 and adRNAs/radRNAs or suppressor tRNAs.
    • 6. TA/Gastrocnemius injections of mdx mice—1E12 particles of AAV8 carrying the ADAR2 and with adRNAs/radRNAs or suppressor tRNA were injected.
    • 7. The mice were sacrificed 6 weeks after injections and the TA/gastrocnemimus were harvested. Immunohistochemistry performed to detect dystrophin. Some evidence of restoration of dystrophin.
    • 8. qPCR, Western blots and NGS were carried out.
    • 9. Vectors were optimized to improve efficiency. adRNA lengths varied, location of the edit varied.
    • 10. Steps 4-8 repeated with optimized vectors.


Applicants designed adRNA and radRNAs against a premature stop codon in GFP and demonstrated robust restoration of expression (FIG. 5). For the ochre stop codon (TAA), two A→G edits are needed to restore expression. Applicants constructed a single ad/radRNA targeting both As or a two ad/radRNAs that target a single A in a sequential manner. Applicants also constructed an adRNA/radRNA+suppressor tRNA vector combining RNA editing with tRNA suppression.


In vitro RNA editing showed robust restoration of GFP expression after which AAVs bearing the ADAR2 and adRNA/radRNAs were generated to target the nonsense mutation in dystrophin in mdx mice.


The Tibialis Anterior (TA) or gastrocnemius muscles of mdx mice were injected with 1E12 particles of AAV8 carrying ADAR2 and two copies of the adRNA/radRNA or one copy of the adRNA/radRNA and a suppressor tRNA. These mice were sacrificed after 6 weeks and the appropriate muscles were harvested. The muscles were sectioned and stained with an antibody against dystrophin. Partial restoration of dystrophin expression was noticed.


In general, Applicants noticed a fractional restoration of dystrophin expression via Immunostaining. However, western blots and NGS did not show any evidence of editing/restoration of dystrophin expression.


Potential applications of the system include targeting point mutations for the treatment of disorders such as but not restricted to DMD, OTC deficiency, Wilson's disease and hereditary tysosinemia type 1. It could also be used to create alternate start codons, enabling the co-existence of a protein and its N-terminal truncated form.


Example 5—ADAR Editing in Mouse Models

Genome engineering methodologies coupled with rapidly advancing synthetic biology toolsets are enabling powerful capabilities to perturb genomes for deciphering function, programming novel function, and repairing aberrant function. In particular, programmable DNA nucleases, such as meganucleases, zinc finger nucleases (ZFNs), transcription activator-like effector nucleases (TALENs), and CRISPR-Cas, have been widely used to engineer genomes across a range of organisms. Their use in gene therapy however poses at least three major challenges: one, the efficiency of homologous recombination versus non-homologous end joining is typically low, particularly in post-mitotic cells that comprise the vast majority of the adult body; two, an active nuclease always poses the threat of introducing permanent off-target mutations, thus presenting formidable challenges in both engineering exquisite nuclease specificity without compromising activity, as well as ensuring tight regulation of the nuclease dose and duration in target cells; and three, prevalent programmable nucleases are of prokaryotic origin or bear domains that are of non-human origin raising a significant risk of immunogenicity in in vivo therapeutic applications. The recent advent of base editing approaches is opening an exciting alternative strategy for gene targeting, but demonstrated approaches rely on CRISPR-Cas systems that are of prokaryotic origin. Thus for genomic mutations that lead to alteration in protein function, such as in disease causing gene mutations, approaches to instead directly target RNA would be highly desirable. Leveraging the aspect that single-stranded RNA as compared to double-stranded DNA, is generally more accessible to oligonucleotide mediated targeting without a need for additional enabling proteins, and building on the advances in tRNA mediated codon suppression and genetic code expansion, as well as adenosine deaminase mediated RNA editing, Applicants have engineered and optimized an integrated platform for RNA targeting, and demonstrate its efficacy in in vitro and in vivo applications.


Vector Design and Construction


To construct the GFP reporters—GFP-Amber, GFP-Ochre and GFP-Opal, three gene blocks were synthesized with ‘TAG’, ‘TAA’ and ‘TGA’ respectively replacing the Y39 residue of the wild type GFP and were cloned downstream of a CAG promoter. One, two, or four copies of the endogenous suppressor tRNAs were cloned into an AAV vector containing a human U6 and mouse U6 promoter. Pyrrolysyl tRNAs and adRNAs/radRNAs were similarly cloned into an AAV vector containing a human U6 and mouse U6 promoter along with a CMV promoter driving the expression of MbPylRS/MmPylRS/AcKRS or hADAR2 respectively.


Mammalian Cell Culture and Transfection


All HEK 293T cells were grown in Dulbecco's Modified Eagle Medium supplemented with 10% FBS and 1% Antibiotic-Antimycotic (Thermo Fisher) in an incubator at 37° C. and 5% CO2 atmosphere. All in vitro transfection experiments were carried out in HEK 293T cells using the commercial transfection reagent Lipofectamine 2000 (Thermo Fisher). All in vitro suppression and editing experiments were carried out in 24 well plates using 500 ng of reporter plasmid and 1000 ng of the suppressor tRNA/aaRS plasmid or the adRNA/ADAR2 plasmid. Cells were transfected at 30% confluence. Cells were harvested 48 and 72 hours post transfection for quantification of suppression and editing respectively. The UAAs Nε-Boc-L-Lysine (Chemimpex) and NE-Acetyl-L-Lysine (Sigma) were added to the media at the desired concentration before transfection.


Production of AAV Vectors


Virus was prepared using the protocol from the Gene Transfer, Targeting and Therapeutics (GT3) core at the Salk Institute of Biological Studies (La Jolla, Calif.). AAV8 particles were produced using HEK 293T cells via the triple transfection method and purified via an iodixanol gradient. Confluency at transfection was about 80%. Two hours prior to transfection, DMEM supplemented with 10% FBS was added to the HEK 293T cells. Each virus was produced in 5×15 cm plates, where each plate was transfected with 7.5 ug of pXR-8, 7.5 of ug recombinant transfer vector, 7.5 ug of pHelper vector using PEI (1 ug/uL linear PEI in 1×DPBS pH 4.5, using HCl) at a PEI:DNA mass ratio of 4:1. The mixture was incubated for 10 minutes at RT and then applied dropwise onto the cell media. The virus was harvested after 72 hours and purified using an iodixanol density gradient ultracentrifugation method. The virus was then dialyzed with 1×PBS (pH 7.2) supplemented with 50 mM NaCl and 0.0001% of Pluronic F68 (Thermo Fisher) using 50 kDA filters (Millipore), to a final volume of ˜1 mL and quantified by qPCR using primers specific to the ITR region, against a standard (ATCC VR-1616).











AAV-ITR-F:



(SEQ ID NO: 158)




5′-CGGCCTCAGTGAGCGA-3′




and







AAV-ITR-R:



(SEQ ID NO: 159)




5′-GGAACCCCTAGTGATGGAGTT-3′.







RNA Isolation and Next Generation Sequencing Library Preparation


RNA from gastrocnemius or TA muscles of mdx mice or livers of spfash mice was extracted using the RNeasy Plus Universal Mini Kit (Qiagen), according to the manufacturer's protocol. Next generation sequencing libraries were prepared as follows. cDNA was synthesized using the Protoscript II First Strand cDNA synthesis Kit (New England Biolabs). Briefly, 500 ng of input cDNA was amplified by PCR with primers that amplify 150 bp surrounding the sites of interest using KAPA Hifi HotStart PCR Mix (Kapa Biosystems). PCR products were gel purified (Qiagen Gel Extraction kit), and further purified (Qiagen PCR Purification Kit) to eliminate byproducts. Library construction was done with NEBNext Multiplex Oligos for Illumina kit (NEB). 10 ng of input DNA was amplified with indexing primers. Samples were then pooled and loaded on an Illumina Miseq (150 single-end run) at 5 nM concentrations. Data analysis was performed using CRISPResso.


Animal Experiments


AAV Injections: All animal procedures were performed in accordance with protocols approved by the Institutional Animal Care and Use Committee (IACUC) of the University of California, San Diego. All mice were acquired from Jackson labs. AAVs were injected into the gastrocnemius or TA muscle of mdx mice (6-10 weeks old) using 2.5 E+12 vg/muscle. AAVs were injected into spfash (10-12 weeks old) mice via retro-orbital injections using 3 E+12 vg/mouse.


UAA administration: Mice were fed water containing 20 mg/ml Nε-Boc-L-Lysine (Chemimpex) for one month. Mice were also administered the 30 mg Nε-Boc-L-Lysine via IP injections, thrice a week.


