Cas variants for gene editing

Information

  • Patent Grant
  • 10465176
  • Patent Number
    10,465,176
  • Date Filed
    Friday, December 12, 2014
    10 years ago
  • Date Issued
    Tuesday, November 5, 2019
    5 years ago
Abstract
Some aspects of this disclosure provide strategies, systems, reagents, methods, and kits that are useful for the targeted editing of nucleic acids, including editing a single site within the genome of a cell or subject, e.g., within the human genome. In some embodiments, fusion proteins of Cas9 and nucleic acid editing enzymes or enzyme domains, e.g., deaminase domains, are provided. In some embodiments, methods for targeted nucleic acid editing are provided. In some embodiments, reagents and kits for the generation of targeted nucleic acid editing proteins, e.g., fusion proteins of Cas9 and nucleic acid editing enzymes or domains, are provided.
Description
BACKGROUND OF THE INVENTION

Targeted editing of nucleic acid sequences, for example, the introduction of a specific modification into genomic DNA, is a highly promising approach for the study of gene function and also has the potential to provide new therapies for human genetic diseases.1 An ideal nucleic acid editing technology possesses three characteristics: (1) high efficiency of installing the desired modification; (2) minimal off-target activity; and (3) the ability to be programmed to edit precisely any site in a given nucleic acid, e.g., any site within the human genome.2 Current genome engineering tools, including engineered zinc finger nucleases (ZFNs),3 transcription activator like effector nucleases (TALENs),4 and most recently, the RNA-guided DNA endonuclease Cas9,5 effect sequence-specific DNA cleavage in a genome. This programmable cleavage can result in mutation of the DNA at the cleavage site via non-homologous end joining (NHEJ) or replacement of the DNA surrounding the cleavage site via homology-directed repair (HDR).6,7


One drawback to the current technologies is that both NHEJ and HDR are stochastic processes that typically result in modest gene editing efficiencies as well as unwanted gene alterations that can compete with the desired alteration.8 Since many genetic diseases in principle can be treated by effecting a specific nucleotide change at a specific location in the genome (for example, a C to T change in a specific codon of a gene associated with a disease),9 the development of a programmable way to achieve such precision gene editing would represent both a powerful new research tool, as well as a potential new approach to gene editing-based human therapeutics.


SUMMARY OF THE INVENTION

The clustered regularly interspaced short palindromic repeat (CRISPR) system is a recently discovered prokaryotic adaptive immune system10 that has been modified to enable robust and general genome engineering in a variety of organisms and cell lines.11 CRISPR-Cas (CRISPR associated) systems are protein-RNA complexes that use an RNA molecule (sgRNA) as a guide to localize the complex to a target DNA sequence via base-pairing.12 In the natural systems, a Cas protein then acts as an endonuclease to cleave the targeted DNA sequence.13 The target DNA sequence must be both complementary to the sgRNA, and also contain a “protospacer-adjacent motif” (PAM) dinucleotide at the 3′-end of the complementary region in order for the system to function (FIG. 1).14 Among the known Cas proteins, S. pyogenes Cas9 has been mostly widely used as a tool for genome engineering.15 This Cas9 protein is a large, multi-domain protein containing two distinct nuclease domains. Point mutations can be introduced into Cas9 to abolish nuclease activity, resulting in a dead Cas9 (dCas9) that still retains its ability to bind DNA in a sgRNA-programmed manner.16 In principle, when fused to another protein or domain, dCas9 can target that protein to virtually any DNA sequence simply by co-expression with an appropriate sgRNA.


The potential of the dCas9 complex for genome engineering purposes is immense. Its unique ability to bring proteins to specific sites in a genome programmed by the sgRNA in theory can be developed into a variety of site-specific genome engineering tools beyond nucleases, including transcriptional activators, transcriptional repressors, histone-modifying proteins, integrases, and recombinases.11 Some of these potential applications have recently been implemented through dCas9 fusions with transcriptional activators to afford RNA-guided transcriptional activators,17,18 transcriptional repressors,16,19,20 and chromatin modification enzymes.21 Simple co-expression of these fusions with a variety of sgRNAs results in specific expression of the target genes. These seminal studies have paved the way for the design and construction of readily programmable sequence-specific effectors for the precise manipulation of genomes.


Significantly, 80-90% of protein mutations responsible for human disease arise from the substitution, deletion, or insertion of only a single nucleotide.6 No genome engineering tools, however, have yet been developed that enable the manipulation of a single nucleotide in a general and direct manner. Current strategies for single-base gene correction include engineered nucleases (which rely on the creation of double-strand breaks, DSBs, followed by stochastic, inefficient homology-directed repair, HDR), and DNA-RNA chimeric oligonucleotides.22 The latter strategy involves the design of a RNA/DNA sequence to base pair with a specific sequence in genomic DNA except at the nucleotide to be edited. The resulting mismatch is recognized by the cell's endogenous repair system and fixed, leading to a change in the sequence of either the chimera or the genome. Both of these strategies suffer from low gene editing efficiencies and unwanted gene alterations, as they are subject to both the stochasticity of HDR and the competition between HDR and non-homologous end-joining, NHEJ.23-25 HDR efficiencies vary according to the location of the target gene within the genome,26 the state of the cell cycle,27 and the type of cell/tissue.28 The development of a direct, programmable way to install a specific type of base modification at a precise location in genomic DNA with enzyme-like efficiency and no stochasticity would therefore represent a powerful new approach to gene editing-based research tools and human therapeutics.


Some aspects of this disclosure provide strategies, systems, reagents, methods, and kits that are useful for the targeted editing of nucleic acids, including editing a single site within a subject's genome, e.g., the human genome. In some embodiments, fusion proteins of Cas9 and nucleic acid editing enzymes or enzyme domains, e.g., deaminase domains, are provided. In some embodiments, methods for targeted nucleic acid editing are provided. In some embodiments, reagents and kits for the generation of targeted nucleic acid editing proteins, e.g., fusion proteins of Cas9 and nucleic acid editing enzymes or domains, are provided.


Some aspects of this disclosure provide fusion proteins comprising (i) a nuclease-inactive CAS9 domain; and (ii) a nucleic acid-editing domain. In some embodiments, the nucleic acid-editing domain is a DNA-editing domain. In some embodiments, the nucleic-acid-editing domain is a deaminase domain. In some embodiments, the deaminase is a cytidine deaminase. In some embodiments, the deaminase is an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase. In some embodiments, the deaminase is an APOBEC1 family deaminase. In some embodiments, the deaminase is an activation-induced cytidine deaminase (AID). In some embodiments, the deaminase is an ACF1/ASE deaminase. In some embodiments, the deaminase is an adenosine deaminase. In some embodiments, the deaminase is an ADAT family deaminase. In some embodiments, the nucleic-acid-editing domain is fused to the N-terminus of the CAS9 domain. In some embodiments, the nucleic-acid-editing domain is fused to the C-terminus of the CAS9 domain. In some embodiments, the CAS9 domain and the nucleic-acid-editing domain are fused via a linker. In some embodiments, the linker comprises a (GGGGS)n (SEQ ID NO: 91), a (G)n, an (EAAAK)n (SEQ ID NO: 5), a (GGS)n, an SGSETPGTSESATPES (SEQ ID NO: 93) motif (see, e.g., Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82; the entire contents are incorporated herein by reference), or an (XP)n motif, or a combination of any of these, wherein n is independently an integer between 1 and 30.


Some aspects of this disclosure provide methods for DNA editing. In some embodiments, the methods comprise contacting a DNA molecule with (a) a fusion protein comprising a nuclease-inactive Cas9 domain and a deaminase domain; and (b) an sgRNA targeting the fusion protein of (a) to a target nucleotide sequence of the DNA strand; wherein the DNA molecule is contacted with the fusion protein and the sgRNA in an amount effective and under conditions suitable for the deamination of a nucleotide base. In some embodiments, the target DNA sequence comprises a sequence associated with a disease or disorder, and wherein the deamination of the nucleotide base results in a sequence that is not associated with a disease or disorder. In some embodiments, the DNA sequence comprises a T>C or A>G point mutation associated with a disease or disorder, and wherein the deamination of the mutant C or G base results in a sequence that is not associated with a disease or disorder. In some embodiments, the deamination corrects a point mutation in the sequence associated with the disease or disorder. In some embodiments, the sequence associated with the disease or disorder encodes a protein, and wherein the deamination introduces a stop codon into the sequence associated with the disease or disorder, resulting in a truncation of the encoded protein. In some embodiments, the deamination corrects a point mutation in the PI3KCA gene, thus correcting an H1047R and/or a A3140G mutation. In some embodiments, the contacting is performed in vivo in a subject susceptible to having, having, or diagnosed with the disease or disorder. In some embodiments, the disease or disorder is a disease associated with a point mutation, or a single-base mutation, in the genome. In some embodiments, the disease is a genetic disease, a cancer, a metabolic disease, or a lysosomal storage disease.


Some aspects of this disclosure provide a reporter construct for detecting nucleic-acid-editing activity of a Cas9:DNA-editing domain fusion protein. In some embodiments, the construct comprises (a) a reporter gene comprising a target site for the Cas9 DNA-editing protein, wherein targeted DNA editing results in an increase in expression of the reporter gene; and (b) a promoter sequence that controls expression of the reporter gene. In some embodiments, the construct further comprises (c) a sequence encoding an sgRNA targeting the Cas9 DNA-editing protein to the target site of the reporter gene, wherein expression of the sgRNA is independent of the expression of the reporter gene. In some embodiments, the target site of the reporter gene comprises a premature stop codon, and wherein targeted DNA editing of the template strand by the Cas9 DNA-editing protein results in a conversion of the premature stop codon to a codon encoding an amino acid residue. In some embodiments, the reporter gene encodes a luciferase, a fluorescent protein, or an antibiotic resistance marker.


Some aspects of this disclosure provide kits comprising a nucleic acid construct that comprises a sequence encoding a nuclease-inactive Cas9 sequence, a sequence comprising a cloning site positioned to allow cloning of a sequence encoding a nucleic acid-editing enzyme or enzyme domain in-frame with the Cas9-encoding sequence, and, optionally, a sequence encoding a linker positioned between the Cas9 encoding sequence and the cloning site. In addition, in some embodiments, the kit comprises suitable reagents, buffers, and/or instructions for in-frame cloning of a sequence encoding a nucleic acid-editing enzyme or enzyme domain into the nucleic acid construct to generate a Cas9 nucleic acid editing fusion protein. In some embodiments, the sequence comprising the cloning site is N-terminal of the Cas9 sequence. In some embodiments, the sequence comprising the cloning site is C-terminal of the Cas9 sequence. In some embodiments, the encoded linker comprises a (GGGGS)n (SEQ ID NO: 91), a (G)n, an (EAAAK)n(SEQ ID NO: 5), a (GGS)n, an SGSETPGTSESATPES (SEQ ID NO: 93) motif (see, e.g., Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82; the entire contents are incorporated herein by reference), or an (XP)n motif, or a combination of any of these, wherein n is independently an integer between 1 and 30.


Some aspects of this disclosure provide kits comprising a fusion protein comprising a nuclease-inactive Cas9 domain and a nucleic acid-editing enzyme or enzyme domain, and, optionally, a linker positioned between the Cas9 domain and the nucleic acid-editing enzyme or enzyme domain. In addition, in some embodiments, the kit comprises suitable reagents, buffers, and/or instructions for using the fusion protein, e.g., for in vitro or in vivo DNA or RNA editing. In some embodiments, the kit comprises instructions regarding the design and use of suitable sgRNAs for targeted editing of a nucleic acid sequence.


The summary above is meant to illustrate, in a non-limiting manner, some of the embodiments, advantages, features, and uses of the technology disclosed herein. Other embodiments, advantages, features, and uses of the technology disclosed herein will be apparent from the Detailed Description, the Drawings, the Examples, and the Claims.





BRIEF DESCRIPTION OF THE DRAWINGS


FIG. 1. The Cas9/sgRNA-DNA complex. The 3′ end of the sgRNA forms a ribonucleoprotein complex with the Cas9 nuclease, while the 20 nt 5′ end of the sgRNA recognizes its complementary stretch of DNA. DNA binding requires the 3-nt PAM sequence 5′ to the target DNA. In the case of wtCas9, double-strand DNA cleavage occurs 3 nt from the PAM to produce blunt ends (shown by the arrows). It should be noted that the size of the bubble is unknown.



FIG. 2. Crystal structure of the catalytic domain of APOBEC3G (PDB ID 3E1U). The core secondary structure, which is believed to be conserved among the entire family, consists of a five-stranded β-sheet (arrows) flanked by six α-helices. The active center loop (active site loop), is believed to be responsible for determining deamination specificity. The Zn2+ responsible for catalytic activity is shown as a sphere. Sequences correspond, from top to bottom, to SEQ ID NOs: 97-98.



FIG. 3. Design of luciferase-based reporter assay. The sgRNA will be varied to target numerous sequences that correspond to regions prior to and including the luciferase gene in order to target the mutated start codon (C residue underlined). A “buffer” region will be added between the start codon and the luciferase gene to include codons of only A's and T's (shown as (ZZZ)X). The Shine-Dalgarno sequence is indicated. In some embodiments, it is preferable to keep all C's base-paired to prevent off-target effects.



FIG. 4. Deaminase assay. Sequences correspond, from top to bottom, to SEQ ID NOs: 99-105.



FIG. 5. SDS PAGE gel of ssDNA edited by Cas9-APOBEC1 fusion proteins.





DEFINITIONS

As used herein and in the claims, the singular forms “a,” “an,” and “the” include the singular and the plural reference unless the context clearly indicates otherwise. Thus, for example, a reference to “an agent” includes a single agent and a plurality of such agents.


The term “Cas9” or “Cas9 nuclease” refers to an RNA-guided nuclease comprising a Cas9 protein, or a fragment thereof (e.g., a protein comprising an active or inactive DNA cleavage domain of Cas9, and/or the gRNA binding domain of Cas9). A Cas9 nuclease is also referred to sometimes as a casn1 nuclease or a CRISPR (clustered regularly interspaced short palindromic repeat)-associated nuclease. CRISPR is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). In type II CRISPR systems correct processing of pre-crRNA requires a trans-encoded small RNA (tracrRNA), endogenous ribonuclease 3 (rnc) and a Cas9 protein. The tracrRNA serves as a guide for ribonuclease 3-aided processing of pre-crRNA. Subsequently, Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer. The target strand not complementary to crRNA is first cut endonucleolytically, then trimmed 3′-5′ exonucleolytically. In nature, DNA-binding and cleavage typically requires protein and both RNAs. However, single guide RNAs (“sgRNA”, or simply “gNRA”) can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M., Chylinski K., Fonfara I., Hauer M., Doudna J. A., Charpentier E. Science 337:816-821(2012), the entire contents of which is hereby incorporated by reference. Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self. Cas9 nuclease sequences and structures are well known to those of skill in the art (see, e.g., “Complete genome sequence of an M1 strain of Streptococcus pyogenes.” Ferretti et al., J. J., McShan W. M., Ajdic D. J., Savic D. J., Savic G., Lyon K., Primeaux C., Sezate S., Suvorov A. N., Kenton S., Lai H. S., Lin S. P., Qian Y., Jia H. G., Najar F. Z., Ren Q., Zhu H., Song L., White J., Yuan X., Clifton S. W., Roe B. A., McLaughlin R. E., Proc. Natl. Acad. Sci. U.S.A. 98:4658-4663(2001); “CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III.” Deltcheva E., Chylinski K., Sharma C. M., Gonzales K., Chao Y., Pirzada Z. A., Eckert M. R., Vogel J., Charpentier E., Nature 471:602-607(2011); and “A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity.” Jinek M., Chylinski K., Fonfara I., Hauer M., Doudna J. A., Charpentier E. Science 337:816-821(2012), the entire contents of each of which are incorporated herein by reference). Cas9 orthologs have been described in various species, including, but not limited to, S. pyogenes and S. thermophilus. Additional suitable Cas9 nucleases and sequences will be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier, “The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference. In some embodiments, a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain.