Immunofluorescence


Harvested gastrocnemius or TA muscles were placed in molds containing OCT compound (VWR) and flash frozen in liquid nitrogen. 20 μm sections were cut onto pre-treated histological slides. Slides were fixed using 4% Paraformaldehyde. Dystrophin was detected with a rabbit polyclonal antibody against the N-terminal domain of dystrophin (1:100, Abcam 15277) followed by a donkey anti-rabbit Alexa 546 secondary antibody (1:250, Thermo Fisher).


Statistical Analysis


All statistical analyses were performed using the software Graphpad Prism and p-values were computed by unpaired two-tailed t tests.


Results


Applicants focused first on establishing the system for targeting nonsense mutations. This was motivated by the fact that nonsense mutations are responsible for 11% of all described gene lesions causing inheritable human disease, and close to 20% of disease-associated single base substitutions that affect the coding regions of genes. Specifically, we explored two independent but complementary approaches to directly target nonsense mutations. First, Applicants focused on engineering robust nonsense codon suppression via suppressor tRNAs. Although the use of suppressor tRNAs for premature stop codon read-through of endogenous non-sense mutations has been attempted in vivo in mice, these prior studies relied only on plasmid delivery and the use of robust and optimized delivery formats was not explored. Additionally, the potential use of un-natural amino acid (UAA) based inducible in vivo suppression of a disease-causing endogenous nonsense mutation has not been explored either. Towards this, Applicants first modified the anticodon stems of serine, arginine and leucine tRNAs to create suppressor tRNAs targeting all three stop codons, amber, opal and ochre, and evaluated these constructs in cells using GFP reporters harboring corresponding nonsense mutations. Among these, the serine suppressor tRNA demonstrated the most consistent and robust results (FIG. 16A, FIG. 18A). To also engineer UAA mediated inducible codon suppression, we next utilized the pyrrolysyl-tRNA/aminoacyl tRNA synthetase (aaRS) pair from Methanosarcina barkeri (MbPylRS)32,33 and cloned it into AAV vectors. This enabled programmable incorporation of UAAs at a stop codon. Notably, Applicants found that adding a second copy of the tRNA into the expression vector significantly boosted suppression efficiencies (FIG. 18B). Applicants further systematically evaluated additional aminoacyl tRNA synthetases from Methanosarcina mazei (MmPylRS)34 and an NE-acetyl-lysyl-tRNA synthetase (AcKRS), and also explored varying the number of tRNAs copies per vector to up to four (FIG. 18B).


As suppressor tRNA based approaches can lead to the read-through of other non-target stop codons, concurrently Applicants also engineered a system for sequence-specific targeted RNA editing via adenosine deaminase enzymes. Specifically, adenosine to inosine (A to I) editing is a common post-transcriptional modification in RNA, catalyzed by adenosine deaminases acting on RNA (ADARs). Inosine is a deaminated form of adenosine and is biochemically recognized as guanine. Recently, multiple studies have demonstrated the engineering of ADAR2 mediated targeting in vitro, and a study also demonstrated correction of the nonsense mutation in CFTR in Xenopus oocytes. Building on this, Applicants engineered here a system for sequence-specific targeted RNA editing in vitro and in vivo, utilizing the human ADAR2 enzyme and an associated ADAR2 guide RNA (adRNAs) engineered from its naturally occurring substrate GluR2 pre-mRNA. This ADAR2 guiding RNA comprises an ADAR-recruiting domain and a programmable antisense region that is complementary to a specified target RNA sequence. Applicants first evaluated the RNA editing efficiency of this system in vitro by co-transfecting the constructs with GFP reporters harboring a non-sense amber or ochre mutation at Y39. Specifically, Applicants utilized two editing approaches to engineer the editing of both adenosines in the ochre stop codon: a one-step mechanism where both the adenosines are edited simultaneously or a two-step mechanism wherein editing takes place sequentially. In addition, we also explored the possibility of conversion of an ochre codon to an amber codon followed by amber suppression to restore GFP expression. All three approaches enabled restoration of GFP expression (FIG. 16C, FIG. 19A). Applicants next constructed AAV vectors to deliver the adRNA or a reverse oriented adRNA (radRNA) along with the ADAR2 enzyme. Similar to tRNA mediated codon suppression, addition of a second copy of the adRNA/radRNA significantly improved the targeting efficiency (FIG. 19D). Applicants further systematically evaluated modified ADAR recruiting domains, and a range of RNA targeting antisense designs of varying lengths and the number of nucleotides intervening the target A and the R/G motif of the adRNA26, yielding a panel of efficient adRNA designs (FIG. 19B-C).


Based on the above in vitro optimizations, Applicants next tested the system for in vivo RNA targeting. Applicants focused first on the mdx mouse model for Duchenne muscular dystrophy (DMD)35 which bears an ochre stop site in exon 23 of the dystrophin gene. Recent studies utilizing the CRISPR-Cas9 system have shown promising results in the prevention38 and partial functional recovery of DMD by making changes in exon 23 at the DNA level in the mdx mouse. We thus concurrently evaluated three approaches (FIG. 17A): one, suppressor tRNAs derived from modified endogenous tRNAs or pyrrolysyl tRNAs for nonsense codon suppression; two, ADAR2 based correction of the nonsense mutation; and, three, CRISPR-Cas9 based genome targeting to benchmark the RNA targeting approaches.


Corresponding, Applicants first designed an AAV carrying two copies of the serine suppressor tRNA targeting the ochre stop codon, and the tibalis anterior (TA) or gastrocnemius of mdx mice were injected with the same. Mice muscles were harvested after 2, 4, and 8 weeks. Progressively improved restoration of dystrophin expression was seen over time, with the mice harvested after 8 weeks showing the greatest degree of restoration (FIG. 17B, FIG. 20A). In addition, neuronal nitric oxide synthase (nNOS) activity was restored at the sarcolemma which is absent in mdx mice due to the absence of the nNOS binding site in the mutant dystrophin protein (FIG. 17B). To further make the system inducible, a vector carrying two copies of the pyrrolysyl-tRNA targeting the ochre stop codon and MbPylRS was also constructed and injected into the TA or gastrocnemius of mdx mice, and the mice were divided into two groups: one that was administered the pyrrolysine UAA and a control group that was not. Expectedly only mice that were provided the UAA showed nNOS localization at the sarcolemma (FIG. 20B), and restoration of dystrophin expression (FIG. 20C).


Next, Applicants evaluated the ADAR2 based site-specific RNA editing approach in this mouse model. To test the efficiency of this system in editing both adenosines in the ochre stop codon in mdx DMD mRNA, Applicants first optimized the constructs in vitro with a reporter plasmid bearing a fragment of the mdx DMD mRNA in HEK293T cells. Sanger sequencing and NGS analysis confirmed successful targeting (FIG. 21A). Applicants next packaged the optimized constructs into AAV8, and injected the tibialis anterior (TA) or gastrocnemius of mdx mice. Eight weeks post injection, TA and gastrocnemius muscles were collected from mdx mice, wild type mice, and mice treated with adRNA targeting and non-targeting controls. IHC revealed clear restoration of dystrophin expression (FIG. 17B). In addition, nNOS activity was also restored at the sarcolemma (FIG. 17B). RNA editing rates (TAA→TGG/TAG/TGA) of 0.5-0.7% were observed in treated mice (FIG. 17C, FIG. 21B). Applicants also note that the mdx mice showed no mRNA with a TAA→TGG change while the treated mice showed up to 0.42% TAA→TGG edited mRNA. Applicants note that corresponding DNA editing rates via CRISPR-Cas9 in published in vivo targeting studies were about 2%39. To further benchmark the tRiAD approach, we thus also targeted the mdx mice via CRISPR based genome editing of the nonsense mutation. Applicants injected vectors bearing dual-gRNAs to excise exon 23 codon, and expectedly, this led to restoration of dystrophin expression in a subset of the muscle cells (FIG. 17B).


Finally, we also evaluated the ADAR2 mediated RNA editing approach in an independent mouse model of human disease. Specifically, we focused on the male sparse fur ash (spfash) mouse model of ornithine transcarbamylase (OTC) deficiency. The spfash mice have a G→A point mutation in the last nucleotide of the fourth exon of the OTC gene, which leads to OTC mRNA deficiency and production of mutant protein43. Recent studies have demonstrated the use of CRISPR-Cas9 and homologous recombination based strategies for robust correction of this mutation in neonatal mice. However, gene correction via homology-directed repair (HDR) in adult mice was inefficient and led to genomic deletions which proved to be lethal as they compromised liver function in targeted mice. To test the effectiveness of the system in editing the point mutation in spfash OTC mRNA (FIG. 17D), Applicants first evaluated our constructs in vitro with a plasmid bearing a fragment of the spfash OTC mRNA in HEK293T cells. Sanger sequencing and next generation sequencing (NGS) analysis confirmed robust RNA editing efficiencies (FIG. 21C). Applicants next packaged the constructs into AAV8, which has high liver tropism44, and injected 10-12 week old spfash mice. Four weeks post injection, Applicants collected liver samples from spfash, wild-type litter mates, and spfash mice treated with the ADAR2 targeting and non-targeting vectors and evaluated editing efficiency via NGS. Notably, significant RNA editing rates in the range of 0.8-4.2% were observed in treated mice in the spliced OTC mRNA (FIG. 17E, FIG. 21D), further confirming the utility of this approach for in vivo editing of endogenous RNA in adult mice.


Taken together, Applicants' results establish the use of suppressor tRNAs and ADAR2 as potential strategies for in vivo RNA targeting of point mutations. Specifically, by optimizing delivery, Applicants first demonstrated robust and inducible stop codon read-through via the use of suppressor tRNAs. The delivery of modified endogenous suppressor tRNAs for premature stop read-through has several potential advantages: it lacks the toxicity associated with read-through drugs such as gentamycin and can be used to bring about efficient stop codon read-through in post-mitotic cells. In addition, being of endogenous origin, it is not likely to elicit a strong immune response. Additionally, the inducibility enabled by the UAA based systems, albeit non-native, could provide tight regulation over the expression of genes. Localized injections of the UAA into the target muscle could further help improve the efficiency of the system in future studies. Notably, Applicants did not observe any overt toxicity via this approach in the mdx targeting studies. Applicants however note too that an important caveat to this strategy, analogous to the read-through drugs, is that suppressor tRNA based approaches will lead to the read-through of other non-target stop codons. In this regard, Applicants thus also demonstrated ADAR2 based site-specific correction of point mutations in RNA in two independent mouse models. Applicants note that potential off-targets in RNA are limited as compared to DNA, as the transcriptome is only a small subset of the genome. Secondly, even if off-targets exist, the presence of an A within the target window is required for the enzyme to create an off-target A→G change. Lastly, the off-target effects will be transient. Thus, overall off-target effects due to a RNA editing enzyme such as ADAR2 are likely to be limited, although enzyme processivity, promiscuity, and off-target hybridization of the antisense domain of the adRNA need to be studied thoroughly. ADAR2 being of human origin is also less likely to elicit an immune response, while enabling more site-specific editing of RNA compared to the suppressor tRNA approach.


Applicants also note that compared to the tRiAD based RNA targeting approaches above, CRISPR based genome targeting approaches currently show faster kinetics and greater degree of mutant protein restoration. Applicants however anticipate that systematic engineering and directed evolution of the ADAR2 could help improve the editing efficiency and also eliminate the intrinsic biases of the ADAR2 for certain sequences, coupled with insights from studies unearthing novel regulators of ADAR2 providing cues to improve its stability. In this regard, Applicants tested the ADAR2-E488Q mutant and noted that it enabled higher editing efficiency than the wild type ADAR2 for both the DMD and OTC mRNA fragments expressed in vitro (FIG. 22). The demonstration of site-specific A→G mRNA editing in vivo also opens up the door to future site-specific C→T editing via targeted recruitment of cytosine deaminases, thereby potentially expanding the repertoire of RNA editing tools. However, an important consideration while targeting RNA for gene therapy via the use of non-integrating vectors such as AAVs, is the necessity for periodic re-administration of the effector constructs due to the typically limited half-life of edited mRNAs. Secondly, RNA folding, intrinsic half-life, localization, and RNA binding proteins might also impact accessibility of target sites in the RNA. For instance, in this example, the short half-life of mutant dystrophin RNA, and the need to target the transient pre-mRNA in OTC potentially negatively impact overall editing efficiencies. Chemical and structural modifications in tRNAs and adRNAs while taking cues from the specificity studies on sgRNAs49, or coupling of shielding proteins, or recently demonstrated programmable RNA binding proteins and RNA-targeting CRISPR-Cas systems, might help improve RNA stability and specificity, and improve the efficiency of the above approaches. With progressive improvements, Applicants thus anticipate this integrated tRiAD toolset will have broad implications in both applied life sciences as well as fundamental research.


Example 6—ADAR and APOBEC Editing Efficacy

A number of ADAR scaffolds—both dual and single—were tested for efficacy in recruiting ADAR in a cell line where ADAR2 was overexpressed (FIG. 28 and FIG. 29). Further assessments were made for MCP-ADAR fusion scaffolds (FIG. 30). Endogenous mRNA target editing efficiency was assessed using scaffold v2. SEQ ID NOS 160-163 are disclosed below.

















mRNA
Target
#1
#2
#3
Average







RAB7A
GGGAAATCCAGCTAG
32.0%
34.1%
30.2%
32.1%



CGGCA









RAB7A
GGGAAAACTGTCTAG
28.2%
27.5%
23.0%
26.2%



TTCCC









CCNB1
TAATTGACTGGCTAG
23.8%
17.2%
21.1%
20.7%



TACAG









CCNB1
GAGCTTTTTGCTTAG
15.1%
18.4%
17.4%
17.0%



CACTG









EQUIVALENTS

Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this technology belongs.


The present technology illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms “comprising,” “including,” “containing,” etc. shall be read expansively and without limitation. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the present technology claimed.


Thus, it should be understood that the materials, methods, and examples provided here are representative of preferred aspects, are exemplary, and are not intended as limitations on the scope of the present technology.


The present technology has been described broadly and generically herein. Each of the narrower species and sub-generic groupings falling within the generic disclosure also form part of the present technology. This includes the generic description of the present technology with a proviso or negative limitation removing any subject matter from the genus, regardless of whether or not the excised material is specifically recited herein.


In addition, where features or aspects of the present technology are described in terms of Markush groups, those skilled in the art will recognize that the present technology is also thereby described in terms of any individual member or subgroup of members of the Markush group.


All publications, patent applications, patents, and other references mentioned herein are expressly incorporated by reference in their entirety, to the same extent as if each were incorporated by reference individually. In case of conflict, the present specification, including definitions, will control.


Other aspects are set forth within the following claims.


REFERENCES



  • Welch, E. M. et al. PTC124 targets genetic disorders caused by nonsense mutations. Nature 447, 87-91 (2007).

  • Mah, J. Current and emerging treatment strategies for Duchenne muscular dystrophy. Neuropsychiatr. Dis. Treat. Volume 12, 1795-1807 (2016).

  • Tabebordbar, M. et al. In vivo gene editing in dystrophic mouse muscle and muscle stem cells. Science (80.). 351, 407-411 (2016).

  • Nelson, C. E. et al. In vivo genome editing improves muscle function in a mouse model of Duchenne muscular dystrophy. Science (80.). 351, (2016).

  • Cirak, S. et al. Exon skipping and dystrophin restoration in patients with Duchenne muscular dystrophy after systemic phosphorodiamidate morpholino oligomer treatment: an open label, phase 2, dose escalation study. Lancet 378, 595-605 (2011).

  • Malik, V. et al. Gentamicin induced readthrough of stop codons in Duchenne muscular dystrophy. Ann. Neurol. 67, NANA (2010).

  • Wagner, K. R. et al. Gentamicin treatment of Duchenne and Becker muscular dystrophy due to nonsense mutations. Ann. Neurol. 49, 706-11 (2001).

  • Yang, Y. et al. A dual AAV system enables the Cas9-mediated correction of a metabolic liver disease in newborn mice. Nat. Biotechnol. 34, 334-338 (2016).

  • Wettengel, J. et al. Harnessing human ADAR2 for RNA repair—Recoding a PINK1 mutation rescues mitophagy. Nucleic Acids Res. gkw911 (2016).

  • Fukuda, M. et al. Construction of a guide-RNA for site-directed RNA mutagenesis utilising intracellular A-to-I RNA editing 1-49.

  • Hendel, A. et al. Chemically modified guide RNAs enhance CRISPR-Cas genome editing in human primary cells. Nature Biotechnology, 33(9), pp. 985-989 (2015).

  • Jinek, M. et al. A Programmable Dual-RNA-Guided DNA Endonuclease in Adaptive Bacterial Immunity. Science (80-.). 337, 816-821 (2012).

  • Christian, M. et al. Targeting DNA Double-Strand Breaks with TAL Effector Nucleases. Genetics 186, 757-761 (2010).

  • Urnov, F. D. et al. Highly efficient endogenous human gene correction using designed zinc-finger nucleases. Nature 435, 646-651 (2005).

  • Urnov, F. D., Rebar, E. J., Holmes, M. C., Zhang, H. S. & Gregory, P. D. Genome editing with engineered zinc finger nucleases. Nat. Rev. Genet. 11, 636-646 (2010).

  • Mali, P. et al. RNA-guided human genome engineering via Cas9. Science 339, 823-6 (2013).

  • Cong, L., Ran, F., Cox, D., Lin, S. & Barretto, R. Multiplex Genome Engineering Using CRISPR/Cas Systems. Science (80). 819, (2013).