A nuclease-inactivated Cas9 protein may interchangeably be referred to as a “dCas9” protein (for nuclease-“dead” Cas9). Methods for generating a Cas9 protein (or a fragment thereof) having an inactive DNA cleavage domain are known (See, e.g., Jinek et al., Science. 337:816-821(2012); Qi et al., “Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression” (2013) Cell. 28; 152(5):1173-83, the entire contents of each of which are incorporated herein by reference). For example, the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvC1 subdomain. The HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvC1 subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9. For example, the mutations D10A and H841A completely inactivate the nuclease activity of S. pyogenes Cas9 (Jinek et al., Science. 337:816-821(2012); Qi et al., Cell. 28; 152(5):1173-83 (2013). In some embodiments, proteins comprising fragments of Cas9 are provided. For example, in some embodiments, a protein comprises one of two Cas9 domains: (1) the gRNA binding domain of Cas9; or (2) the DNA cleavage domain of Cas9. In some embodiments, proteins comprising Cas9 or fragments thereof are referred to as “Cas9 variants.” A Cas9 variant shares homology to Cas9, or a fragment thereof. For example a Cas9 variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to wild type Cas9. In some embodiments, the Cas9 variant comprises a fragment of Cas9 (e.g., a gRNA binding domain or a DNA-cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to the corresponding fragment of wild type Cas9. In some embodiments, wild type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCBI Reference Sequence: NC_017053.1, SEQ ID NO:1 (nucleotide); SEQ ID NO:2 (amino acid)).









(SEQ ID NO: 1)


ATGGATAAGAAATACTCAATAGGCTTAGATATCGGCACAAATAGCGTCGG





ATGGGCGGTGATCACTGATGATTATAAGGTTCCGTCTAAAAAGTTCAAGG





TTCTGGGAAATACAGACCGCCACAGTATCAAAAAAAATCTTATAGGGGCT





CTTTTATTTGGCAGTGGAGAGACAGCGGAAGCGACTCGTCTCAAACGGAC





AGCTCGTAGAAGGTATACACGTCGGAAGAATCGTATTTGTTATCTACAGG





AGATTTTTTCAAATGAGATGGCGAAAGTAGATGATAGTTTCTTTCATCGA





CTTGAAGAGTCTTTTTTGGTGGAAGAAGACAAGAAGCATGAACGTCATCC





TATTTTTGGAAATATAGTAGATGAAGTTGCTTATCATGAGAAATATCCAA





CTATCTATCATCTGCGAAAAAAATTGGCAGATTCTACTGATAAAGCGGAT





TTGCGCTTAATCTATTTGGCCTTAGCGCATATGATTAAGTTTCGTGGTCA





TTTTTTGATTGAGGGAGATTTAAATCCTGATAATAGTGATGTGGACAAAC





TATTTATCCAGTTGGTACAAATCTACAATCAATTATTTGAAGAAAACCCT





ATTAACGCAAGTAGAGTAGATGCTAAAGCGATTCTTTCTGCACGATTGAG





TAAATCAAGACGATTAGAAAATCTCATTGCTCAGCTCCCCGGTGAGAAGA





GAAATGGCTTGTTTGGGAATCTCATTGCTTTGTCATTGGGATTGACCCCT





AATTTTAAATCAAATTTTGATTTGGCAGAAGATGCTAAATTACAGCTTTC





AAAAGATACTTACGATGATGATTTAGATAATTTATTGGCGCAAATTGGAG





ATCAATATGCTGATTTGTTTTTGGCAGCTAAGAATTTATCAGATGCTATT





TTACTTTCAGATATCCTAAGAGTAAATAGTGAAATAACTAAGGCTCCCCT





ATCAGCTTCAATGATTAAGCGCTACGATGAACATCATCAAGACTTGACTC





TTTTAAAAGCTTTAGTTCGACAACAACTTCCAGAAAAGTATAAAGAAATC





TTTTTTGATCAATCAAAAAACGGATATGCAGGTTATATTGATGGGGGAGC





TAGCCAAGAAGAATTTTATAAATTTATCAAACCAATTTTAGAAAAAATGG





ATGGTACTGAGGAATTATTGGTGAAACTAAATCGTGAAGATTTGCTGCGC





AAGCAACGGACCTTTGACAACGGCTCTATTCCCCATCAAATTCACTTGGG





TGAGCTGCATGCTATTTTGAGAAGACAAGAAGACTTTTATCCATTTTTAA





AAGACAATCGTGAGAAGATTGAAAAAATCTTGACTTTTCGAATTCCTTAT





TATGTTGGTCCATTGGCGCGTGGCAATAGTCGTTTTGCATGGATGACTCG





GAAGTCTGAAGAAACAATTACCCCATGGAATTTTGAAGAAGTTGTCGATA





AAGGTGCTTCAGCTCAATCATTTATTGAACGCATGACAAACTTTGATAAA





AATCTTCCAAATGAAAAAGTACTACCAAAACATAGTTTGCTTTATGAGTA





TTTTACGGTTTATAACGAATTGACAAAGGTCAAATATGTTACTGAGGGAA





TGCGAAAACCAGCATTTCTTTCAGGTGAACAGAAGAAAGCCATTGTTGAT





TTACTCTTCAAAACAAATCGAAAAGTAACCGTTAAGCAATTAAAAGAAGA





TTATTTCAAAAAAATAGAATGTTTTGATAGTGTTGAAATTTCAGGAGTTG





AAGATAGATTTAATGCTTCATTAGGCGCCTACCATGATTTGCTAAAAATT





ATTAAAGATAAAGATTTTTTGGATAATGAAGAAAATGAAGATATCTTAGA





GGATATTGTTTTAACATTGACCTTATTTGAAGATAGGGGGATGATTGAGG





AAAGACTTAAAACATATGCTCACCTCTTTGATGATAAGGTGATGAAACAG





CTTAAACGTCGCCGTTATACTGGTTGGGGACGTTTGTCTCGAAAATTGAT





TAATGGTATTAGGGATAAGCAATCTGGCAAAACAATATTAGATTTTTTGA





AATCAGATGGTTTTGCCAATCGCAATTTTATGCAGCTGATCCATGATGAT





AGTTTGACATTTAAAGAAGATATTCAAAAAGCACAGGTGTCTGGACAAGG





CCATAGTTTACATGAACAGATTGCTAACTTAGCTGGCAGTCCTGCTATTA





AAAAAGGTATTTTACAGACTGTAAAAATTGTTGATGAACTGGTCAAAGTA





ATGGGGCATAAGCCAGAAAATATCGTTATTGAAATGGCACGTGAAAATCA





GACAACTCAAAAGGGCCAGAAAAATTCGCGAGAGCGTATGAAACGAATCG





AAGAAGGTATCAAAGAATTAGGAAGTCAGATTCTTAAAGAGCATCCTGTT





GAAAATACTCAATTGCAAAATGAAAAGCTCTATCTCTATTATCTACAAAA





TGGAAGAGACATGTATGTGGACCAAGAATTAGATATTAATCGTTTAAGTG





ATTATGATGTCGATCACATTGTTCCACAAAGTTTCATTAAAGACGATTCA





ATAGACAATAAGGTACTAACGCGTTCTGATAAAAATCGTGGTAAATCGGA





TAACGTTCCAAGTGAAGAAGTAGTCAAAAAGATGAAAAACTATTGGAGAC





AACTTCTAAACGCCAAGTTAATCACTCAACGTAAGTTTGATAATTTAACG





AAAGCTGAACGTGGAGGTTTGAGTGAACTTGATAAAGCTGGTTTTATCAA





ACGCCAATTGGTTGAAACTCGCCAAATCACTAAGCATGTGGCACAAATTT





TGGATAGTCGCATGAATACTAAATACGATGAAAATGATAAACTTATTCGA





GAGGTTAAAGTGATTACCTTAAAATCTAAATTAGTTTCTGACTTCCGAAA





AGATTTCCAATTCTATAAAGTACGTGAGATTAACAATTACCATCATGCCC





ATGATGCGTATCTAAATGCCGTCGTTGGAACTGCTTTGATTAAGAAATAT





CCAAAACTTGAATCGGAGTTTGTCTATGGTGATTATAAAGTTTATGATGT





TCGTAAAATGATTGCTAAGTCTGAGCAAGAAATAGGCAAAGCAACCGCAA





AATATTTCTTTTACTCTAATATCATGAACTTCTTCAAAACAGAAATTACA





CTTGCAAATGGAGAGATTCGCAAACGCCCTCTAATCGAAACTAATGGGGA





AACTGGAGAAATTGTCTGGGATAAAGGGCGAGATTTTGCCACAGTGCGCA





AAGTATTGTCCATGCCCCAAGTCAATATTGTCAAGAAAACAGAAGTACAG





ACAGGCGGATTCTCCAAGGAGTCAATTTTACCAAAAAGAAATTCGGACAA





GCTTATTGCTCGTAAAAAAGACTGGGATCCAAAAAAATATGGTGGTTTTG





ATAGTCCAACGGTAGCTTATTCAGTCCTAGTGGTTGCTAAGGTGGAAAAA





GGGAAATCGAAGAAGTTAAAATCCGTTAAAGAGTTACTAGGGATCACAAT





TATGGAAAGAAGTTCCTTTGAAAAAAATCCGATTGACTTTTTAGAAGCTA





AAGGATATAAGGAAGTTAAAAAAGACTTAATCATTAAACTACCTAAATAT





AGTCTTTTTGAGTTAGAAAACGGTCGTAAACGGATGCTGGCTAGTGCCGG





AGAATTACAAAAAGGAAATGAGCTGGCTCTGCCAAGCAAATATGTGAATT





TTTTATATTTAGCTAGTCATTATGAAAAGTTGAAGGGTAGTCCAGAAGAT





AACGAACAAAAACAATTGTTTGTGGAGCAGCATAAGCATTATTTAGATGA





GATTATTGAGCAAATCAGTGAATTTTCTAAGCGTGTTATTTTAGCAGATG





CCAATTTAGATAAAGTTCTTAGTGCATATAACAAACATAGAGACAAACCA





ATACGTGAACAAGCAGAAAATATTATTCATTTATTTACGTTGACGAATCT





TGGAGCTCCCGCTGCTTTTAAATATTTTGATACAACAATTGATCGTAAAC





GATATACGTCTACAAAAGAAGTTTTAGATGCCACTCTTATCCATCAATCC





ATCACTGGTCTTTATGAAACACGCATTGATTTGAGTCAGCTAGGAGGTGA





CTGA





(SEQ ID NO: 2)


MDKKYSIGLDIGTNSVGWAVITDDYKVPSKKFKVLGNTDRHSIKKNLIGA






LLFGSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR






LEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLADSTDKAD





LRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQIYNQLFEENP





INASRVDAKAILSARLSKSRRLENLIAQLPGEKRNGLFGNLIALSLGLTP





NFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAI





LLSDILRVNSEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEI





FFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLR





KQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPY





YVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDK





NLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVD





LLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGAYHDLLKI





IKDKDFLDNEENEDILEDIVLTLTLFEDRGMIEERLKTYAHLFDDKVMKQ





LKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDD





SLTFKEDIQKAQVSGQGHSLHEQIANLAGSPAIKKGILQTVKIVDELVKV






MGHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPV







ENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFIKDDS







IDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLT







KAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIR







EVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKY







PKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEIT







LANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQ







TGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEK






GKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKY





SLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPED





NEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKP





IREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQS





ITGLYETRIDLSQLGGD


(single underline: HNH domain; double


underline: RuvC domain)






In some embodiments, wild type Cas9 corresponds to, or comprises SEQ ID NO:3 (nucleotide) and/or SEQ ID NO: 4 (amino acid):









(SEQ ID NO: 3)