  • Mario, R. et al. Altering the genome by Homologous Recombination. Sci. Virol. Sci. Theor. Appl. Genet. Arch. Tierz. Kexue Tongbao K. Ozato al. Cell Differ. Aquac. Trans. Am. Fish. Soc 244, 1288-1292 (1989).

  • Takata, M. et al. Homologous recombination and non-homologous end-joining pathways of DNA double-strand break repair have overlapping roles in the maintenance of chromosomal integrity in vertebrate cells. EMBO J. 17, 5497-508 (1998).

  • Cho, S. W. et al. Analysis of off-target effects of CRISPR/Cas-derived RNA-guided endonucleases and nickases. Genome Res. 24, 132-41 (2014).

  • Schaefer, K. A. et al. Unexpected mutations after CRISPR—Cas9 editing in vivo

  • Digenome-seq web tool for profiling CRISPR specificity. Nature 14, 547-548 (2017).

  • Wang, D. et al. Adenovirus-Mediated Somatic Genome Editing of Pten by CRISPR/Cas9 in Mouse Liver in Spite of Cas9-Specific Immune Responses. Hum. Gene Ther. 26, 432-42 (2015).

  • Chew, W. L. et al. A multifunctional AAV-CRISPR-Cas9 and its host response. Nat. Methods 13, 868-874 (2016).

  • Komor, A. C., Kim, Y. B., Packer, M. S., Zuris, J. A. & Liu, D. R. Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature 533, 420-424 (2016).

  • Gaudelli, N. M. et al. Programmable base editing of A.T to G.C in genomic DNA without DNA cleavage. (2017). doi:10.1038/nature24644

  • Kim, K. et al. Highly efficient RNA-guided base editing in mouse embryos. Nat. Biotechnol. 9, 12-15 (2017).

  • Capone, J. P., Sharp, P. A. & RajBhandary, U. L. Amber, ochre and opal suppressor tRNA genes derived from a human serine tRNA gene. EMBO J. 4, 213-21 (1985).

  • Geslain, R. & Pan, T. Functional analysis of human tRNA isodecoders. doi:10.1016/j.jmb.2009.12.018

  • Panchal, R. G., Wang, S., Mcdermott, J. & Link, C. J. Partial Functional Correction of Xeroderma Pigmentosum Group A Cells by Suppressor tRNA. Hum. Gene Ther. 10, 2209-2219 (1999).

  • Buvoli, M., Buvoli, A. & Leinwand, L. A. Suppression of nonsense mutations in cell culture and mice by multimerized suppressor tRNA genes. Mol. Cell. Biol. 20, 3116-24 (2000).

  • Wang, L., Brock, A., Herberich, B. & Schultz, P. G. Expanding the Genetic Code of Escherichia coli. Science (80-.). 292, (2001).

  • Ernst, R. J. et al. Genetic code expansion in the mouse brain. 1-5 (2016). doi:10.1038/nchembio.2160

  • Han, S. et al. Expanding the genetic code of Mus musculus. Nat. Commun. 8, 14568 (2017).

  • Melcher, T. et al. A mammalian RNA editing enzyme. Nature 379, 460-464 (1996).

  • Rueter, S. M., Burns, C. M., Coode, S. A., Mookherjee, P. & Emeson, R. B. Glutamate receptor RNA editing in vitro by enzymatic conversion of adenosine to inosine. Science 267, 1491-4 (1995).

  • Montiel-Gonzalez, M. F., Vallecillo-Viejo, I., Yudowski, G. A. & Rosenthal, J. J. C. Correction of mutations within the cystic fibrosis transmembrane conductance regulator by site-directed RNA editing. Proc. Natl. Acad. Sci. U.S.A 110, 18285-90 (2013).

  • Wettengel, J., Reautschnig, P., Geisler, S., Kahle, P. J. & Stafforst, T. Harnessing human ADAR2 for RNA repair—Recoding a PINK1 mutation rescues mitophagy. Nucleic Acids Res. gkw911 (2016). doi:10.1093/nar/gkw911

  • Fukuda, M. et al. Construction of a guide-RNA for site-directed RNA mutagenesis utilising intracellular A-to-I RNA editing. Sci. Rep. 7, 41478 (2017).

  • Mort, M., Ivanov, D., Cooper, D. N. & Chuzhanova, N. A. A meta-analysis of nonsense mutations causing human genetic disease. Hum. Mutat. 29, 1037-1047 (2008).

  • Bidou, L., Allamand, V., Rousset, J.-P. & Namy, O. Sense from nonsense: therapies for premature stop codon diseases. Trends Mol. Med. 18, 679-688 (2012).

  • Li, K. et al. OCHRE SUPPRESSOR TRANSFER RNA RESTORED DYSTROPHIN EXPRESSION IN MDX MICE. Life Sci. 61, PL205-PL209 (1997).

  • Kiselev, A. V. et al. Suppression of nonsense mutations in the Dystrophin gene by a suppressor tRNA gene|Ispol'zovanie gena supressornoi tRNK dlia ispravleniia nonsens-mutatsii v gene distrofina. Mol. Biol. 36, 43-47 (2002).

  • Gautier, A. et al. Genetically Encoded Photocontrol of Protein Localization in Mammalian Cells. J. Am. Chem. Soc. 132, 4086-4088 (2010).

  • Chatterjee, A., Xiao, H., Bollong, M., Ai, H. & Schultz, P. G. Efficient viral delivery system for unnatural amino acid mutagenesis in mammalian cells. 110, 11803-11808 (2013).

  • Greiss, S. & Chin, J. W. Expanding the Genetic Code of an Animal. 2, 14196-14199 (2011).

  • Robinson-Hamm, J. N. & Gersbach, C. A. Gene therapies that restore dystrophin expression for the treatment of Duchenne muscular dystrophy. Hum. Genet. 135, 1029-1040 (2016).

  • Bulfield, G., Siller, W. G., Wight, P. A. & Moore, K. J. X chromosome-linked muscular dystrophy (mdx) in the mouse. Proc. Natl. Acad. Sci. U.S.A 81, 1189-92 (1984).

  • Sicinski, P. et al. The molecular basis of muscular dystrophy in the mdx mouse: a point mutation. Science 244, 1578-80 (1989).

  • Long, C. et al. Prevention of muscular dystrophy in mice by CRISPR/Cas9-mediated editing of germline DNA. Science (80-.). 345, 1184-1188 (2014).

  • Nelson, C. E. et al. In vivo genome editing improves muscle function in a mouse model of Duchenne muscular dystrophy. Science (80-.). 351, (2016).

  • Tabebordbar, M. et al. In vivo gene editing in dystrophic mouse muscle and muscle stem cells. Science (80-.). 351, 407-411 (2016).

  • Long, C. et al. Postnatal genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy. Science (80-.). 351, 400-403 (2016).

  • Bengtsson, N. E. et al. Muscle-specific CRISPR/Cas9 dystrophin gene editing ameliorates pathophysiology in a mouse model for Duchenne muscular dystrophy. Nat. Commun. 8, 14454 (2017).

  • Hodges, P. E. & Rosenberg, L. E. The spfash mouse: a missense mutation in the ornithine transcarbamylase gene also causes aberrant mRNA splicing. Proc. Natl. Acad. Sci. U.S.A 86, 4142-4146 (1989).

  • Yang, Y. et al. A dual AAV system enables the Cas9-mediated correction of a metabolic liver disease in newborn mice. Nat. Biotechnol. 34, 334-338 (2016).

  • Kuttan, A. & Bass, B. L. Mechanistic insights into editing-site specificity of ADARs. Proc. Natl. Acad. Sci. 109, E3295-E3304 (2012).

  • Tan, M. H. et al. Dynamic landscape and regulation of RNA editing in mammals. Nature 550, 249-254 (2017).

  • Varani, G., Cheong, C. & Tinoco, I. Structure of an Unusually Stable RNA Hairpint. Biochemistry 30, 3280-3289 (1991).

  • Tuerk, C. et al. CUUCGG hairpins: Extraordinarily stable RNA secondary structures associated with various biochemical processes (hairpin stability/sequence analysis/reverse transcriptase). Biochemistry 85, 1364-1368 (1988).

  • Fu, Y., Sander, J. D., Reyon, D., Cascio, V. M. & Joung, J. K. Improving CRISPR-Cas nuclease specificity using truncated guide RNAs. Nat. Biotechnol. 32, 279-84 (2014).

  • Adamala, K. P., Martin-Alarcon, D. A. & Boyden, E. S. Programmable RNA-binding protein composed of repeats of a single modular unit. Proc. Natl. Acad. Sci. 113, E2579-E2588 (2016).

  • East-Seletsky, A. et al. Two distinct RNase activities of CRISPR-C2c2 enable guide-RNA processing and RNA detection. Nature (2016). doi:10.1038/nature19802

  • Abudayyeh, O. O. et al. C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector. Science 353, aaf5573 1-9 (2016).

  • O'Connell, M. R. et al. Programmable RNA recognition and cleavage by CRISPR/Cas9. Nature 516, 263-266 (2014).

  • Abudayyeh, O. O. et al. RNA targeting with CRISPR-Cas13. Nature (2017). doi:10.1038/nature24049

  • Cox, D. B. T. et al. RNA editing with CRISPR-Cas13. Science eaaq0180 (2017). doi:10.1126/science.aaq0180

  • Gootenberg, J. S. et al. Nucleic acid detection with CRISPR-Cas13a/C2c2. Science (80-.). 356, 438-442 (2017).

  • East-Seletsky, A., O'Connell, M. R., Burstein, D., Knott, G. J. & Doudna, J. A. RNA Targeting by Functionally Orthogonal Type VI-A CRISPR-Cas Enzymes. Mol. Cell 66, 373-383.e3 (2017).

  • Grieger, J. C., Choi, V. W. & Samulski, R. J. Production and characterization of adeno-associated viral vectors. Nat. Protoc. 1, 1412-1428 (2006).

  • Analyzing CRISPR genome-editing experiments with CRISPResso. Nat. Biotechnol. 34, (2016).


Claims
  • 1. A method of treating an inherited disease in a subject, the method comprising: administering to the subject a viral vector comprising a polynucleotide encoding an adenosine deaminase acting on RNA (ADAR)-based editing system that comprises a first guide RNA and a second guide RNA, wherein: (a) the first guide RNA comprises at least: (i) a first recruiting domain; and(ii) a first targeting domain, wherein the first targeting domain forms a mismatch corresponding to an adenosine of a first target sequence of an RNA when bound to the first target sequence, wherein the first targeting domain comprises a length of at least about 50 nucleotides and wherein upon hybridization of the first guide RNA to the first target sequence in the subject, an Adenosine Deaminase Acting on RNA (ADAR) enzyme endogenous to the subject is recruited, wherein upon recruitment, the ADAR enzyme edits the first target sequence; and(b) the second guide RNA comprises: (i) a second recruiting domain; and(ii) a second targeting domain, wherein the second targeting domain forms a mismatch corresponding to an adenosine of a second target sequence of an RNA when bound to the second target sequence, wherein the second targeting domain comprises a length of at least about 50 nucleotides and wherein upon hybridization of the second guide RNA to the second target sequence in the subject, the ADAR enzyme endogenous to the subject is recruited, wherein upon recruitment, the ADAR enzyme edits the second target sequence;wherein the first recruiting domain and the second recruiting domain are independently positioned from 5 to 7 bases away from the adenosine to be edited, wherein the ADAR-based editing system does not comprise an ADAR1 or ADAR2 enzyme encoded by the polynucleotide, and wherein the inherited disease is selected from the group consisting of: Muscular dystrophy, Wilson's disease, Hereditary tyrosinemia type 1, a cancer, beta thalassemia, ornithine transcarbamylase (OTC) deficiency, cystic fibrosis, amyotrophic lateral sclerosis (ALS), Usher syndrome, retinitis pigmentosa, spinal muscular atrophy, Rett syndrome, Parkinson disease 2, and Hurler syndrome, thereby treating the inherited disease.
  • 2. The method of claim 1, wherein the inherited disease is caused by a mutation in an OTC gene or a DMD gene.
  • 3. The method of claim 1, wherein the first recruiting domain and the second recruiting domain are each GluR2 domains.
  • 4. The method of claim 1, wherein the first recruiting domain and the second recruiting domain each independently comprise a hairpin.
  • 5. The method of claim 1, wherein the edit to the first target sequence or the second target sequence comprises editing a point mutation in the first target sequence or the second target sequence.
  • 6. The method of claim 1, wherein the edit to the first target sequence and the edit to the second target sequence are at a plurality of adenosines.
  • 7. The method of claim 1, wherein the edit to the first target sequence or the edit to the second target sequence comprises editing a missense mutation or a nonsense mutation.
  • 8. The method of claim 1, wherein the edit to the first target sequence or the edit to the second target sequence comprises editing a premature stop codon in the target sequence.
  • 9. The method of claim 8, wherein the premature stop codon is UGA, UAA, or UAG.
  • 10. The method of claim 1, wherein the ADAR is a human ADAR1 or a human ADAR2.
  • 11. The method of claim 1, wherein the polynucleotide is delivered in an adeno-associated virus (AAV).
  • 12. The method of claim 11, wherein the AAV comprises AAV1, AAV2, AAV3, AAV4, AAV5, AAV6, AAV7, AAV8, AAV9, AAV10, or AAV11.
  • 13. A method for treating a disease or disorder in a subject in need thereof, wherein the disease or disorder is characterized by the presence of a point mutation in a target sequence of an RNA encoding a protein associated with the disease or disorder in the subject in need thereof, the method comprising: administering a viral vector comprising a polynucleotide encoding an adenosine deaminase acting on RNA (ADAR)-based editing system that comprises a first guide RNA and a second guide RNA to the subject, wherein:(a) the first guide RNA comprises: (i) a first recruiting domain; and(ii) a first targeting domain that binds to the target sequence, wherein the first targeting domain forms a first mismatch corresponding to an adenosine of the target sequence when bound to the target sequence, wherein the first targeting domain comprises a length of at least about 50 nucleotides; and(b) the second guide RNA comprises: (i) a second recruiting domain; and(ii) a second targeting domain, wherein the second targeting domain forms a second mismatch corresponding to an adenosine of the target sequence when bound to the target sequence, wherein the second targeting domain comprises a length of at least about 50 nucleotides;wherein upon hybridization of the first guide RNA or the second guide RNA to the target sequence in the subject, an Adenosine Deaminase Acting on RNA (ADAR) enzyme endogenous to the subject is recruited, wherein the ADAR-based editing system does not comprise an ADAR1 or ADAR2 enzyme encoded by the polynucleotide, wherein the first recruiting domain is positioned from 5 to 7 bases away from the first mismatch and the second recruiting domain is positioned from 5 to 7 bases away from the second mismatch, and wherein the first mismatch and the second mismatch are different, and wherein the disease or disorder is selected from the group consisting of: Muscular dystrophy, Wilson's disease, Hereditary tyrosinemia type 1, a cancer, beta thalassemia, ornithine transcarbamylase (OTC) deficiency, cystic fibrosis, amyotrophic lateral sclerosis (ALS), Usher syndrome, retinitis pigmentosa, spinal muscular atrophy, Rett syndrome, Parkinson disease 2, and Hurler syndrome.
  • 14. The method of claim 13, wherein the edit to the first target sequence and the edit to the second target sequence are at a plurality of adenosines.
  • 15. A method for at least partially restoring expression of a protein, the method comprising: administering a viral vector comprising a polynucleotide encoding an adenosine deaminase acting on RNA (ADAR)-based editing system that comprises a first guide RNA and a second guide RNA to a subject in need thereof, wherein: (a) the first guide RNA comprises: (i) a first recruiting domain; and(ii) a first targeting domain that binds to a target sequence of an RNA, wherein the first targeting domain forms a first mismatch corresponding to an adenosine of the target sequence when bound to the target sequence, wherein the first targeting domain comprises a length of at least about 50 nucleotides; and(b) the second guide RNA comprises: (i) a second recruiting domain; and(ii) a second targeting domain, wherein the second targeting domain forms a second mismatch corresponding to an adenosine of the target sequence when bound to the target sequence, wherein the second targeting domain comprises a length of at least about 50 nucleotides;wherein the RNA target sequence encodes the protein, wherein the target sequence comprises a point mutation, wherein upon hybridization of the first guide RNA or the second guide RNA to the target sequence in the subject, an Adenosine Deaminase Acting on RNA (ADAR) enzyme endogenous to the subject is recruited, wherein the ADAR-based editing system does not comprise an ADAR1 or ADAR2 enzyme encoded by the polynucleotide, wherein the first recruiting domain is positioned from 5 to 7 bases away from the first mismatch and the second recruiting domain is positioned from 5 to 7 bases away from the second mismatch, and wherein upon recruitment, the ADAR edits the adenosine corresponding to the first mismatch or the second mismatch of the target sequence to inosine (I), and wherein the protein has a point mutation associated with a disease or disorder selected from the group consisting of: Muscular dystrophy, Wilson's disease, Hereditary tyrosinemia type 1, a cancer, beta thalassemia, ornithine transcarbamylase (OTC) deficiency, cystic fibrosis, amyotrophic lateral sclerosis (ALS), Usher syndrome, retinitis pigmentosa, spinal muscular atrophy, Rett syndrome, Parkinson disease 2, and Hurler syndrome, thereby editing the point mutation and at least partially restoring expression of the protein.
  • 16. The method of claim 15, wherein the edit to the first target sequence and the edit to the second target sequence are at the adenosine corresponding to the first mismatch and the second mismatch.
  • 17. The method of claim 1, wherein the first targeting domain and the second targeting domain are different.
  • 18. The method of claim 1, wherein the first targeting domain and the second targeting domain are the same.
  • 19. The method of claim 1, wherein the first targeting domain and the second targeting domain each have a length of from about 50 nucleotides to about 150 nucleotides.
  • 20. The method of claim 1, wherein the first targeting domain and the second targeting domain each have a length of about 100 nucleotides.
  • 21. The method of claim 1, wherein the first recruiting domain is proximal to the 5′ end of the first targeting domain, the second recruiting domain is proximal to the 5′ end of the second targeting domain, or a combination thereof.
  • 22. The method of claim 1, wherein the first recruiting domain is proximal to the 3′ end of the first targeting domain, the second recruiting domain is proximal to the 3′ end of the second targeting domain, or a combination thereof.
  • 23. The method of claim 1, wherein the inherited disease is associated with a G to A point mutation.
  • 24. The method of claim 13, wherein the first targeting domain and the second targeting domain each have a length of from about 50 nucleotides to about 150 nucleotides.
  • 25. The method of claim 15, wherein the first targeting domain and the second targeting domain each have a length of from about 50 nucleotides to about 150 nucleotides.
  • 26. The method of claim 1, wherein the first guide RNA and the second guide RNA do not comprise a chemical modification.
  • 27. The method of claim 13, wherein the first guide RNA and the second guide RNA do not comprise a chemical modification.
  • 28. The method of claim 15, wherein the first guide RNA and the second guide RNA do not comprise a chemical modification.
  • 29. The method of claim 1, wherein the subject is a human.
  • 30. The method of claim 13, wherein the subject is a human.
  • 31. The method of claim 15, wherein the subject is a human.
CROSS REFERENCE TO RELATED APPLICATION