ATGGATAAAAAGTATTCTATTGGTTTAGACATCGGCACTAATTCCGTTGG





ATGGGCTGTCATAACCGATGAATACAAAGTACCTTCAAAGAAATTTAAGG





TGTTGGGGAACACAGACCGTCATTCGATTAAAAAGAATCTTATCGGTGCC





CTCCTATTCGATAGTGGCGAAACGGCAGAGGCGACTCGCCTGAAACGAAC





CGCTCGGAGAAGGTATACACGTCGCAAGAACCGAATATGTTACTTACAAG





AAATTTTTAGCAATGAGATGGCCAAAGTTGACGATTCTTTCTTTCACCGT





TTGGAAGAGTCCTTCCTTGTCGAAGAGGACAAGAAACATGAACGGCACCC





CATCTTTGGAAACATAGTAGATGAGGTGGCATATCATGAAAAGTACCCAA





CGATTTATCACCTCAGAAAAAAGCTAGTTGACTCAACTGATAAAGCGGAC





CTGAGGTTAATCTACTTGGCTCTTGCCCATATGATAAAGTTCCGTGGGCA





CTTTCTCATTGAGGGTGATCTAAATCCGGACAACTCGGATGTCGACAAAC





TGTTCATCCAGTTAGTACAAACCTATAATCAGTTGTTTGAAGAGAACCCT





ATAAATGCAAGTGGCGTGGATGCGAAGGCTATTCTTAGCGCCCGCCTCTC





TAAATCCCGACGGCTAGAAAACCTGATCGCACAATTACCCGGAGAGAAGA





AAAATGGGTTGTTCGGTAACCTTATAGCGCTCTCACTAGGCCTGACACCA





AATTTTAAGTCGAACTTCGACTTAGCTGAAGATGCCAAATTGCAGCTTAG





TAAGGACACGTACGATGACGATCTCGACAATCTACTGGCACAAATTGGAG





ATCAGTATGCGGACTTATTTTTGGCTGCCAAAAACCTTAGCGATGCAATC





CTCCTATCTGACATACTGAGAGTTAATACTGAGATTACCAAGGCGCCGTT





ATCCGCTTCAATGATCAAAAGGTACGATGAACATCACCAAGACTTGACAC





TTCTCAAGGCCCTAGTCCGTCAGCAACTGCCTGAGAAATATAAGGAAATA





TTCTTTGATCAGTCGAAAAACGGGTACGCAGGTTATATTGACGGCGGAGC





GAGTCAAGAGGAATTCTACAAGTTTATCAAACCCATATTAGAGAAGATGG





ATGGGACGGAAGAGTTGCTTGTAAAACTCAATCGCGAAGATCTACTGCGA





AAGCAGCGGACTTTCGACAACGGTAGCATTCCACATCAAATCCACTTAGG





CGAATTGCATGCTATACTTAGAAGGCAGGAGGATTTTTATCCGTTCCTCA





AAGACAATCGTGAAAAGATTGAGAAAATCCTAACCTTTCGCATACCTTAC





TATGTGGGACCCCTGGCCCGAGGGAACTCTCGGTTCGCATGGATGACAAG





AAAGTCCGAAGAAACGATTACTCCATGGAATTTTGAGGAAGTTGTCGATA





AAGGTGCGTCAGCTCAATCGTTCATCGAGAGGATGACCAACTTTGACAAG





AATTTACCGAACGAAAAAGTATTGCCTAAGCACAGTTTACTTTACGAGTA





TTTCACAGTGTACAATGAACTCACGAAAGTTAAGTATGTCACTGAGGGCA





TGCGTAAACCCGCCTTTCTAAGCGGAGAACAGAAGAAAGCAATAGTAGAT





CTGTTATTCAAGACCAACCGCAAAGTGACAGTTAAGCAATTGAAAGAGGA





CTACTTTAAGAAAATTGAATGCTTCGATTCTGTCGAGATCTCCGGGGTAG





AAGATCGATTTAATGCGTCACTTGGTACGTATCATGACCTCCTAAAGATA





ATTAAAGATAAGGACTTCCTGGATAACGAAGAGAATGAAGATATCTTAGA





AGATATAGTGTTGACTCTTACCCTCTTTGAAGATCGGGAAATGATTGAGG





AAAGACTAAAAACATACGCTCACCTGTTCGACGATAAGGTTATGAAACAG





TTAAAGAGGCGTCGCTATACGGGCTGGGGACGATTGTCGCGGAAACTTAT





CAACGGGATAAGAGACAAGCAAAGTGGTAAAACTATTCTCGATTTTCTAA





AGAGCGACGGCTTCGCCAATAGGAACTTTATGCAGCTGATCCATGATGAC





TCTTTAACCTTCAAAGAGGATATACAAAAGGCACAGGTTTCCGGACAAGG





GGACTCATTGCACGAACATATTGCGAATCTTGCTGGTTCGCCAGCCATCA





AAAAGGGCATACTCCAGACAGTCAAAGTAGTGGATGAGCTAGTTAAGGTC





ATGGGACGTCACAAACCGGAAAACATTGTAATCGAGATGGCACGCGAAAA





TCAAACGACTCAGAAGGGGCAAAAAAACAGTCGAGAGCGGATGAAGAGAA





TAGAAGAGGGTATTAAAGAACTGGGCAGCCAGATCTTAAAGGAGCATCCT





GTGGAAAATACCCAATTGCAGAACGAGAAACTTTACCTCTATTACCTACA





AAATGGAAGGGACATGTATGTTGATCAGGAACTGGACATAAACCGTTTAT





CTGATTACGACGTCGATCACATTGTACCCCAATCCTTTTTGAAGGACGAT





TCAATCGACAATAAAGTGCTTACACGCTCGGATAAGAACCGAGGGAAAAG





TGACAATGTTCCAAGCGAGGAAGTCGTAAAGAAAATGAAGAACTATTGGC





GGCAGCTCCTAAATGCGAAACTGATAACGCAAAGAAAGTTCGATAACTTA





ACTAAAGCTGAGAGGGGTGGCTTGTCTGAACTTGACAAGGCCGGATTTAT





TAAACGTCAGCTCGTGGAAACCCGCCAAATCACAAAGCATGTTGCACAGA





TACTAGATTCCCGAATGAATACGAAATACGACGAGAACGATAAGCTGATT





CGGGAAGTCAAAGTAATCACTTTAAAGTCAAAATTGGTGTCGGACTTCAG





AAAGGATTTTCAATTCTATAAAGTTAGGGAGATAAATAACTACCACCATG





CGCACGACGCTTATCTTAATGCCGTCGTAGGGACCGCACTCATTAAGAAA





TACCCGAAGCTAGAAAGTGAGTTTGTGTATGGTGATTACAAAGTTTATGA





CGTCCGTAAGATGATCGCGAAAAGCGAACAGGAGATAGGCAAGGCTACAG





CCAAATACTTCTTTTATTCTAACATTATGAATTTCTTTAAGACGGAAATC





ACTCTGGCAAACGGAGAGATACGCAAACGACCTTTAATTGAAACCAATGG





GGAGACAGGTGAAATCGTATGGGATAAGGGCCGGGACTTCGCGACGGTGA





GAAAAGTTTTGTCCATGCCCCAAGTCAACATAGTAAAGAAAACTGAGGTG





CAGACCGGAGGGTTTTCAAAGGAATCGATTCTTCCAAAAAGGAATAGTGA





TAAGCTCATCGCTCGTAAAAAGGACTGGGACCCGAAAAAGTACGGTGGCT





TCGATAGCCCTACAGTTGCCTATTCTGTCCTAGTAGTGGCAAAAGTTGAG





AAGGGAAAATCCAAGAAACTGAAGTCAGTCAAAGAATTATTGGGGATAAC





GATTATGGAGCGCTCGTCTTTTGAAAAGAACCCCATCGACTTCCTTGAGG





CGAAAGGTTACAAGGAAGTAAAAAAGGATCTCATAATTAAACTACCAAAG





TATAGTCTGTTTGAGTTAGAAAATGGCCGAAAACGGATGTTGGCTAGCGC





CGGAGAGCTTCAAAAGGGGAACGAACTCGCACTACCGTCTAAATACGTGA





ATTTCCTGTATTTAGCGTCCCATTACGAGAAGTTGAAAGGTTCACCTGAA





GATAACGAACAGAAGCAACTTTTTGTTGAGCAGCACAAACATTATCTCGA





CGAAATCATAGAGCAAATTTCGGAATTCAGTAAGAGAGTCATCCTAGCTG





ATGCCAATCTGGACAAAGTATTAAGCGCATACAACAAGCACAGGGATAAA





CCCATACGTGAGCAGGCGGAAAATATTATCCATTTGTTTACTCTTACCAA





CCTCGGCGCTCCAGCCGCATTCAAGTATTTTGACACAACGATAGATCGCA





AACGATACACTTCTACCAAGGAGGTGCTAGACGCGACACTGATTCACCAA





TCCATCACGGGATTATATGAAACTCGGATAGATTTGTCACAGCTTGGGGG





TGACGGATCCCCCAAGAAGAAGAGGAAAGTCTCGAGCGACTACAAAGACC





ATGACGGTGATTATAAAGATCATGACATCGATTACAAGGATGACGATGAC





AAGGCTGCAGGA





(SEQ ID NO: 4)


MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGA






LLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR






LEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKAD





LRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENP





INASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTP





NFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAI





LLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEI





FFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLR





KQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPY





YVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDK





NLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVD





LLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKI





IKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQ





LKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDD





SLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKV






MGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHP







VENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDD







SIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNL







TKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLI







REVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKK







YPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEI







TLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEV







QTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVE






KGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPK





YSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPE





DNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDK





PIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQ





SITGLYETRIDLSQLGGD


(single underline: HNH domain; double


underline: RuvC domain)






In some embodiments, dCas9 corresponds to, or comprises in part or in whole, a Cas9 amino acid sequence having one or more mutations that inactivate the Cas9 nuclease activity. For example, in some embodiments, a dCas9 domain comprises D10A and/or H820A mutation.









dCas9 (D10A and H840A):


(SEQ ID NO: 34)


MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGA






LLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR






LEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKAD





LRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENP





INASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTP





NFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAI





LLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEI





FFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLR





KQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPY





YVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDK





NLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVD





LLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKI





IKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQ





LKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDD





SLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKV






MGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHP







VENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDD







SIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNL







TKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLI







REVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKK







YPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEI







TLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEV







QTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVE






KGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPK





YSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPE





DNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDK





PIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQ





SITGLYETRIDLSQLGGD


(single underline: HNH domain; double


underline: RuvC domain)






In other embodiments, dCas9 variants having mutations other than D10A and H820A are provided, which e.g., result in nuclease inactivated Cas9 (dCas9). Such mutations, by way of example, include other amino acid substitutions at D10 and H820, or other substitutions within the nuclease domains of Cas9 (e.g., substitutions in the HNH nuclease subdomain and/or the RuvC1 subdomain). In some embodiments, variants or homologues of dCas9 (e.g., variants of SEQ ID NO: 34) are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to SEQ ID NO: 34. In some embodiments, variants of dCas9 (e.g., variants of SEQ ID NO: 34) are provided having amino acid sequences which are shorter, or longer than SEQ ID NO: 34, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids or more.


In some embodiments, Cas9 fusion proteins as provided herein comprise the full-length amino acid of a Cas9 protein, e.g., one of the sequences provided above. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length Cas9 sequence, but only a fragment thereof. For example, in some embodiments, a Cas9 fusion protein provided herein comprises a Cas9 fragment, wherein the fragment binds crRNA and tracrRNA or sgRNA, but does not comprise a functional nuclease domain, e.g., in that it comprises only a truncated version of a nuclease domain or no nuclease domain at all. Exemplary amino acid sequences of suitable Cas9 domains and Cas9 fragments are provided herein, and additional suitable sequences of Cas9 domains and fragments will be apparent to those of skill in the art.


In some embodiments, Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs: NC_016782.1, NC_016786.1); Spiroplasma syrphidicola (NCBI Ref: NC_021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma taiwanense (NCBI Ref: NC_021846.1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquisI (NCBI Ref: NC_018721.1); Streptococcus thermophilus (NCBI Ref: YP_820832.1); Listeria innocua (NCBI Ref: NP_472073.1); Campylobacter jejuni (NCBI Ref: YP_002344900.1); or Neisseria. meningitidis (NCBI Ref: YP_002342100.1).


The term “deaminase” refers to an enzyme that catalyzes a deamination reaction. In some embodiments, the deaminase is a cytidine deaminase, catalyzing the hydrolytic deamination of cytidine or deoxycytidine to uracil or deoxyuracil, respectively.


The term “effective amount,” as used herein, refers to an amount of a biologically active agent that is sufficient to elicit a desired biological response. For example, in some embodiments, an effective amount of a nuclease may refer to the amount of the nuclease that is sufficient to induce cleavage of a target site specifically bound and cleaved by the nuclease. In some embodiments, an effective amount of a fusion protein provided herein, e.g., of a fusion protein comprising a nuclease-inactive Cas9 domain and a nucleic acid-editing domain (e.g., a deaminase domain) may refer to the amount of the fusion protein that is sufficient to induce editing of a target site specifically bound and edited by the fusion protein. As will be appreciated by the skilled artisan, the effective amount of an agent, e.g., a fusion protein, a nuclease, a deaminase, a recombinase, a hybrid protein, a protein dimer, a complex of a protein (or protein dimer) and a polynucleotide, or a polynucleotide, may vary depending on various factors as, for example, on the desired biological response, e.g., on the specific allele, genome, or target site to be edited, on the cell or tissue being targeted, and on the agent being used.


The term “linker,” as used herein, refers to a chemical group or a molecule linking two molecules or moieties, e.g., two domains of a fusion protein, such as, for example, a nuclease-inactive Cas9 domain and a nucleic acid-editing domain (e.g., a deaminase domain). In some embodiments, a linker joins a gRNA binding domain of an RNA-programmable nuclease, including a Cas9 nuclease domain, and the catalytic domain of anucleic-acid editing protein. In some embodiments, a linker joins a dCas9 and a nucleic-acid editing protein. Typically, the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two. In some embodiments, the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein). In some embodiments, the linker is an organic molecule, group, polymer, or chemical moiety. In some embodiments, the linker is 5-100 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 30-35, 35-40, 40-45, 45-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-150, or 150-200 amino acids in length. Longer or shorter linkers are also contemplated.


The term “mutation,” as used herein, refers to a substitution of a residue within a sequence, e.g., a nucleic acid or amino acid sequence, with another residue, or a deletion or insertion of one or more residues within a sequence. Mutations are typically described herein by identifying the original residue followed by the position of the residue within the sequence and by the identity of the newly substituted residue. Various methods for making the amino acid substitutions (mutations) provided herein are well known in the art, and are provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)).


The terms “nucleic acid” and “nucleic acid molecule,” as used herein, refer to a compound comprising a nucleobase and an acidic moiety, e.g., a nucleoside, a nucleotide, or a polymer of nucleotides. Typically, polymeric nucleic acids, e.g., nucleic acid molecules comprising three or more nucleotides are linear molecules, in which adjacent nucleotides are linked to each other via a phosphodiester linkage. In some embodiments, “nucleic acid” refers to individual nucleic acid residues (e.g. nucleotides and/or nucleosides). In some embodiments, “nucleic acid” refers to an oligonucleotide chain comprising three or more individual nucleotide residues. As used herein, the terms “oligonucleotide” and “polynucleotide” can be used interchangeably to refer to a polymer of nucleotides (e.g., a string of at least three nucleotides). In some embodiments, “nucleic acid” encompasses RNA as well as single and/or double-stranded DNA. Nucleic acids may be naturally occurring, for example, in the context of a genome, a transcript, an mRNA, tRNA, rRNA, siRNA, snRNA, a plasmid, cosmid, chromosome, chromatid, or other naturally occurring nucleic acid molecule. On the other hand, a nucleic acid molecule may be a non-naturally occurring molecule, e.g., a recombinant DNA or RNA, an artificial chromosome, an engineered genome, or fragment thereof, or a synthetic DNA, RNA, DNA/RNA hybrid, or including non-naturally occurring nucleotides or nucleosides. Furthermore, the terms “nucleic acid,” “DNA,” “RNA,” and/or similar terms include nucleic acid analogs, e.g., analogs having other than a phosphodiester backbone. Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, and backbone modifications. A nucleic acid sequence is presented in the 5′ to 3′ direction unless otherwise indicated. In some embodiments, a nucleic acid is or comprises natural nucleosides (e.g. adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine); nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, O(6)-methylguanine, and 2-thiocytidine); chemically modified bases; biologically modified bases (e.g., methylated bases); intercalated bases; modified sugars (e.g., 2′-fluororibose, ribose, 2′-deoxyribose, arabinose, and hexose); and/or modified phosphate groups (e.g., phosphorothioates and 5′-N-phosphoramidite linkages).