This application is a continuation of U.S. application Ser. No. 16/864,911, filed May 1, 2020, which is a continuation of U.S. application Ser. No. 16/490,494, filed Aug. 30, 2019, which application is a U.S. National Stage Application filed under 35 U.S.C. § 371 and claims priority to International Application No. PCT/US2018/020762, filed Mar. 2, 2018, which claims priority under 35 U.S.C. 119(e) to U.S. Ser. No. 62/466,961, filed Mar. 3, 2017, and U.S. Ser. No. 62/551,732, filed Aug. 29, 2017, the disclosures of each of which are incorporated by reference herein.

STATEMENT REGARDING GOVERNMENT SUPPORT

This invention was made with government support under Grant No. R01HG009285 awarded by the National Institutes of Health. The government has certain rights in the invention.

US Referenced Citations (17)
Number Name Date Kind
5759833 Shiba et al. Jun 1998 A
7709616 Bentwich et al. May 2010 B2
9650627 Rosenthal et al. May 2017 B1
9745576 de Visser et al. Aug 2017 B2
9890379 De Kimp et al. Feb 2018 B2
10450568 Butler et al. Jan 2019 B2
10479995 Vargeese et al. Nov 2019 B2
10689646 De Kimp et al. Jun 2020 B2
20020156042 Panchal et al. Oct 2002 A1
20070050146 Bentwich et al. Mar 2007 A1
20150020223 Zhang Jan 2015 A1
20190040383 Klein et al. Feb 2019 A1
20190218552 Turunen et al. Jul 2019 A1
20200140857 De Kimpe et al. May 2020 A1
20200149043 De Visser et al. May 2020 A1
20200283755 Zhang et al. Sep 2020 A1
20200291383 Mandel et al. Sep 2020 A1
Foreign Referenced Citations (32)
Number Date Country
102015012522.2 Jun 2016 DE
3323890 May 2018 EP
3353299 Mar 2020 EP
3642342 Apr 2020 EP
3234134 May 2020 EP
3712269 Sep 2020 EP
1521987.6 Dec 2015 GB
2002-508959 Mar 2002 JP
2016-182140 Oct 2016 JP
2013075035 May 2013 WO
2014011053 Jan 2014 WO
2015120197 Aug 2015 WO
2005094370 Oct 2015 WO
2016094845 Jun 2016 WO
2016097212 Jun 2016 WO
2017010556 Jan 2017 WO
2017050306 Mar 2017 WO
2017201091 Nov 2017 WO
2017220751 Dec 2017 WO
2018134301 Jan 2018 WO
2018041973 Mar 2018 WO
2018134301 Jul 2018 WO
2019023680 Jan 2019 WO
2019071048 Apr 2019 WO
2019071274 Apr 2019 WO
2019217944 Nov 2019 WO
2020023655 Jan 2020 WO
2020001793 Jan 2020 WO
2020074001 Apr 2020 WO
2020154342 Jul 2020 WO
2020154343 Jul 2020 WO
2020154344 Jul 2020 WO
Non-Patent Literature Citations (109)
Entry
Daniel et al. “Editing inducer elements increases A-to-I editing efficiency in the mammalian transciptome,” Genome Biology, 2017, 18:195, pp. 1-16.
Eggington et al., “Predicting sites of ADAR editing in double-stranded RNA,” Nature Communications. Feb. 2011, 2:319, pp. 1-9.
Garncarz et al., “A high-throughput screen to identify enhancers of ADAR-mediated RNA editing,” RNA Biology, Feb. 2013, 10:2, 192-204.
Katrekar et al., “In vivo RNA editing of point mutations via RNA-guided adenosine deaminases”, Nature Methods, Mar. 2019, vol. 16, 239-242.
Lueck et al. “Engineered transfer RNA for suppression of premature termination codons,” Nature Communications, 2019, 10:822, pp. 1-11.
Merkle et al., “Precise RNA editing by recruiting endogenous ADARs with antisense oligonucleotides,” Nature Biotechnology, Jan. 27, 2019, 37(2):133-138.
Bordeira-Carrico et al., “Rescue of wild-type E-cadherin expression from nonsense-mutated cancer cells by a suppressor-tRNA”, European Journal of Human Genetics, 2014, 22, 1085-1092.
Buvoli et al., “Suppression of Nonsense Mutations in Cell Culture and Mice by Multimerized Suppressor tRNA Genes”, Mol Cell Biol., May 2000, 20(9): 3116-3124.
Chang et al., “Suppression of the nonsense mutation in homozygous β0 thalassaemia”, Nature, Oct. 18, 1979:281(5732):602-3.
Garncarz et al., “A high-throughput screen to identify enhancers of ADAR-mediated RNA-editing”, RNA Biology, 2013, 10:2, 192-204.
Ho et al., “In vivo aminoacylation of human and Xenopus suppressor tRNAs constructed by site-specific mutagenesis”, Proc Natl Acad Sci U S A, Apr. 1987, 84(8):2185-8.
Hudziak et al., “Establishment of Mammalian Cell Lines Containing Multiple Nonsense Mutations and Functional Suppressor tRNA Genes”, Cell, Nov. 1982, vol. 31, 127-146.
Kimble et al., “Suppression of an amber mutation by microinjection of suppressor tRNA in C. elegans”, Nature, , Sep. 30, 1982, 299 (5882):456-458.
Kiselev et al., Suppression of Nonsense Mutations in the Dystrophin Gene by a Suppressor tRNA Gene, Molecular Biology, vol. 36, No. 1, 2002, pp. 30-33.
Koukuntla et al., “U6 promoter-enhanced GlnUAG suppressor tRNA has higher suppression efficacy and can be stably expressed in 293 cells”, J Gene Med, Feb. 2013, 15(2):93-101.
Laski et al.,“An amber suppressor tRNA gene derived by site-specific mutagenesis: Cloning and function in mammalian cells”, Proc. Natl. Acad. Sci. USA, Oct. 1982, vol. 79, pp. 5813-5817.
Lueck et al., “Engineered tRNA suppression of a CFTR nonsense mutation”, bioRxiv, Nov. 19, 2016.
Lueck et al., “Engineered transfer RNAs for suppression of premature termination condons”, Nature Commun., Feb. 18, 2019; 10(1)822.
Panchal et al. “Partial Functional Correction of Xeroderma Pigmentosum Group A Cells by Suppressor tRNA”, Human Gene Therapy, 1999, vol. 10, No. 13, 2209-19.
Sako et al., “A novel therapeutic approach for genetic diseases by introduction of suppressor tRNA”, Nucleic Acids Symposium Series , 2006, No. 50, 239-240.
Temple et al., “Construction of a functional human suppressor tRNA gene: an approach to gene therapy for β-thalassaemia”, Nature, Apr. 1, 1982, 296, 537-540.
Woolf et al., “Toward the therapeutic editing of mutated RNA sequences”, Proc. Natl. Acad. Sci. USA, Aug. 1995, vol. 92, pp. 8298-8302.
Senis et al., “CRISPR/Cas9-mediated genome engineering: An adeno-associated viral (AAV) vector toolbox,” Biotechnol. J., 9:1402-1412, 2014.
Biddle et al., “Modification of Orthogonal tRNAs: Unexpected Consequences for Sense Codon Reassignment,” Nucleic Acids Research, vol. 44, No. 21, pp. 10042-10050, Oct. 23, 2016.
Gatti, “SMRT Compounds Correct Nonsense Mutations in Primary Immunodeficiency and Other Genetic Models,” Annals of the New York Academy of Sciences, vol. 1250, pp. 1-13, Feb. 2012.
Katrekar et al., “In vivo RNA Targeting of Point Mutations via Suppressor tRNAs and Adenosine Deaminases,” BioRxiv, pp. 1-25, Oct. 27, 2017.
Mohri, Mineko, International Preliminary Examination Report on Patentability & Written Opinion, PCT/US2018/020762, The International Bureau of WIPO, dated Sep. 12, 2019.
Thomas, Shane, International Search Report & Written Opinion, PCT/US2018/020762, United States Patent & Trademark Office, dated Jul. 17, 2018.