The term “proliferative disease,” as used herein, refers to any disease in which cell or tissue homeostasis is disturbed in that a cell or cell population exhibits an abnormally elevated proliferation rate. Proliferative diseases include hyperproliferative diseases, such as pre-neoplastic hyperplastic conditions and neoplastic diseases. Neoplastic diseases are characterized by an abnormal proliferation of cells and include both benign and malignant neoplasias. Malignant neoplasia is also referred to as cancer.


The terms “protein,” “peptide,” and “polypeptide” are used interchangeably herein, and refer to a polymer of amino acid residues linked together by peptide (amide) bonds. The terms refer to a protein, peptide, or polypeptide of any size, structure, or function. Typically, a protein, peptide, or polypeptide will be at least three amino acids long. A protein, peptide, or polypeptide may refer to an individual protein or a collection of proteins. One or more of the amino acids in a protein, peptide, or polypeptide may be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modification, etc. A protein, peptide, or polypeptide may also be a single molecule or may be a multi-molecular complex. A protein, peptide, or polypeptide may be just a fragment of a naturally occurring protein or peptide. A protein, peptide, or polypeptide may be naturally occurring, recombinant, or synthetic, or any combination thereof. The term “fusion protein” as used herein refers to a hybrid polypeptide which comprises protein domains from at least two different proteins. One protein may be located at the amino-terminal (N-terminal) portion of the fusion protein or at the carboxy-terminal (C-terminal) protein thus forming an “amino-terminal fusion protein” or a “carboxy-terminal fusion protein,” respectively. A protein may comprise different domains, for example, a nucleic acid binding domain (e.g., the gRNA binding domain of Cas9 that directs the binding of the protein to a target site) and a nucleic acid cleavage domain or a catalytic domain of a nucleic-acid editing protein. In some embodiments, a protein comprises a proteinaceous part, e.g., an amino acid sequence constituting a nucleic acid binding domain, and an organic compound, e.g., a compound that can act as a nucleic acid cleavage agent. In some embodiments, a protein is in a complex with, or is in association with, a nucleic acid, e.g., RNA. Any of the proteins provided herein may be produced by any method known in the art. For example, the proteins provided herein may be produced via recombinant protein expression and purification, which is especially suited for fusion proteins comprising a peptide linker. Methods for recombinant protein expression and purification are well known, and include those described by Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)), the entire contents of which are incorporated herein by reference.


The term “RNA-programmable nuclease,” and “RNA-guided nuclease” are used interchangeably herein and refer to a nuclease that forms a complex with (e.g., binds or associates with) one or more RNA that is not a target for cleavage. In some embodiments, an RNA-programmable nuclease, when in a complex with an RNA, may be referred to as a nuclease:RNA complex. Typically, the bound RNA(s) is referred to as a guide RNA (gRNA). gRNAs can exist as a complex of two or more RNAs, or as a single RNA molecule. gRNAs that exist as a single RNA molecule may be referred to as single-guide RNAs (sgRNAs), though “gRNA” is used interchangeably to refer to guide RNAs that exist as either single molecules or as a complex of two or more molecules. Typically, gRNAs that exist as single RNA species comprise two domains: (1) a domain that shares homology to a target nucleic acid (e.g., and directs binding of a Cas9 complex to the target); and (2) a domain that binds a Cas9 protein. In some embodiments, domain (2) corresponds to a sequence known as a tracrRNA, and comprises a stem-loop structure. For example, in some embodiments, domain (2) is homologous to a tracrRNA as depicted in FIG. 1E of Jinek et al., Science 337:816-821(2012), the entire contents of which is incorporated herein by reference. Other examples of gRNAs (e.g., those including domain 2) can be found in U.S. Provisional Patent Application, U.S. Ser. No. 61/874,682, filed Sep. 6, 2013, entitled “Switchable Cas9 Nucleases And Uses Thereof,” and U.S. Provisional Patent Application, U.S. Ser. No. 61/874,746, filed Sep. 6, 2013, entitled “Delivery System For Functional Nucleases,” the entire contents of each are hereby incorporated by reference in their entirety. In some embodiments, a gRNA comprises two or more of domains (1) and (2), and may be referred to as an “extended gRNA.” For example, an extended gRNA will, e.g., bind two or more Cas9 proteins and bind a target nucleic acid at two or more distinct regions, as described herein. The gRNA comprises a nucleotide sequence that complements a target site, which mediates binding of the nuclease/RNA complex to said target site, providing the sequence specificity of the nuclease:RNA complex. In some embodiments, the RNA-programmable nuclease is the (CRISPR-associated system) Cas9 endonuclease, for example Cas9 (Csn1) from Streptococcus pyogenes (see, e.g., “Complete genome sequence of an M1 strain of Streptococcus pyogenes.” Ferretti J. J., McShan W. M., Ajdic D. J., Savic D. J., Savic G., Lyon K., Primeaux C., Sezate S., Suvorov A. N., Kenton S., Lai H. S., Lin S. P., Qian Y., Jia H. G., Najar F. Z., Ren Q., Zhu H., Song L., White J., Yuan X., Clifton S. W., Roe B. A., McLaughlin R. E., Proc. Natl. Acad. Sci. U.S.A. 98:4658-4663(2001); “CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III.” Deltcheva E., Chylinski K., Sharma C. M., Gonzales K., Chao Y., Pirzada Z. A., Eckert M. R., Vogel J., Charpentier E., Nature 471:602-607(2011); and “A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity.” Jinek M., Chylinski K., Fonfara I., Hauer M., Doudna J. A., Charpentier E. Science 337:816-821(2012), the entire contents of each of which are incorporated herein by reference.


Because RNA-programmable nucleases (e.g., Cas9) use RNA:DNA hybridization to target DNA cleavage sites, these proteins are able to be targeted, in principle, to any sequence specified by the guide RNA. Methods of using RNA-programmable nucleases, such as Cas9, for site-specific cleavage (e.g., to modify a genome) are known in the art (see e.g., Cong, L. et al. Multiplex genome engineering using CRISPR/Cas systems. Science 339, 819-823 (2013); Mali, P. et al. RNA-guided human genome engineering via Cas9. Science 339, 823-826 (2013); Hwang, W. Y. et al. Efficient genome editing in zebrafish using a CRISPR-Cas system. Nature biotechnology 31, 227-229 (2013); Jinek, M. et al. RNA-programmed genome editing in human cells. eLife 2, e00471 (2013); Dicarlo, J. E. et al. Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic acids research (2013); Jiang, W. et al. RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Nature biotechnology 31, 233-239 (2013); the entire contents of each of which are incorporated herein by reference).


The term “subject,” as used herein, refers to an individual organism, for example, an individual mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal. In some embodiments, the subject is a non-human primate. In some embodiments, the subject is a rodent. In some embodiments, the subject is a sheep, a goat, a cattle, a cat, or a dog. In some embodiments, the subject is a vertebrate, an amphibian, a reptile, a fish, an insect, a fly, or a nematode. In some embodiments, the subject is a research animal. In some embodiments, the subject is genetically engineered, e.g., a genetically engineered non-human subject. The subject may be of either sex and at any stage of development.


The term “target site” refers to a sequence within a nucleic acid molecule that is deaminated by a deaminase or a fusion protein comprising a deaminase, (e.g., a dCas9-deaminase fusion protein provided herein).


The terms “treatment,” “treat,” and “treating,” refer to a clinical intervention aimed to reverse, alleviate, delay the onset of, or inhibit the progress of a disease or disorder, or one or more symptoms thereof, as described herein. As used herein, the terms “treatment,” “treat,” and “treating” refer to a clinical intervention aimed to reverse, alleviate, delay the onset of, or inhibit the progress of a disease or disorder, or one or more symptoms thereof, as described herein. In some embodiments, treatment may be administered after one or more symptoms have developed and/or after a disease has been diagnosed. In other embodiments, treatment may be administered in the absence of symptoms, e.g., to prevent or delay onset of a symptom or inhibit onset or progression of a disease. For example, treatment may be administered to a susceptible individual prior to the onset of symptoms (e.g., in light of a history of symptoms and/or in light of genetic or other susceptibility factors). Treatment may also be continued after symptoms have resolved, for example, to prevent or delay their recurrence.


DETAILED DESCRIPTION OF CERTAIN EMBODIMENTS OF THE INVENTION

Some aspects of this disclosure provide fusion proteins that comprise a Cas9 domain that binds to a guide RNA (also referred to as gRNA or sgRNA), which, in turn, binds a target nucleic acid sequence via strand hybridization; and a DNA-editing domain, for example, a deaminase domain that can deaminate a nucleobase, such as, for example, cytidine. The deamination of a nucleobase by a deaminase can lead to a point mutation at the respective residue, which is referred to herein as nucleic acid editing. Fusion proteins comprising a Cas9 variant or domain and a DNA editing domain can thus be used for the targeted editing of nucleic acid sequences. Such fusion proteins are useful for targeted editing of DNA in vitro, e.g., for the generation of mutant cells or animals; for the introduction of targeted mutations, e.g., for the correction of genetic defects in cells ex vivo, e.g., in cells obtained from a subject that are subsequently re-introduced into the same or another subject; and for the introduction of targeted mutations, e.g., the correction of genetic defects or the introduction of deactivating mutations in disease-associated genes in a subject. Typically, the Cas9 domain of the fusion proteins described herein does not have any nuclease activity but instead is a Cas9 fragment or a dCas9 protein or domain. Methods for the use of Cas9 fusion proteins as described herein are also provided.


Non-limiting, exemplary nuclease-inactive Cas9 domains are provided herein. One exemplary suitable nuclease-inactive Cas9 domain is the D10A/H840A Cas9 domain mutant:









(SEQ ID NO: 37; see, e.g., Qi et al., Repurposing


CRISPR as an RNA-guided platform for sequence-


specific control of gene expression. Cell. 2013;


152(5): 1173-83, the entire contents of which are


incorporated herein by reference).


MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGA





LLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR





LEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKAD





LRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENP





INASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTP





NFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAI





LLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEI





FFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLR





KQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPY





YVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDK





NLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVD





LLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKI





IKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQ





LKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDD





SLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKV





MGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHP





VENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDD





SIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNL





TKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLI





REVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKK





YPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEI





TLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEV





QTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVE





KGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPK





YSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPE





DNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDK





PIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQ





SITGLYETRIDLSQLGGD






Additional suitable nuclease-inactive Cas9 domains will be apparent to those of skill in the art based on this disclosure. Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology. 2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference).


Fusion Proteins Between Cas9 and Nucleic Acid Editing Enzymes or Domains


Some aspects of this disclosure provide fusion proteins comprising (i) a nuclease-inactive Cas9 enzyme or domain; and (ii) a nucleic acid-editing enzyme or domain. In some embodiments, the nucleic acid-editing enzyme or domain is a DNA-editing enzyme or domain. In some embodiments, the nucleic acid-editing enzyme possesses deaminase activity. In some embodiments, the nucleic acid-editing enzyme or domain comprises or is a deaminase domain. In some embodiments, the deaminase is a cytidine deaminase. In some embodiments, the deaminase is an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase. In some embodiments, the deaminase is an APOBEC1 family deaminase. In some embodiments, the deaminase is an activation-induced cytidine deaminase (AID). In some embodiments, the deaminase is an ACF1/ASE deaminase. In some embodiments, the deaminase is an adenosine deaminase. In some embodiments, the deaminase is an ADAT family deaminase. Some nucleic-acid editing enzymes and domains as well as Cas9 fusion proteins including such enzymes or domains are described in detail herein. Additional suitable nucleic acid-editing enzymes or domains will be apparent to the skilled artisan based on this disclosure.


The instant disclosure provides Cas9:nucleic acid-editing enzyme/domain fusion proteins of various configurations. In some embodiments, the nucleic acid-editing enzyme or domain is fused to the N-terminus of the Cas9 domain. In some embodiments, the nucleic acid-editing enzyme or domain is fused to the C-terminus of the Cas9 domain. In some embodiments, the Cas9 domain and the nucleic acid-editing-editing enzyme or domain are fused via a linker. In some embodiments, the linker comprises a (GGGGS)n (SEQ ID NO: 91), a (G)n, an (EAAAK)n (SEQ ID NO: 5), a (GGS)n, an SGSETPGTSESATPES (SEQ ID NO: 93) motif (see, e.g., Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82; the entire contents are incorporated herein by reference), or an (XP)n motif, or a combination of any of these, wherein n is independently an integer between 1 and 30. In some embodiments, n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30, or, if more than one linker or more than one linker motif is present, any combination thereof. Additional suitable linker motifs and linker configurations will be apparent to those of skill in the art. In some embodiments, suitable linker motifs and configurations include those described in Chen et al., Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. 2013; 65(10):1357-69, the entire contents of which are incorporated herein by reference. Additional suitable linker sequences will be apparent to those of skill in the art based on the instant disclosure.


In some embodiments, the general architecture of exemplary Cas9 fusion proteins provided herein comprises the structure:

[NH2]-[nucleic acid-editing enzyme or domain]-[Cas9]-[COOH] or
[NH2]-[Cas9]-[nucleic acid-editing enzyme or domain]-[COOH],

wherein NH2 is the N-terminus of the fusion protein, and COOH is the C-terminus of the fusion protein.


Additional features may be present, for example, one or more linker sequences between the NLS and the rest of the fusion protein and/or between the nucleic acid-editing enzyme or domain and the Cas9. Other exemplary features that may be present are localization sequences, such as nuclear localization sequences, cytoplasmic localization sequences, export sequences, such as nuclear export sequences, or other localization sequences, as well as sequence tags that are useful for solubilization, purification, or detection of the fusion proteins. Suitable localization signal sequences and sequences of protein tags are provided herein, and include, but are not limited to, biotin carboxylase carrier protein (BCCP) tags, myc-tags, calmodulin-tags, FLAG-tags, hemagglutinin (HA)-tags, polyhistidine tags, also referred to as histidine tags or His-tags, maltose binding protein (MBP)-tags, nus-tags, glutathione-S-transferase (GST)-tags, green fluorescent protein (GFP)-tags, thioredoxin-tags, S-tags, Softags (e.g., Softag 1, Softag 3), strep-tags, biotin ligase tags, FlAsH tags, V5 tags, and SBP-tags. Additional suitable sequences will be apparent to those of skill in the art.