Nose et al., “Short-Chain Guide RNA for Site-Directed A-to-I RNA Editing”, Nucleic Acid Therapeutics, Nov. 10, 2020; 00(00): 1-10.
O'Connell, M. R. et al., “Programmable RNA recognition and cleavage by CRISPR/Cas9”, Nature, Dec. 11, 2014, 516(7530), 263-266.
Pinello, “Analyzing CRISPR genome editing experiments with CRISPResso”, Nat. Biotechnol., Jul. 12, 2016, vol. 34(7), pp. 695-697.
Reider et al., “Tertiary structural elements determine the extent and specificity of messenger RNA editing”, Nat. Commun., Feb. 2013; 4:2232, pp. 1-11.
Robinson-Hamm, J. N. & Gersbach, C. A., “Gene therapies that restore dystrophin expression for the treatment of Duchenne muscular dystrophy”, Hum. Genet., Sep. 2016, 135(9), 1029-1040.
Rueter, S. M., et al., “Glutamate Receptor RNA Editing in Vitro by Enzymatic Conversion of Adenosine to Inosine”, Science, Mar. 10, 1995, vol. 267(5203), pp. 1491-1494.
Schade et al., “A 6 bp Z-DNA hairpin binds two Za domains from the human RNA editing enzyme ADAR1”, FEBS Letters, Sep. 3, 1999, 458, 27-31.
Schaefer, K. A. et al., “Unexpected mutations after CRISPR-Cas9 editing in vivo”, Nature, May 30, 2017, 14(6), pp. 547-548.
Schneider et al., “Optimal guideRNAs for re-directing deaminase activity of hADARI and hADAR2 in trans” Nucleic Acids Research, Apr. 17, 2014, vol. 42, No. 10, e87, pp. 1-9.
Sicinski, P. et al., “The Molecular Basis of Muscular Dystrophy in the mdx Mouse: A Point Mutation”, Science, Jun. 1989, 244(4912), 1578-80.
Stefl et al., “A novel RNA pentaloop fold involved in targeting ADAR2”, RNA, May 2005, vol. 11(5), pp. 592-597.
Svoboda et al., “Hairpin RNA: a secondary structure of primary importance”, Cell. Mol. Life Sci., Mar. 29, 2006, (7-8), pp. 901-908.
Tabebordbar, M. et al., “In vivo gene editing in dystrophic mouse muscle and muscle stem cells#”, Science, Jan. 22, 2016, vol. 351(6271), pp. 407-411.
Takata, M. et al., “Homologous recombination and non-homologous end-joining pathways of DNA double-strand break repair have overlapping roles in the maintenance of chromosomal integrity in vertebrate cells”, EMBO J., Sep. 15, 1998, vol. 17, Issue 18, pp. 5497-5508.
Tan, M. H. et al., “Dynamic landscape and regulation of RNA editing in mammals”, Nature, Oct. 11, 2017, 550 (7675), 249-254.
Tuerk, C. et al., “CUUCGG hairpins: Extraordinarily stable RNA secondary structures associated with various biochemical processes (hairpin stability/sequence analysis/reverse transcriptase)”, Proc. Natl. Acad. Sci. USA, Biochemistry, Mar. 1988, vol. 85, pp. 1364-1368.
Urnov, F. D. et al., “Highly efficient endogenous human gene correction using designed zinc-finger nucleases,” Nature, Jun. 2005, 435, pp. 646-651.
Urnov, F. D., Rebar, E. J., Holmes, M. C., Zhang, H. S. & Gregory, P. D., “Genome editing with engineered zinc finger nucleases”, Nat. Rev. Genet., Sep. 2010, 11, pp. 636-646.
Varani, G., Cheong, C. & Tinoco, I., “Structure of an Unusually Stable RNA Hairpint,” Biochemistry, Apr. 2, 1991, 30(13), 3280-3289.
Vogel et al., “Improving Site-Directed RNA Editing In vitro and in Cell Culture by Chemical Modification of the GuideRNA”, Angewandte Chemie, May 28, 2014, 53(24), pp. 6267-6271.
Wagner, K. R. et al., “Gentamicin Treatment of Duchenne and Becker Muscular Dystrophy Due to Nonsense Mutations”, Ann. Neurol., Jun. 5, 2001, vol. 49, Issue 6, pp. 706-711.
Wang, D. et al., “Adenovirus-Mediated Somatic Genome Editing of Pten by CRISPR/Cas9 in Mouse Liver in Spite of Cas9-Specific Immune Responses”, Hum. Gene Ther., Jun. 17, 2015, vol. 26, No. 7, pp. 432-442.
Wang, L., Brock, A., Herberich, B. & Schultz, P. G., “Expanding the Genetic Code of Escherichia coli”, Science, May 2001, vol. 292(5516), pp. 498-500.
Welch, E. M. et al., “PTC124 targets genetic disorders caused by nonsense mutations”, Nature, May 3, 2007, vol. 447, 87-91.
Wettengel, J. et al., “Harnessing human ADAR2 for RNA repair—Recoding a PINK1 mutation rescues mitophagy,” Oct. 7, 2016, Nucleic Acids Res., vol. 45, Issue 5, pp. 2797-2808, 2017.
Wong et al., “Substrate recognition by ADAR1 and ADAR2”, RNA, Jun. 1, 2001, 7(6), pp. 846-858.
Yang, Y. et al., “A dual AAV system enables the Cas9-mediated correction of a metabolic liver disease in newborn mice,” Nat. Biotechnol., Mar. 2016, 34(3), 334-338.
Abudayyeh, 0. 0. et al., “C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector”, Science, Aug. 5, 2016, 353(6299), pp. 1-23.
Abudayyeh, 0. 0. et al., “RNA targeting with CRISPR-Cas13a”, Nature, Oct. 12, 2017, 550(7675), pp. 280-284.
Adamala, K. P., Martin-Alarcon, D. A & Boyden, E. S., “Programmable RNA-binding protein composed of repeats of a single modular unit”, PNAS, Apr. 26, 2016, 113(19), E2579-E2588.
Aruscavage et al., “A phylogenetic analysis reveals an unusual sequence conservation within introns involved in RNA editing” RNA, Feb. 1, 2000, 6:257-269.
Bengtsson, N. E. et al., “Muscle-specific CRISPR/Cas9 dystrophin gene editing ameliorates pathophysiology in a mouse model for Duchenne muscular dystrophy”, Nat Commun., Feb. 2017, 8(14454), pp. 1-10.
Bidou, L., Allamand, V., Rousset, J.-P. & NAMY, 0., “Sense from nonsense: therapies for premature stop codon diseases”, Trends Mol. Med., Nov. 2012, vol. 18, Issue 11, pp. 679-688.
Bulfield, G., Siller, W. G., Wight, P. A. & Moore, K. J., “X chromosome-linked muscular dystrophy (mdx) in the mouse”, Proc. Natl. Acad. Sci. U.S. A., Feb. 1984, vol. 81, 1189-92.
Capecchi et al., “Altering the Genome by Homologous Recombination”, Science, Jun. 16, 1989, vol. 244, Issue 4910, pp. 1288-129.
Capone, J. P., Sharp, P. A. & Rajbhandary, U. L., “Amber, ochre and opal suppressor tRNA genes derived from a human serine tRNA gene”, The EMBO Journal, Jan. 1985, 4(1), pp. 213-221.
Chatterjee, A., Xiao, H., Bollong, M., Al, H. & Schultz, P. G., “Efficient viral delivery system for unnatural amino acid mutagenesis in mammalian cells”, PNAS, Jul. 16, 2013, vol. 110, No. 29, pp. 11803-11808.
Chew, W. L. et al., “A multi-functional AAV-CRISPR-Cas9 and its host response”, Nat. Methods, Oct. 2016, 13 (10), pp. 868-887.
Cho, S. W. et al., “Analysis of off-target effects of CRISPR/Cas-derived RNA-guided endonucleases and nickases”, Genome Res., Jan. 2014, vol. 24, pp. 132-141.
Christian, M. et al., “Targeting DNA Double-Strand Breaks with TAL Effector Nucleases,” Genetics, Oct. 2010, vol. 186, Issue 2, pp. 757-761.