In some embodiments, the nucleic acid-editing enzyme or domain is a deaminase. For example, in some embodiments, the general architecture of exemplary Cas9 fusion proteins with a deaminase enzyme or domain comprises the structure:

[NH2]-[NLS]-[Cas9]-[deaminase]-[COOH],
[NH2]-[NLS]-[deaminase]-[Cas9]-[COOH],
[NH2]-[Cas9]-[deaminase]-[COOH], or
[NH2]-[deaminase]-[Cas9]-[COOH]

wherein NLS is a nuclear localization signal, NH2 is the N-terminus of the fusion protein, and COOH is the C-terminus of the fusion protein. In some embodiments, a linker is inserted between the Cas9 and the deaminase. In some embodiments, the NLS is located C-terminal of the deaminase and/or the Cas9 domain. In some embodiments, the NLS is located between the deaminase and the Cas9 domain. Additional features, such as sequence tags, may also be present


One exemplary suitable type of nucleic acid-editing enzymes and domains are cytosine deaminases, for example, of the APOBEC family. The apolipoprotein B mRNA-editing complex (APOBEC) family of cytosine deaminase enzymes encompasses eleven proteins that serve to initiate mutagenesis in a controlled and beneficial manner.29 One family member, activation-induced cytidine deaminase (AID), is responsible for the maturation of antibodies by converting cytosines in ssDNA to uracils in a transcription-dependent, strand-biased fashion.30 The apolipoprotein B editing complex 3 (APOBEC3) enzyme provides protection to human cells against a certain HIV-1 strain via the deamination of cytosines in reverse-transcribed viral ssDNA.31 These proteins all require a Zn2+-coordinating motif (His-X-Glu-X23-26-Pro-Cys-X24-Cys) and bound water molecule for catalytic activity. The Glu residue acts to activate the water molecule to a zinc hydroxide for nucleophilic attack in the deamination reaction. Each family member preferentially deaminates at its own particular “hotspot”, ranging from WRC (W is A or T, R is A or G) for hAID, to TTC for hAPOBEC3F.32 A recent crystal structure of the catalytic domain of APOBEC3G (FIG. 2) revealed a secondary structure comprised of a five-stranded β-sheet core flanked by six α-helices, which is believed to be conserved across the entire family.33 The active center loops have been shown to be responsible for both ssDNA binding and in determining “hotspot” identity.34 Overexpression of these enzymes has been linked to genomic instability and cancer, thus highlighting the importance of sequence-specific targeting.35


Another exemplary suitable type of nucleic acid-editing enzymes and domains are adenosine deaminases. For example, an ADAT family adenosine deaminase can be fused to a Cas9 domain, e.g., a nuclease-inactive Cas9 domain, thus yielding a Cas9-ADAT fusion protein.


Some aspects of this disclosure provide a systematic series of fusions between Cas9 and deaminase enzymes, e.g., cytosine deaminase enzymes such as APOBEC enzymes, or adenosine deaminase enzymes such as ADAT enzymes, that has been generated in order to direct the enzymatic activities of these deaminases to a specific site in genomic DNA. The advantages of using Cas9 as the recognition agent are twofold: (1) the sequence specificity of Cas9 can be easily altered by simply changing the sgRNA sequence; and (2) Cas9 binds to its target sequence by denaturing the dsDNA, resulting in a stretch of DNA that is single-stranded and therefore a viable substrate for the deaminase. Successful fusion proteins have been generated with human and mouse deaminase domains, e.g., AID domains. A variety of other fusion proteins between the catalytic domains of human and mouse AID and Cas9 are also contemplated. It will be understood that other catalytic domains, or catalytic domains from other deaminases, can also be used to generate fusion proteins with Cas9, and that the disclosure is not limited in this regard.


In some embodiments, fusion proteins of Cas9 and AID are provided. In an effort to engineer Cas9 fusion proteins to increase mutation rates in ssDNA, both mouse and human AID were tethered to gene V of filamentous phage (a nonspecific ssDNA binding protein). The resulting fusion proteins exhibited enhanced mutagenic activities compared to the wild type enzymes in a cell-based assay. This work demonstrates that the enzymatic activity of these proteins is maintained in and can be successfully targeted to genetic sequences with fusion proteins.36


While several crystal structures of Cas9 (and even Cas9 in complex with its sgRNA and target DNA) have been reported, (see, e.g., Jinek M, Jiang F, Taylor D W, Sternberg S H, Kaya E, Ma E, Anders C, Hauer M, Zhou K, Lin S, Kaplan M, lavarone A T, Charpentier E, Nogales E, Doudna J A. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science. 2014; 343(6176):1247997. PMID: 24505130; and Nishimasu H, Ran F A, Hsu P D, Konermann S, Shehata S I, Dohmae N, Ishitani R, Zhang F, Nureki O. Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell. 2014; 156(5):935-49. PMID: 24529477, the entire contents of each of which are incorporated herein by reference), the portion of DNA that is single stranded in the Cas9-DNA complex is unknown (the size of the Cas9-DNA bubble). However, it has been shown in a dCas9 system with a sgRNA specifically designed for the complex to interfere with transcription that transcriptional interference only occurs when the sgRNA binds to the non-template strand. This result suggests that certain portions of the DNA in the DNA-Cas9 complex are unguarded by Cas9, and could potentially be targeted by a deaminase in the fusion protein (see Qi L S, Larson M H, Gilbert L A, Doudna J A, Weissman J S, Arkin A P, Lim W A. Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression. Cell. 2013; 152(5):1173-83. PMID: 23452860, the entire contents of which are incorporated herein by reference). Further supporting this notion, footprinting experiments with exonuclease III and nuclease P1 (which only acts on ssDNA as a substrate) have revealed that at least 26 bases on the non-template strand are susceptible to digestion by these enzymes (see Jinek M, Jiang F, Taylor D W, Sternberg S H, Kaya E, Ma E, Anders C, Hauer M, Zhou K, Lin S, Kaplan M, lavarone A T, Charpentier E, Nogales E, Doudna J A. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science. 2014; 343(6176):1247997. PMID: 24505130). It has also been reported that in certain cases, Cas9 induces single base-substitution mutations in this susceptible stretch of DNA at frequencies as high as 15% (see Tsai S Q, Wyvekens N, Khayter C, Foden J A, Thapar V, Reyon D, Goodwin M J, Aryee M J, Joung J K. Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editing. Nat Biotechnol. 2014; 32(6):569-76. PMID: 24770325, the entire contents of which are incorporated herein by reference). While the mechanism of introduction of these mutations is unknown, in all cases, the base that is mutated is a cytosine, which could possibly indicate the involvement of a cytosine deaminase enzyme. Taken together, these data are clearly consistent with a portion of the target DNA being single stranded and susceptible to other enzymes. It has been shown in a dCas9 system with a sgRNA specifically designed for the complex to interfere with transcription that transcriptional interference only occurs when the sgRNA binds to the non-template strand. This result suggests that certain portions of the DNA in the DNA-Cas9 complex are unguarded by Cas9, and could potentially be targeted by AID in the fusion protein.16 Accordingly, both N-terminal and C-terminal fusions of Cas9 with a deaminase domain are useful according to aspects of this disclosure.


In some embodiments, the deaminase domain and the Cas9 domain are fused to each other via a linker. Various linker lengths and flexibilities between the deaminase domain (e.g., AID) and the Cas9 domain can be employed (e.g., ranging from very flexible linkers of the form (GGGGS)n (SEQ ID NO: 91), (GGS)n, and (G)n to more rigid linkers of the form (EAAAK)n (SEQ ID NO: 5), SGSETPGTSESATPES (SEQ ID NO: 93) (see, e.g., Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82; the entire contents are incorporated herein by reference) and (XP)n)37 in order to achieve the optimal length for deaminase activity for the specific application.


Some exemplary suitable nucleic-acid editing enzymes and domains, e.g., deaminases and deaminase domains, that can be fused to Cas9 domains according to aspects of this disclosure are provided below. It will be understood that, in some embodiments, the active domain of the respective sequence can be used, e.g., the domain without a localizing signal (nuclear localizing signal, without nuclear export signal, cytoplasmic localizing signal).









Human AID:


(SEQ ID NO: 6)



MDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLR






NKNGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRG





NPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIAIMTFKDYFYCWNT





FVENHERTFKAWEGLHENSVRLSRQLRRILLPLYEVDDLRDAFRTLGL


(underline: nuclear localization signal; double


underline: nuclear export signal)





Mouse AID:


(SEQ ID NO: 7)



MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLR






NKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRW





NPNLSLRIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNT





FVENRERTFKAWEGLHENSVRLTRQLRRILLPLYEVDDLRDAFRMLGF


(underline: nuclear localization signal; double


underline: nuclear export signal)





Dog AID:


(SEQ ID NO: 8)



MDSLLMKQRKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLR






NKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRG





YPNLSLRIFAARLYFCEDRKAEPEGLRRLHRAGVQIAIMTFKDYFYCWNT





FVENREKTFKAWEGLHENSVRLSRQLRRILLPLYEVDDLRDAFRTLGL


(underline: nuclear localization signal; double


underline: nuclear export signal)





Bovine AID:


(SEQ ID NO: 9)



MDSLLKKQRQFLYQFKNVRWAKGRHETYLCYVVKRRDSPTSFSLDFGHLR






NKAGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRG





YPNLSLRIFTARLYFCDKERKAEPEGLRRLHRAGVQIAIMTFKDYFYCWN





TFVENHERTFKAWEGLHENSVRLSRQLRRILLPLYEVDDLRDAFRTLGL


(underline: nuclear localization signal; double


underline: nuclear export signal)





Mouse APOBEC-3:


(SEQ ID NO: 10)


MGPFCLGCSHRKCYSPIRNLISQETFKFHFKNLGYAKGRKDTFLCYEVTR





KDCDSPVSLHHGVFKNKDNIHAEICFLYWFHDKVLKVLSPREEFKITWYM






SWSPCFECAEQIVRFLATHHNLSLDIFSSRLYNVQDPETQQNLCRLVQEG






AQVAAMDLYEFKKCWKKFVDNGGRRFRPWKRLLTNFRYQDSKLQEILRPC





YIPVPSSSSSTLSNICLTKGLPETRFCVEGRRMDPLSEEEFYSQFYNQRV





KHLCYYHRMKPYLCYQLEQFNGQAPLKGCLLSEKGKQHAEILFLDKIRSM






ELSQVTITCYLTWSPCPNCAWQLAAFKRDRPDLILHIYTSRLYFHWKRPF






QKGLCSLWQSGILVDVMDLPQFTDCWTNFVNPKRPFWPWKGLEIISRRTQ





RRLRRIKESWGLQDLVNDFGNLQLGPPMS


(italic: nucleic acid editing domain)





Rat APOBEC-3:


(SEQ ID NO: 11)


MGPFCLGCSHRKCYSPIRNLISQETFKFHFKNLRYAIDRKDTFLCYEVTR





KDCDSPVSLHHGVFKNKDNIHAEICFLYWFHDKVLKVLSPREEFKITWYM






SWSPCFECAEQVLRFLATHHNLSLDIFSSRLYNIRDPENQQNLCRLVQEG






AQVAAMDLYEFKKCWKKFVDNGGRRFRPWKKLLTNFRYQDSKLQEILRPC





YIPVPSSSSSTLSNICLTKGLPETRFCVERRRVHLLSEEEFYSQFYNQRV





KHLCYYHGVKPYLCYQLEQFNGQAPLKGCLLSEKGKQHAEILFLDKIRSM






ELSQVIITCYLTWSPCPNCAWQLAAFKRDRPDLILHIYTSRLYFHWKRPF






QKGLCSLWQSGILVDVMDLPQFTDCWTNFVNPKRPFWPWKGLEIISRRTQ





RRLHRIKESWGLQDLVNDFGNLQLGPPMS


(italic: nucleic acid editing domain)





Rhesus macaque APOBEC-3G:


(SEQ ID NO: 12)



MVEPMDPRTFVSNFNNRPILSGLNTVWLCCEVKTKDPSGPPLDAKIFQGK







VYSKAKYHPEM
RFLRWFHKWRQLHHDQEYKVTWYVSWSPCTRCANSVATF






LAKDPKVTLTIFVARLYYFWKPDYQQALRILCQKRGGPHATMKIMNYNEF





QDCWNKFVDGRGKPFKPRNNLPKHYTLLQATLGELLRHLMDPGTFTSNFN





NKPWVSGQHETYLCYKVERLHNDTWVPLNQHRGFLRNQAPNIHGFPKGRH






AELCFLDLIPFWKLDGQQYRVTCFTSWSPCFSCAQEMAKFISNNEHVSLC






IFAARIYDDQGRYQEGLRALHRDGAKIAMMNYSEFEYCWDTFVDRQGRPF





QPWDGLDEHSQALSGRLRAI


(italic: nucleic acid editing domain;


underline: cytoplasmic localization signal)





Chimpanzee APOBEC-3G:


(SEQ ID NO: 13)



MKPHFRNPVERMYQDTFSDNFYNRPILSHRNTVWLCYEVKTKGPSRPPLD







AKIFRGQVYSKLKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC






TRDVATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMK





IMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPP





TFTSNFNNELWVRGRHETYLCYEVERLHNDTWVLLNQRRGFLCNQAPHKH





GFLEGRHAELCFLDVIPFWKLDLHQDYRVTCFTSWSPCFSCAQEMAKFIS





NNKHVSLCIFAARIYDDQGRCQEGLRTLAKAGAKISIMTYSEFKHCWDTF





VDHQGCPFQPWDGLEEHSQALSGRLRAILQNQGN


(italic: nucleic acid editing domain;


underline: cytoplasmic localization signal)





Green monkey APOBEC-3G:


(SEQ ID NO: 14)



MNPQIRNMVEQMEPDIFVYYFNNRPILSGRNTVWLCYEVKTKDPSGPPLD







ANIFQGKLYPEAKDHPEMKFLHWFRKWRQLHRDQEYEVTWYVSWSPCTRC






ANSVATFLAEDPKVTLTIFVARLYYFWKPDYQQALRILCQERGGPHATMK





IMNYNEFQHCWNEFVDGQGKPFKPRKNLPKHYTLLHATLGELLRHVMDPG





TFTSNFNNKPWVSGQRETYLCYKVERSHNDTWVLLNQHRGFLRNQAPDRH





GFPKGRHAELCFLDLIPFWKLDDQQYRVTCFTSWSPCFSCAQKMAKFISN





NKHVSLCIFAARIYDDQGRCQEGLRTLHRDGAKIAVMNYSEFEYCWDTFV





DRQGRPFQPWDGLDEHSQALSGRLRAI


(italic: nucleic acid editing domain;


underline: cytoplasmic localization signal)





Human APOBEC-3G:


(SEQ ID NO: 15)



MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLD







AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC






TRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMK





IMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPP





TFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKH





GFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFIS





KNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTF





VDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQEN


(italic: nucleic acid editing domain;


underline: cytoplasmic localization signal)





Human APOBEC-3F:


(SEQ ID NO: 16)


MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLD





AKIFRGQVYSQPEHHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDCV





AKLAEFLAEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVKIMDDE





EFAYCWENFVYSEGQPFMPWYKFDDNYAFLHRTLKEILRNPMEAMYPHIF





YFHFKNLRKAYGRNESWLCFTMEVVKHHSPVSWKRGVFRNQVDPETHCHA






ERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLT






IFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEP





FKPWKGLKYNFLFLDSKLQEILE


(italic: nucleic acid editing domain)





Human APOBEC-3B:


(SEQ ID NO: 17)


MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLW





DTGVFRGQVYFKPQYHAEMCFLSWFCGNQLPAYKCFQITWFVSWTPCPDC





VAKLAEFLSEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVTIMDY





EEFAYCWENFVYNEGQQFMPWYKFDENYAFLHRTLKEILRYLMDPDTFTF





NFNNDPLVLRRRQTYLCYEVERLDNGTWVLMDQHMGFLCNEAKNLLCGFY





GRHAELRFLDLVPSLQLDPAQIYRVTWFISWSPCFSWGCAGEVRAFLQEN





THVRLRIFAARIYDYDPLYKEALQMLRDAGAQVSIMTYDEFEYCWDTFVY





RQGCPFQPWDGLEEHSQALSGRLRAILQNQGN


(italic: nucleic acid editing domain)





Human APOBEC-3C:


(SEQ ID NO: 18)


MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSW





KTGVFRNQVDSETHCHAERCFLSWFCDDILSPNTKYQVTWYTSWSPCPDC





AGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQEGVAVEIMDY





EDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ


(italic: nucleic acid editing domain)





Human APOBEC-3A:


(SEQ ID NO: 19)


MEASPASGPRHLMDPHIFTSNFNNGIGRHKTYLCYEVERLDNGTSVKMDQ





HRGFLHNQAKNLLCGFYGRHAELRFLDLVPSLQLDPAQIYRVTWFISWSP






CFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQV






SIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQGN


(italic: nucleic acid editing domain)





Human APOBEC-3H:


(SEQ ID NO: 20)


MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENK





KKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHD





HLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPKFADCWENFVD





HEKPLSFNPYKMLEELDKNSRAIKRRLERIKIPGVRAQGRYMDILCDAEV


(italic: nucleic acid editing domain)





Human APOBEC-3D:


(SEQ ID NO: 21)


MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLW





DTGVFRGPVLPKRQSNHRQEVYFRFENHAEMCFLSWFCGNRLPANRRFQI






TWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYYRDRDWRWVLLRL






HKAGARVKIMDYEDFAYCWENFVCNEGQPFMPWYKFDDNYASLHRTLKEI





LRNPMEAMYPHIFYFHFKNLLKACGRNESWLCFTMEVTKHHSAVFRKRGV





FRNQVDPETHCHAERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEV





AEFLARHSNVNLTIFTARLCYFWDTDYQEGLCSLSQEGASVKIMGYKDFV





SCWKNFVYSDDEPFKPWKGLQTNFRLLKRRLREILQ


(italic: nucleic acid editing domain)





Human APOBEC-1:


(SEQ ID NO: 22)


MTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKI





WRSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAI





REFLSRHPGVTLVIYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYY





HCWRNFVNYPPGDEAHWPQYPPLWMMLYALELHCIILSLPPCLKISRRWQ





NHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWR





Mouse APOBEC-1:


(SEQ ID NO: 23)


MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSV





WRHTSQNTSNHVEVNFLEKFTTERYFRPNTRCSITWFLSWSPCGECSRAI





TEFLSRHPYVTLFIYIARLYHHTDQRNRQGLRDLISSGVTIQIMTEQEYC





YCWRNFVNYPPSNEAYWPRYPHLWVKLYVLELYCIILGLPPCLKILRRKQ





PQLTFFTITLQTCHYQRIPPHLLWATGLK





Rat APOBEC-1:


(SEQ ID NO: 24)


MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSI





WRHTSQNTNKHVEVNFIEKFTTERYFCPNTRCSITWFLSWSPCGECSRAI





TEFLSRYPHVTLFIYIARLYHHADPRNRQGLRDLISSGVTIQIMTEQESG





YCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILGLPPCLNILRRKQ





PQLTFFTIALQSCHYQRLPPHILWATGLK





Human ADAT-2:


(SEQ ID NO: 25)


MEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVY





NNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVL





YVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGR





PFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS





Mouse ADAT-2:


(SEQ ID NO: 26)


MEEKVESTTTPDGPCVVSVQETEKWMEEAMRMAKEALENIEVPVGCLMVY





NNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCHQHGQSPSTVFEHTVL





YVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGR





PFQCIPGYRAEEAVELLKTFYKQENPNAPKSKVRKKDCQKS





Mouse ADAT-1:


(SEQ ID NO: 27)


MWTADEIAQLCYAHYNVRLPKQGKPEPNREWTLLAAVVKIQASANQACDI





PEKEVQVTKEVVSMGTGTKCIGQSKMRESGDILNDSHAEIIARRSFQRYL






LHQLHLAAVLKEDSIFVPGTQRGLWRLRPDLSFVFFSSHTPCGDASIIPM







LEFEEQPCCPVIRSWANNSPVQETENLEDSKDKRNCEDPASPVAKKMRLG







TPARSLSNCVAHHGTQESGPVKPDVSSSDLTKEEPDAANGIASGSFRVVD







VYRTGAKCVPGETGDLREPGAAYHQVGLLRVKPGRGDRTCSMSCSDKMAR







WNVLGCQGALLMHFLEKPIYLSAVVIGKCPYSQEAMRRALTGRCEETLVL







PRGFGVQELEIQQSGLLFEQSRCAVHRKRGDSPGRLVPCGAAISWSAVPQ







QPLDVTANGFPQGTTKKEIGSPRARSRISKVELFRSFQKLLSSIADDEQP







DSIRVTKKLDTYQEYKDAASAYQEAWGALRRIQPFASWIRNPPDYHQFK



(italic: nucleic acid editing domain)





Human ADAT-1:


(SEQ ID NO: 28)


MWTADEIAQLCYEHYGIRLPKKGKPEPNHEWTLLAAVVKIQSPADKACDT





PDKPVQVTKEVVSMGTGTKCIGQSKMRKNGDILNDSHAEVIARRSFQRYL






LHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPM







LEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLE







PGTAAREVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGLATVTRIAPGS







AKVIDVYRTGAKCVPGEAGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCS







DKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQRALIGRCQ







NVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISW







SAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIA







RDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQ







FK



(italic: nucleic acid editing domain)






In some embodiments, fusion proteins as provided herein comprise the full-length amino acid of a nucleic acid-editing enzyme, e.g., one of the sequences provided above. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length sequence of a nucleic acid-editing enzyme, but only a fragment thereof. For example, in some embodiments, a fusion protein provided herein comprises a Cas9 domain and a fragment of a nucleic acid-editing enzyme, e.g., wherein the fragment comprises a nucleic acid-editing domain. Exemplary amino acid sequences of nucleic acid-editing domains are shown in the sequences above as italicized letters, and additional suitable sequences of such domains will be apparent to those of skill in the art.


Additional suitable nucleic-acid editing enzyme sequences, e.g., deaminase enzyme and domain sequences, that can be used according to aspects of this invention, e.g., that can be fused to a nuclease-inactive Cas9 domain, will be apparent to those of skill in the art based on this disclosure. In some embodiments, such additional enzyme sequences include deaminase enzyme or deaminase domain sequences that are at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% similar to the sequences provided herein. Additional suitable Cas9 domains, variants, and sequences will also be apparent to those of skill in the art. Examples of such additional suitable Cas9 domains include, but are not limited to, D10A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology. 2013; 31(9): 833-838 the entire contents of which are incorporated herein by reference).


Additional suitable strategies for generating fusion proteins comprising a Cas9 domain and a deaminase domain will be apparent to those of skill in the art based on this disclosure in combination with the general knowledge in the art. Suitable strategies for generating fusion proteins according to aspects of this disclosure using linkers or without the use of linkers will also be apparent to those of skill in the art in view of the instant disclosure and the knowledge in the art. For example, Gilbert et al., CRISPR-mediated modular RNA-guided regulation of transcription in eukaryotes. Cell. 2013; 154(2):442-51, showed that C-terminal fusions of Cas9 with VP64 using 2 NLS's as a linker (SPKKKRKVEAS, SEQ ID NO: 29), can be employed for transcriptional activation. Mali et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nat Biotechnol. 2013; 31(9):833-8, reported that C-terminal fusions with VP64 without linker can be employed for transcriptional activation. And Maeder et al., CRISPR RNA-guided activation of endogenous human genes. Nat Methods. 2013; 10: 977-979, reported that C-terminal fusions with VP64 using a Gly4Ser (SEQ ID NO: 91) linker can be used as transcriptional activators. Recently, dCas9-FokI nuclease fusions have successfully been generated and exhibit improved enzymatic specificity as compared to the parental Cas9 enzyme (In Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82, and in Tsai S Q, Wyvekens N, Khayter C, Foden J A, Thapar V, Reyon D, Goodwin M J, Aryee M J, Joung J K. Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editing. Nat Biotechnol. 2014; 32(6):569-76. PMID: 24770325 a SGSETPGTSESATPES (SEQ ID NO: 93) or a GGGGS (SEQ ID NO: 91) linker was used in FokI-dCas9 fusion proteins, respectively).


Use of Cas9 DNA Editing Fusion Proteins for Correcting Disease-Associated Mutations


Some embodiments provide methods for using the Cas9 DNA editing fusion proteins provided herein. In some embodiments, the fusion protein is used to introduce a point mutation into a nucleic acid by deaminating a target nucleobase, e.g., a C residue. In some embodiments, the deamination of the target nucleobase results in the correction of a genetic defect, e.g., in the correction of a point mutation that leads to a loss of function in a gene product. In some embodiments, the genetic defect is associated with a disease or disorder, e.g., a lysosomal storage disorder or a metabolic disease, such as, for example, type I diabetes. In some embodiments, the methods provided herein are used to introduce a deactivating point mutation into a gene or allele that encodes a gene product that is associated with a disease or disorder. For example, in some embodiments, methods are provided herein that employ a Cas9 DNA editing fusion protein to introduce a deactivating point mutation into an oncogene (e.g., in the treatment of a proliferative disease). A deactivating mutation may, in some embodiments, generate a premature stop codon in a coding sequence, which results in the expression of a truncated gene product, e.g., a truncated protein lacking the function of the full-length protein.


In some embodiments, the purpose of the methods provide herein is to restore the function of a dysfunctional gene via genome editing. The Cas9 deaminase fusion proteins provided herein can be validated for gene editing-based human therapeutics in vitro, e.g., by correcting a disease-associated mutation in human cell culture. It will be understood by the skilled artisan that the fusion proteins provided herein, e.g., the fusion proteins comprising a Cas9 domain and a nucleic acid deaminase domain can be used to correct any single point T→C or A→G mutation. In the first case, deamination of the mutant C back to U corrects the mutation, and in the latter case, deamination of the C that is base-paired with the mutant G, followed by a round of replication, corrects the mutation.


An exemplary disease-relevant mutation that can be corrected by the provided fusion proteins in vitro or in vivo is the H1047R (A3140G) polymorphism in the PI3KCA protein. The phosphoinositide-3-kinase, catalytic alpha subunit (PI3KCA) protein acts to phosphorylate the 3-OH group of the inositol ring of phosphatidylinositol. The PI3KCA gene has been found to be mutated in many different carcinomas, and thus it is considered to be a potent oncogene.50 In fact, the A3140G mutation is present in several NCI-60 cancer cell lines, such as, for example, the HCT116, SKOV3, and T47D cell lines, which are readily available from the American Type Culture Collection (ATCC).51


In some embodiments, a cell carrying a mutation to be corrected, e.g., a cell carrying a point mutation, e.g., an A3140G point mutation in exon 20 of the PI3KCA gene, resulting in a H1047R substitution in the PI3KCA protein, is contacted with an expression construct encoding a Cas9 deaminase fusion protein and an appropriately designed sgRNA targeting the fusion protein to the respective mutation site in the encoding PI3KCA gene. Control experiments can be performed where the sgRNAs are designed to target the fusion enzymes to non-C residues that are within the PI3KCA gene. Genomic DNA of the treated cells can be extracted, and the relevant sequence of the PI3KCA genes PCR amplified and sequenced to assess the activities of the fusion proteins in human cell culture.


It will be understood that the example of correcting point mutations in PI3KCA is provided for illustration purposes and is not meant to limit the instant disclosure. The skilled artisan will understand that the instantly disclosed DNA-editing fusion proteins can be used to correct other point mutations and mutations associated with other cancers and with diseases other than cancer including other proliferative diseases.


The successful correction of point mutations in disease-associated genes and alleles opens up new strategies for gene correction with applications in therapeutics and basic research. Site-specific single-base modification systems like the disclosed fusions of Cas9 and deaminase enzymes or domains also have applications in “reverse” gene therapy, where certain gene functions are purposely suppressed or abolished. In these cases, site-specifically mutating Trp (TGG), Gln (CAA and CAG), or Arg (CGA) residues to premature stop codons (TAA, TAG, TGA) can be used to abolish protein function in vitro, ex vivo, or in vivo.


The instant disclosure provides methods for the treatment of a subject diagnosed with a disease associated with or caused by a point mutation that can be corrected by a Cas9 DNA editing fusion protein provided herein. For example, in some embodiments, a method is provided that comprises administering to a subject having such a disease, e.g., a cancer associated with a PI3KCA point mutation as described above, an effective amount of a Cas9 deaminase fusion protein that corrects the point mutation or introduces a deactivating mutation into the disease-associated gene. In some embodiments, the disease is a proliferative disease. In some embodiments, the disease is a genetic disease. In some embodiments, the disease is a neoplastic disease. In some embodiments, the disease is a metabolic disease. In some embodiments, the disease is a lysosomal storage disease. Other diseases that can be treated by correcting a point mutation or introducing a deactivating mutation into a disease-associated gene will be known to those of skill in the art, and the disclosure is not limited in this respect.