Cirak, S. et al., “Exon skipping and dystrophin restoration in patients with Duchenne muscular dystrophy after systemic phosphorodiamidate morpholino oligomer treatment: an open label, phase 2, dose escalation study,” Lancet, Aug. 13, 2011, 378, 595-605.
Cong, L., Ran, F., Cox, D., Lin, S. & Barretto, R., “Multiplex Genome Engineering Using CRISPR/Cas Systems”, Science, Feb. 15, 2013, vol. 339(6121), pp. 819-823.
Cox, D. B. T. et al., “RNA editing with CRISPR-Cas13”, Science, Nov. 24, 2017, vol. 358(6366), pp. 1019-1027.
Desterro et al., “Dynamic association of RNA-editing enzymes with the nucleolus”, J Cell Sci., May 2003; 116(Pt 9): 1805-18.
East-Seletsky, A et al., “Two Distinct RNase Activities of CRISPR-C2c2 Enable Guide RNA Processing and RNA Detection”, Nature, Oct. 13, 2016, 538(7624), 270-273.
East-Seletsky, A, O'Connell, M. R., Burstein, D., Knott, G. J. & Doudna, J. A., “RNA Targeting by Functionally Orthogonal Type VI-A CRISPR-Cas Enzymes”, Mol. Cell, May 4, 2017, 66, Issue 3, pp. 373-383.
Ernst, R. J. et al., “Genetic code expansion in the mouse brain”, Nat Chem Biol., Oct. 2016, 12(10), pp. 776-778.
Fu, Y., Sander, J. D., Reyon, D., Cascio, V. M. & Joung, J. K., “Improving CRISPR-Cas nuclease specificity using truncated guide RNAs”, Nat. Biotechnol., Mar. 2014, 32(3), 279-284.
Fukuda et al., “Construction of a guide-RNA for site-directed RNA mutagenesis utilising intracellular A-to-I RNA editing”, Sci. Rep. , Feb. 2, 2017, 41478, pp. 1-49.
Gaudelli, N. M. et al., “Programmable base editing of A•T to G•C in genomic DNA without DNA cleavage”, Nov. 23, 2017, Nature, 551(7681), pp. 464-471.
Gautier, A et al., “Genetically Encoded Photocontrol of Protein Localization in Mammalian Cells”, J. Am. Chem. Soc. , Mar. 31, 2010, 132(12), 4086-4088.
Geslain, R. & Pan, T., “Functional Analysis of Human tRNA Isodecoders”, J Mol Biol, Feb. 26, 2010, vol. 396 (3), pp. 1-20.
Gootenberg, J. S. et al., “Nucleic acid detection with CRISPR-Cas13a/C2c2”, Science, Apr. 28, 2017, vol. 356 (6336), pp. 438-442.
Greiss, S. & Chin, J. W., “Expanding the Genetic Code of an Animal”, J American Chemical Society, Aug. 8, 2011, vol. 133(36), 14196-14199.
Grieger, J. C., Choi, V. W. & Samul Ski, R. J., “Production and characterization of adeno-associated viral vectors”, Nat. Protoc., Nov. 9, 2006, vol. 1, No. 3, 1412-1428.
Han, S. et al., “Expanding the genetic code of Mus musculus”, Nat. Commun., Feb. 21, 2017, vol. 8(14568), pp. 1-7.
Hendel, A. et al., “Chemically modified guide RNAs enhance CRISPR-Cas genome editing in human primary cells”, Nature Biotechnology, Sep. 2015, 33(9), pp. 985-989.
Higuchi et al., “RNA Editing of AMPA Receptor Subunit GluR-B: A Base-Paired Intron-Exon Structure Determines Position and Efficiency”, Cell, Dec. 31, 1993; 75: 1361-1370.
Hodges, P. E. & Rosenberg, L. E., “The spfash mouse: A missense mutation in the ornithine transcarbamylase gene also causes aberrant mRNA splicing”, Proc. Natl. Acad. Sci. USA, Jun. 1, 1989, vol. 86, No. 11, 4142-4146.
Jinek, M. et al., “A programmable dual RNA-guided DNA endonuclease in adaptive bacterial immunity,” Science, Aug. 17, 2012, vol. 337(6096), pp. 816-821.
Kim, K. et al., “Highly efficient RNA-guided base editing in mouse embryos”, Nat. Biotechnol., May 2017, vol. 35, No. 5, pp. 435-437.
Komor, A. C., Kim, Y. B., Packer, M. S., Zuris, J. A. & Liu, D. R., “Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage”, Nature, Apr. 20, 2016, 533(7603), 420-424.
Kuttan, A. & Bass, B. L., “Mechanistic insights into editing-site specificity of ADARs”, PNAS, Nov. 5, 2012, 109, E3295-E3304.
Lennox et al., “Chemical modification and design of anit-miRNA oligonucleotides”, Gene Ther., Dec. 2011; 18(12): 1111-20.
Li, K. et al., “Ochre Suppressor Transfer RNA Restored Dystrophin Expression in MDX Mice,” Life Sci., Jan. 1997, vol. 61(15), PL205-PL209.
Lomeli et al., “Control of Kinetic Properties of AMPA Receptor Channels by Nuclear RNA Editing” Science, Dec. 9, 1994, 266(5191): pp. 1709-1713.
Long, C. et al., “Prevention of muscular dystrophy in mice by CRISPR/Cas9-mediated editing of germline DNA”, Science, Sep. 5, 2014, vol. 345(6201), pp. 1184-1188.
Long, C. et al., “Postnatal genome editing partially restores dystrophin expression in a mouse model of muscular dystrophy”, Science, Jan. 22, 2016, vol. 351(6271), pp. 400-403.
Macbeth et al., “Evidence for auto-inhibition by the N terminus of hADAR2 and activation by dsRNA binding”, RNA, Oct. 2004, vol. 10, pp. 1563-71.
Mah, J., “Current and emerging treatment strategies for Duchenne muscular dystrophy”, Neuropsychiatr. Dis. Treat., Jul. 22, 2016, vol. 12, 1795-1807.
Mali, P. et al., “RNA-Guided Human Genome Engineering via Cas9”, Science, Feb. 15, 2013, vol. 339(6121), pp. 823-826.
Malik V. et al., “Gentamicin-Induced Readthrough of Stop Codons in Duchenne Muscular Dystrophy”, Ann. Neurol., May 25, 2010, vol. 67(6), pp. 771-780.
Melcher, T. et al., “A mammalian RNA editing enzyme”, Nature, Feb. 1, 1996, vol. 379, pp. 460-464.
Montiel-Gonzalez et al., “Correction of mutations within the cystic fibrosis transmembrane conductance regulator by site-directed RNA editing”, PNAS, Nov. 5, 2013, 110(45), pp. 18285-18290.
Mort, M., Ivanov, D., Cooper, D. N. & Chuzhanova, N.A., “A Meta-Analysis of Nonsense Mutations Causing Human Genetic Disease”, Hum. Mutation, Aug. 1, 2008, 29(8), 1037-1047.
Nelson, C. E. et al., “In vivo genome editing improves muscle function in a mouse model of Duchenne muscular dystrophy,” Science, Jan. 22, 2016, vol. 351(6271), pp. 403-407.
Nishikura, “Functions and Regulation of RNA Editing by ADAR Deaminases”, Annu Rev Biochem., Oct. 12, 2010, 79, pp. 321-349.
Fujisawa, Masaki, Office Action, Japan Patent Office, Application No. 2019-547704, dated Jan. 4, 2022.
Andres, Serge, Extended European Search Report, European Patent Office, Application No. 18760638.9, dated Oct. 15, 2021.
Yamashita, Takenari et al., “Rescue of amyotrophic lateral sclerosis phenotype in a mouse model by intravenous AAV9-ADAR2 delivery to motor neurons”, EMBO Mol Med, Nov. 2013, 5, pp. 1710-1719.
Fujisawa, Masaki, Final Office Action, Application No. 2019-547704, Japan Patent Office, dated Oct. 18, 2022.
Related Publications (1)
Number Date Country
20210198673 A1 Jul 2021 US
Provisional Applications (2)
Number Date Country
62551732 Aug 2017 US
62466961 Mar 2017 US
Continuations (2)
Number Date Country
Parent 16864911 May 2020 US
Child 17170671 US
Parent 16490494 US
Child 16864911 US