The instant disclosure provides methods for the treatment of additional diseases or disorders, e.g., diseases or disorders that are associated or caused by a point mutation that can be corrected by deaminase-mediated gene editing. Some such diseases are described herein, and additional suitable diseases that can be treated with the strategies and fusion proteins provided herein will be apparent to those of skill in the art based on the instant disclosure. Exemplary suitable diseases and disorders are listed below. It will be understood that the numbering of the specific positions or residues in the respective sequences depends on the particular protein and numbering scheme used. Numbering might be different, e.g., in precursors of a mature protein and the mature protein itself, and differences in sequences from species to species may affect numbering. One of skill in the art will be able to identify the respective residue in any homologous protein and in the respective encoding nucleic acid by methods well known in the art, e.g., by sequence alignment and determination of homologous residues. Exemplary suitable diseases and disorders include, without limitation, cystic fibrosis (see, e.g., Schwank et al., Functional repair of CFTR by CRISPR/Cas9 in intestinal stem cell organoids of cystic fibrosis patients. Cell stem cell. 2013; 13: 653-658; and Wu et. al., Correction of a genetic disease in mouse via use of CRISPR-Cas9. Cell stem cell. 2013; 13: 659-662, neither of which uses a deaminase fusion protein to correct the genetic defect); phenylketonuria—e.g., phenylalanine to serine mutation at position 835 (mouse) or 240 (human) or a homologous residue in phenylalanine hydroxylase gene (T>C mutation)—see, e.g., McDonald et al., Genomics. 1997; 39:402-405; Bernard-Soulier syndrome (BSS)—e.g., phenylalanine to serine mutation at position 55 or a homologous residue, or cysteine to arginine at residue 24 or a homologous residue in the platelet membrane glycoprotein IX (T>C mutation)—see, e.g., Noris et al., British Journal of Haematology. 1997; 97: 312-320, and Ali et al., Hematol. 2014; 93: 381-384; epidermolytic hyperkeratosis (EHK)—e.g., leucine to proline mutation at position 160 or 161 (if counting the initiator methionine) or a homologous residue in keratin 1 (T>C mutation)—see, e.g., Chipev et al., Cell. 1992; 70: 821-828, see also accession number P04264 in the UNIPROT database at www[dot]uniprot[dot]org; chronic obstructive pulmonary disease (COPD)—e.g., leucine to proline mutation at position 54 or 55 (if counting the initiator methionine) or a homologous residue in the processed form of α1-antitrypsin or residue 78 in the unprocessed form or a homologous residue (T>C mutation)—see, e.g., Poller et al., Genomics. 1993; 17: 740-743, see also accession number P01011 in the UNIPROT database; Charcot-Marie-Toot disease type 4J—e.g., isoleucine to threonine mutation at position 41 or a homologous residue in FIG. 4 (T>C mutation)—see, e.g., Lenk et al., PLoS Genetics. 2011; 7: e1002104; neuroblastoma (NB)—e.g., leucine to proline mutation at position 197 or a homologous residue in Caspase-9 (T>C mutation)—see, e.g., Kundu et al., 3 Biotech. 2013, 3:225-234; von Willebrand disease (vWD)—e.g., cysteine to arginine mutation at position 509 or a homologous residue in the processed form of von Willebrand factor, or at position 1272 or a homologous residue in the unprocessed form of von Willebrand factor (T>C mutation)—see, e.g., Lavergne et al., Br. J. Haematol. 1992, see also accession number P04275 in the UNIPROT database; 82: 66-72; myotonia congenital—e.g., cysteine to arginine mutation at position 277 or a homologous residue in the muscle chloride channel gene CLCN1 (T>C mutation)—see, e.g., Weinberger et al., The J. of Physiology. 2012; 590: 3449-3464; hereditary renal amyloidosis—e.g., stop codon to arginine mutation at position 78 or a homologous residue in the processed form of apolipoprotein AII or at position 101 or a homologous residue in the unprocessed form (T>C mutation)—see, e.g., Yazaki et al., Kidney Int. 2003; 64: 11-16; dilated cardiomyopathy (DCM)—e.g., tryptophan to Arginine mutation at position 148 or a homologous residue in the FOXD4 gene (T>C mutation), see, e.g., Minoretti et. al., Int. J. of Mol. Med. 2007; 19: 369-372; hereditary lymphedema—e.g., histidine to arginine mutation at position 1035 or a homologous residue in VEGFR3 tyrosine kinase (A>G mutation), see, e.g., Irrthum et al., Am. J. Hum. Genet. 2000; 67: 295-301; familial Alzheimer's disease—e.g., isoleucine to valine mutation at position 143 or a homologous residue in presenilin1 (A>G mutation), see, e.g., Gallo et. al., J. Alzheimer's disease. 2011; 25: 425-431; Prion disease—e.g., methionine to valine mutation at position 129 or a homologous residue in prion protein (A>G mutation)—see, e.g., Lewis et. al., J. of General Virology. 2006; 87: 2443-2449; chronic infantile neurologic cutaneous articular syndrome (CINCA)—e.g., Tyrosine to Cysteine mutation at position 570 or a homologous residue in cryopyrin (A>G mutation)—see, e.g., Fujisawa et. al. Blood. 2007; 109: 2903-2911; and desmin-related myopathy (DRM)—e.g., arginine to glycine mutation at position 120 or a homologous residue in αB crystallin (A>G mutation)—see, e.g., Kumar et al., J. Biol. Chem. 1999; 274: 24137-24141. The entire contents of all references and database entries is incorporated herein by reference.


It will be apparent to those of skill in the art that in order to target a Cas9:nucleic acid-editing enzyme/domain fusion protein as disclosed herein to a target site, e.g., a site comprising a point mutation to be edited, it is typically necessary to co-express the Cas9:nucleic acid-editing enzyme/domain fusion protein together with a guide RNA, e.g., an sgRNA. As explained in more detail elsewhere herein, a guide RNA typically comprises a tracrRNA framework allowing for Cas9 binding, and a guide sequence, which confers sequence specificity to the Cas9:nucleic acid-editing enzyme/domain fusion protein. In some embodiments, the guide RNA comprises a structure 5′-[guide sequence]-guuuuagagcuagaaauagcaaguuaaaauaaaggcuaguccguuaucaacuugaaaaaguggcaccgagucggugcuuuuu-3′ (SEQ ID NO: 38), wherein the guide sequence comprises a sequence that is complementary to the target sequence. The guide sequence is typically 20 nucleotides long. The sequences of suitable guide RNAs for targeting Cas9:nucleic acid-editing enzyme/domain fusion proteins to specific genomic target sites will be apparent to those of skill in the art based on the instant disclosure. Such suitable guide RNA sequences typically comprise guide sequences that are complementary to a nucleic sequence within 50 nucleotides upstream or downstream of the target nucleotide to be edited. Some exemplary guide RNA sequences suitable for targeting Cas9:nucleic acid-editing enzyme/domain fusion proteins to specific target sequences are provided below.


H1047R (A3140G) polymorphism in the phosphoinositide-3-kinase catalytic alpha subunit (PI3KCA or PIK3CA) (the position of the mutated nucleotide and the respective codon are underlined):









gatgacattgcatacattcgaaagaccctagccttagataaaactgagca


 D  D  I  A  Y  I  R  K  T  L  A  L  D  K  T  E  Q





agaggctttggagtatttcatgaaacaaatgaatgatgcacgtcatggtg


  E  A  L  E  Y  F  M  K  Q  M  N  D  A  R  H  G





gctggacaacaaaaatggattggatcttccacacaattaaacagcatgca


G  W  T  T  K  M  D  W  I  F  H  T  I  K  Q  H  A





ttgaactgaaagataactgagaaaatgaaa


 L  N  -  K  I  T  E  K  M  K


(Nucleotide sequence - SEQ ID NO: 39; protein


sequence - SEQ ID NO: 40).






Exemplary suitable guide sequences for targeting a Cas9:nucleic acid-editing enzyme/domain fusion proteins to the mutant A3140G residue include, without limitation: 5′-aucggaauctauuuugacuc-3′ (SEQ ID NO: 41); 5′-ucggaaucuauuuugacucg-3′ (SEQ ID NO: 42); 5′-cuuagauaaaacugagcaag-3′ (SEQ ID NO: 43); 5′-aucuauuuugacucguucuc-3′ (SEQ ID NO: 44); 5′-uaaaacugagcaagaggcuu-3′ (SEQ ID NO: 45); 5′-ugguggcuggacaacaaaaa-3′ (SEQ ID NO: 46); 5′-gcuggacaacaaaaauggau-3′ (SEQ ID NO: 47); 5′-guguuaauuugucguacgua-3′ (SEQ ID NO: 48). Additional suitable guide sequences for targeting a Cas9:nucleic acid-editing enzyme/domain fusion protein to a mutant PI3KCA sequence, to any of the additional sequences provided below, or to additional mutant sequences associated with a disease will be apparent to those of skill in the art based on the instant disclosure.


Phenylketonuria phenylalanine to serine mutation at residue 240 in phenylalanine hydroxylase gene (T>C mutation) (the position of the mutated nucleotide and the respective codon are underlined):









aatcacatttttccacttcttgaaaagtactgtggcttccatgaagataa


 N  H  I  F  P  L  L  E  K  Y  C  G  F  H  E  D  N





cattccccagctggaagacgtttctcaattcctgcagacttgcactggtc


  I  P  Q  L  E  D  V  S  Q  F  L  Q  T  C  T  G





tccgcctccgacctgtggctggcctgctttcctctcgggatttcttgggt




S
  R  L  R  P  V  A  G  L  L  S  S  R  D  F  L  G






ggcctggccttccgagtcttccactgcaca


 G  L  A  F  R  V  F  H  C  T


(Nucleotide sequence - SEQ ID NO: 49; protein


sequence - SEQ ID NO: 50).






Bernard-Soulier syndrome (BSS)—cysteine to arginine at residue 24 in the platelet membrane glycoprotein IX (T>C mutation):









atgcctgcctggggagccctgttcctgctctgggccacagcagaggccac


 M  P  A  W  G  A  L  F  L  L  W  A  T  A  E  A  T





caaggactgccccagcccacgtacctgccgcgccctggaaaccatggggc


  K  D  C  P  S  P  R  T  C  R  A  L  E  T  M  G  





tgtgggtggactgcaggggccacggactcacggccctgcctgccctgccg


L  W  V  D  C  R  G  H  G  L  T  A  L  P  A  L  P





gcccgcacccgccaccttctgctggccaac


 A  R  T  R  H  L  L  L  A  N


(Nucleotide sequence - SEQ ID NO: 51; protein


sequence - SEQ ID NO: 52).






Epidermolytic hyperkeratosis (EHK)—leucine to proline mutation at residue 161 in keratin 1 (T>C mutation):









ggttatggtcctgtctgccctcctggtggcatacaagaagtcactatcaa


 G  Y  G  P  V  C  P  P  G  G  I  Q  E  V  T  I  N





ccagagccctcttcagcccctcaatgtggagattgaccctgagatccaaa


  Q  S  P  L  Q  P  L  N  V  E  I  D  P  E  I  Q 





aggtgaagtctcgagaaagg


K  V  K  S  R  E  R


(Nucleotide sequence - SEQ ID NO: 53; protein


sequence - SEQ ID NO: 54).






Chronic obstructive pulmonary disease (COPD)—leucine to proline mutation at residue 54 in α1-antitrypsin (T>C mutation):









gtctccctggctgaggatccccagggagatgctgcccagaagacagatac


 V  S  L  A  E  D  P  Q  G  D  A  A  Q  K  T  D  T





atcccaccatgatcaggatcacccaaccttcaacaagatcacccccaacc


  S  H  H  D  Q  D  H  P  T  F  N  K  I  T  P  N







c
ggctgagttcgccttcagcctataccgccagctggcacaccagtccaac





P
  A  E  F  A  F  S  L  Y  R  Q  L  A  H  Q  S  N






agcaccaatatcttcttctccccagtgagc


 S  T  N  I  F  F  S  P  V  S


(Nucleotide sequence - SEQ ID NO: 55; protein


sequence - SEQ ID NO: 56).






Chronic obstructive pulmonary disease (COPD)—leucine to proline mutation at residue 78 in α1-antichymotrypsin (T>C mutation):









gcctccgccaacgtggacttcgctttcagcctgtacaagcagttagtcct


 A  S  A  N  V  D  F  A  F  S  L  Y  K  Q  L  V  L





gaaggcccctgataagaatgtcatcttctccccaccgagcatctccaccg


  K  A  P  D  K  N  V  I  F  S  P  P  S  I  S  T





ccttggccttcctgtctctgggggcccataataccaccctgacagagatt


A  L  A  F  L  S  L  G  A  H  N  T  T  L  T  E  I





ctcaaaggcctcaagttctacctcacggag


 L  K  G  L  K  F  Y  L  T  E





(Nucleotide sequence - SEQ ID NO: 89; protein


sequence - SEQ ID NO: 90).






Neuroblastoma (NB)—leucine to proline mutation at residue 197 in Caspase-9 (T>C mutation):









ggccactgcctcattatcaacaatgtgaacttctgccgtgagtccgggct


 G  H  C  L  I  I  N  N  V  N  F  C  R  E  S  G  L





ccgcacccgcactggctccaacatcgactgtgagaagttgcggcgtcgct


  R  T  R  T  G  S  N  I  D  C  E  K  L  R  R  R





tctcctcgccgcatttcatggtggaggtgaagggcgacctgactgccaag


F  S  S  P  H  F  M  V  E  V  K  G  D  L  T  A  K





aaaatggtgctggctttgctggagctggcg


 K  M  V  L  A  L  L  E  L  A


(Nucleotide sequence - SEQ ID NO: 57; protein


sequence - SEQ ID NO: 58).






Charcot-Marie-Tooth disease type 4J—isoleucine to threonine mutation at residue 41 in FIG. 4 (T>C mutation):









actagagctagatactttctagttgggagcaataatgcagaaacgaaata


 T  R  A  R  Y  F  L  V  H  D  N  N  A  R  T  K  Y





tcgtgtcttgaagactgatagaacagaaccaaaagatttggtcataattg


  R  V  L  K  T  D  R  T  E  P  K  D  L  V  I  I





atgacaggcatgtctatactcaacaagaagtaagggaacttcttggccgc


D  D  R  H  V  Y  T  Q  Q  E  V  R  E  L  L  G  R





ttggatcttggaaatagaacaaagatggga


 L  D  L  G  N  R  T  K  M  G


(Nucleotide sequence - SEQ ID NO: 59; protein


sequence - SEQ ID NO: 60).






von Willebrand disease (vWD)—cysteine to arginine mutation at residue 1272 in von Willebrand factor (T>C mutation):









acagatgccccggtgagccccaccactctgtatgtggaggacatctcgg


 T  D  A  P  V  S  P  T  T  L  Y  V  E  D  I  S





aaccgccgttgcacgatttctaccgcagcaggctactggacctggtctt


E  P  P  L  H  D  F  Y  R  S  R  L  L  D  L  V  F





cctgctggatggctcctccaggctgtccgaggctgagtttgaagtgctg


  L  L  D  G  S  S  R  L  S  E  A  E  F  E  V  L





aaggcctttgtggtggacatgatggagcggctg


 K  A  F  V  V  D  M  M  E  R  L


(Nucleotide sequence - SEQ ID NO: 61; protein


sequence - SEQ ID NO: 62).






Myotonia congenital—cysteine to arginine mutation at position 277 in the muscle chloride channel gene CLCN1 (T>C mutation):









atctgtgctgctgtcctcagcaaattcatgtctgtgttctgcggggtat


 I  C  A  A  V  L  S  K  F  M  S  V  F  C  G  V





atgagcagccatactactactctgatatcctgacggtgggctgtgctgt


Y  E  Q  P  Y  Y  Y  S  D  I  L  T  V  G  C  A  V





gggagtcggccgttgttttgggacaccacttggaggagtgctatttagc


  G  V  G  R  C  F  G  T  P  L  G  G  V  L  F  S





atcgaggtcacctccacctactttgctgttcgg


 I  E  V  T  S  T  Y  F  A  V  R


(Nucleotide sequence - SEQ ID NO: 63; protein


sequence - SEQ ID NO: 64).






Hereditary renal amyloidosis—stop codon to arginine mutation at residue 111 in apolipoprotein AII (T>C mutation):









tactttgaaaagtcaaaggagcagctgacacccctgatcaagaaggctg


 Y  F  E  K  S  K  E  Q  L  T  P  L  I  K  K  A





gaacggaactggttaacttcttgagctatttcgtggaacttggaacaca


G  T  E  L  V  N  F  L  S  Y  F  V  E  L  G  T  Q





gcctgccacccagcgaagtgtccagcaccattgtcttccaaccccagct


  P  A  T  Q  R  S  V  Q  H  H  C  L  P  T  P  A





ggcctctagaacacccactggccagtcctagag


 G  L  -  N  T  H  W  P  V  L  E


(Nucleotide sequence - SEQ ID NO: 65; protein


sequence - SEQ ID NO: 66).






Dilated cardiomyopathy (DCM)—tryptophan to Arginine mutation at position 148 in the FOXD4 gene (T>C mutation):









ccgcacaagcgcctcacgctcagcggcatctgcgccttcattagtgacc


 P  H  K  R  L  T  L  S  G  I  C  A  F  I  S  D 





gcttcccctactaccgccgcaagttccccgcccggcagaacagcatccg


R  F  P  Y  Y  R  R  K  F  P  A  R  Q  N  S  I  R





ccacaacctctcgctgaacgactgcttcgtcaagatcccccgcgagccg


  H  N  L  S  L  N  D  C  F  V  K  I  P  R  E  P





ggccgcccaggcaagggcaactactggagcctg


 G  R  P  G  K  G  N  Y  W  S  L


(Nucleotide sequence - SEQ ID NO: 67; protein


sequence - SEQ ID NO: 68).






Hereditary lymphedema—histidine to arginine mutation at residue 1035 in VEGFR3 tyrosine kinase (A>G mutation):









gctgaggacctgtggctgagcccgctgaccatggaagatcttgtctgct


 A  E  D  L  W  L  S  P  L  T  M  E  D  L  V  C





acagcttccaggtggccagagggatggagttcctggcttcccgaaagtg


Y  S  F  Q  V  A  R  G  M  E  F  L  A  S  R  K  C





catccgcagagacctggctgctcggaacattctgctgtcggaaagcgac


  I  R  R  D  L  A  A  R  N  I  L  L  S  E  S  D





gtggtgaagatctgtgactttggccttgcccgg


 V  V  K  I  C  D  F  G  L  A  R


(Nucleotide sequence - SEQ ID NO: 69; protein


sequence - SEQ ID NO: 70).






Familial Alzheimer's disease—isoleucine to valine mutation at residue 143 in presenilin1 (A>G mutation):









gataccgagactgtgggccagagagccctgcactcaattctgaatgctg


 D  T  E  T  V  G  Q  R  A  L  H  S  I  L  N  A





ccatcatgatcagtgtcgttgttgtcatgactatcctcctggtggttct


A  I  M  I  S  V  V  V  V  M  T  I  L  L  V  V  L





gtataaatacaggtgctataaggtcatccatgcctggcttattatatca


  Y  K  Y  R  C  Y  K  V  I  H  A  W  L  I  I  S





tctctattgttgctgttctttttttcattcatt


 S  L  L  L  L  F  F  F  S  F  I


(Nucleotide sequence - SEQ ID NO: 71; protein


sequence - SEQ ID NO: 72).






Prion disease—methionine to valine mutation at residue 129 in prion protein (A>G mutation):









aagccgagtaagccaaaaaccaacatgaagcacatggctggtgctgcag


 K  P  S  K  P  K  T  N  M  K  H  M  A  G  A  A





cagctggggcagtggtggggggccttggcggctacgtgctgggaagtgc


A  A  G  A  V  V  G  G  L  G  G  Y  V  L  G  S  A





catgagcaggcccatcatacatttcggcagtgactatgaggaccgttac


  M  S  R  P  I  I  H  F  G  S  D  Y  E  D  R  Y





tatcgtgaaaacatgcaccgttaccccaaccaa


 Y  R  E  N  M  H  R  Y  P  N  Q


(Nucleotide sequence - SEQ ID NO: 73; protein


sequence - SEQ ID NO: 74).






Chronic infantile neurologic cutaneous articular syndrome (CINCA)—Tyrosine to Cysteine mutation at residue 570 in cryopyrin (A>G mutation):









cttcccagccgagacgtgacagtccttctggaaaactatggcaaattcg


 L  P  S  R  D  V  T  V  L  L  E  N  Y  G  K  F 





aaaaggggtgtttgatttttgttgtacgtttcctctttggcctggtaaa


E  K  G  C  L  I  F  V  V  R  F  L  F  G  L  V  N





ccaggagaggacctcctacttg


  Q  E  R  T  S  Y  L


(Nucleotide sequence - SEQ ID NO: 75; protein


sequence - SEQ ID NO: 76).






Desmin-related myopathy (DRM)—arginine to glycine mutation at residue 120 in αB crystallin (A>G mutation):









gtgaagcacttctccccagaggaactcaaagttaaggtgttgggagatg


 V  K  H  F  S  P  E  E  L  K  V  K  V  L  G  D





tgattgaggtgcatggaaaacatgaagagcgccaggatgaacatggttt


V  I  E  V  H  G  K  H  E  E  R  Q  D  E  H  G  F





catctccagggagttccacgggaaataccggatcccagctgatgtagac


  I  S  R  E  F  H  G  K  Y  R  I  P  A  D  V  D





cctctcaccattacttcatccctgtcatctgat


 P  L  T  I  T  S  S  L  S  S  D


(Nucleotide sequence - SEQ ID NO: 77; protein


sequence - SEQ ID NO: 78).






Beta-thalassemia-one example is leucine to proline mutation at residue 115 in Hemoglobin B.









gagctgcactgtgacaagctgcacgtggatcctgagaacttcaggctcc


 E  L  H  C  D  K  L  H  V  D  P  E  N  F  R  L





tgggcaacgtgctggtctgtgtgccggcccatcactttggcaaagaatt


L  G  N  V  L  V  C  V  P  A  H  H  F  G  K  E  F





caccccaccagtgcaggctgcctatcagaaagtggtggctggtgtggct


  T  P  P  V  Q  A  A  Y  Q  K  V  V  A  G  V  A  





aatgccctggcccacaagtatcactaagctcgc


 N  A  L  A  H  K  Y  H  -  A  R


(Nucleotide sequence - SEQ ID NO: 79; protein


sequence - SEQ ID NO: 80).







It is to be understood that the sequences provided above are exemplary and not meant to be limiting the scope of the instant disclosure. Additional suitable sequences of point mutations that are associated with disease and amenable to correction by Cas9:nucleic acid-editing enzyme/domain fusion proteins as well as suitable guide RNA sequences will be apparent to those of skill in the art based on this disclosure.


Reporter Systems


Some aspects of this disclosure provide a reporter system that can be used for detecting deaminase activity of the fusion proteins described herein. In some embodiments, the reporter system is a luciferase-based assay in which deaminase activity leads to expression of luciferase. To minimize the impact of potential substrate promiscuity of the deaminase domain (e.g., the AID domain), the number of residues that could unintentionally be targeted for deamination (e.g., off-target C residues that could potentially reside on ssDNA within the reporter system) is minimized. In some embodiments, an intended target residue is be located in an ACG mutated start codon of the luciferase gene that is unable to initiate translation. Desired deaminase activity results in a ACG>AUG modification, thus enabling translation of luciferase and detection and quantification of the deaminase activity.


In some embodiments, in order to minimize single-stranded C residues, a leader sequence is inserted between the mutated start codon and the beginning of the luciferase gene which consists of a stretch of Lys (AAA), Asn (AAT), Leu (TTA), Ile (ATT, ATA), Tyr (TAT), or Phe (TTT) residues. The resulting mutants can be tested to ensure that the leader sequence does not adversely affect luciferase expression or activity. Background luciferase activity with the mutated start codon can be determined as well.


The reporter system can be used to test many different sgRNAs, e.g., in order to determine which residue(s) with respect to the target DNA sequence the respective deaminase (e.g., AID enzyme) will target (FIG. 3). Because the size of the Cas9-DNA bubble is not known, sgRNAs that target non-template strand can also be tested in order to assess off-target effects of a specific Cas9 deaminase fusion protein. In some embodiments, such sgRNAs are designed such that the mutated start codon will not be base-paired with the sgRNA.


Once fusion proteins that are capable of programmable site-specific C to U modifications have been identified, their activities can be further characterized. The data from the luciferase assays can, for example, be integrated into heat maps that describe which nucleotides, with respect to the sgRNA target DNA, are being targeted for deamination by a specific fusion protein. In some embodiments, the position that results in the highest activity in the luciferase assay for each fusion is considered the “target” position, while all others are considered off-target positions.


In some embodiments, Cas9 fusions with various APOBEC3 enzymes, or deaminase domains thereof, are provided. In some embodiments, Cas9 fusion proteins with other nucleic acid editing enzymes or catalytic domains are provided, including, for example, ssRNA editing enzymes, such as the cytidine deaminases APOBEC1 and ACF1/ASF, as well as the ADAT family of adenosine deaminases,38 that can be used for ssDNA editing activity when fused to Cas9. The activity of such fusion proteins can be tested using the same reporter systems and assays described above.


In some embodiments, a reporter system is provided herein that includes a reporter gene comprising a deactivated start codon, e.g., a mutation on the template strand from 3′-TAC-5′ to 3′-CAC-5′. Upon successful deamination of the target C, the corresponding mRNA will be transcribed as 5′-AUG-3′ instead of 5′-GUG-3′, enabling the translation of the reporter gene. Suitable reporter genes will be apparent to those of skill in the art.


The description of exemplary embodiments of the reporter systems above is provided for illustration purposes only and not meant to be limiting. Additional reporter systems, e.g., variations of the exemplary systems described in detail above, are also embraced by this disclosure.


EXAMPLES
Example 1: Fusion Proteins

Exemplary Cas9:deaminase fusion proteins are provided below:










Cas9: human AID fusion (C-terminal)



(SEQ ID NO: 30)




MDSLLMNRRKFLYQFKNVRWAKGRRETYLCDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFK







VLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDD





SFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLA





LAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKS





RRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQ





IGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQL





PEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTF





DNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTR





KSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKY





VTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASL





GTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKR





RRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSG





QGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNS





RERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVD





AIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLT





KAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLV





SDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKS





EQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVL





SMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKV





EKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRK





RMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQI





SEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKR





YTSTKEVLDATLIHQSITGLYETRIDLSQLGGDGGGGSGGGGSGGGGSYVVKRRDSATSFSL





DFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLSL





RIFTARLYFCEDRKAEPEGLRRLHRAGVQIAIMTFKDYFYCWNTFVENHERTFKAWEGLHEN





SVRLSRQLRRILLPLYEVDDLRDAFRTLGL


(underline: nuclear localization signal; double underline:


nuclear export signal, bold: linker


sequence)





Cas9: human AID fusion (N-terminal)


(SEQ ID NO: 31)




MDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLRNKNGCHVELLFL







RYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGNPNLSLRIFTARLYFCEDRKAEPE





GLRRLHRAGVQIAIMTFKDYFYCWNTFVENHERTFKAWEGLHENSVRLSRQLRRILLPGGGG






SGGGGSGGGGSDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALL






FDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHE





RHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNP





DNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLF





GNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAI





LLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGY





IDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILR





RQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGA





SAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAI





VDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNE





ENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRD





KQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIK





KGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQIL





KEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLT





RSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQ





LVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYH





HAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMN





FFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFS





KESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITI





MERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPS





KYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLS





AYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITG





LYETRIDLSQLGGD


(underline: nuclear localization signal; bold: linker


sequence)





Cas9: mouse AID fusion (C-terminal)


(SEQ ID NO: 32)




MDSLLMNRRKFLYQFKNVRWAKGRRETYLCDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFK







VLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDD





SFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLA





LAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKS





RRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQ





IGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQL





PEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTF





DNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTR





KSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKY





VTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASL





GTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKR





RRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSG





QGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNS





RERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVD





AIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLT





KAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLV





SDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKS





EQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVL





SMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKV





EKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRK





RMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQI





SEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKR





YTSTKEVLDATLIHQSITGLYETRIDLSQLGGDGGGGSGGGGSGGGGSYVVKRRDSATSCSL





DFGHLRNKSGCHVELLFLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVAEFLRWNPNLSL





RIFTARLYFCEDRKAEPEGLRRLHRAGVQIGIMTFKDYFYCWNTFVENRERTFKAWEGLHEN





SVRLTRQLRRILLPLYEVDDLRDAFRMLGF


(underline: nuclear localization signal; bod: linker


sequence; double underline: nuclear export signal)





Cas9: human APOBEC-3G fusion (N-terminal)


(SEQ ID NO: 33)




SPKKKRKVEASMELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAE







DPKVTLTIFVARLYYFWDPDYQEALRSLCQKRDGPRATMKIMNYDEFQHCWSKFVYSQRELF





EPWNNLPKYYILLHIMLGEILRHSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVL





LNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMA





KFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPF





QPWDGLDEHSQDLSGRLRAILQNQENSPKKKRKVEASSPKKKRKVEASKKYSIGLAIGTNSV





GWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNR





ICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRK





KLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPIN





ASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKL





QLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYD





EHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEE





LLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPY





YVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHS





LLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIEC





FDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERL





KTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIH





DDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIV





IEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDM





YVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWR





QLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDEN





DKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEF





VYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETG





EIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYG





GFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDL





IIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQ





LFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNL





GAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD


(underline: nuclear localization signal; bold: linker


(1 NLS),





Cas9: human APOBEC-1 fusion (N-terminal)


(SEQ ID NO: 92)




SPKKKRKVEASMTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW







RSSGKNTTNHVEVNFIKKFTSERDFHPSMSCSITWFLSWSPCWECSQAIREFLSRHPGVTLV





IYVARLFWHMDQQNRQGLRDLVNSGVTIQIMRASEYYHCWRNFVNYPPGDEAHWPQYPPLWM





MLYALELHCIILSLPPCLKISRRWQNHLTFFRLHLQNCHYQTIPPHILLATGLIHPSVAWRS






PKKKRKVEASSPKKKRKVEASDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHS






IKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEES





FLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRG





HFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRLENLIAQ





LPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQIGDQYADLF





LAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFF





DQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQI





HLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRKSEETITPW





NFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKYVTEGMRKPA





FLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKI





IKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRL





SRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGDSLHEHI





ANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEE





GIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLK





DDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSE





LDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQF





YKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATA





KYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVK





KTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLK





SVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGEL





QKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVIL





ADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLD





ATLIHQSITGLYETRIDLSQLGGD


(underline: nuclear localization signal; bold: linker


(1 NLS),





Cas9: human ADAT1 fusion (N-terminal)


(SEQ ID NO: 35)




MDSLLMNRRKFLYQFKNVRWAKGRRETYLC
SMGTGTKCIGQSKMRKNGDILNDSHAEVIARR








SFQRYLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPMLEFEDQ







PCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLEPGTAAREVTNGAAHHQSF







GKQKSGPISPGIHSCDLTVEGLATVTRIAPGSAKVIDVYRTGAKCVPGEAGDSGKPGAAFHQ







VGLLRVKPGRGDRTRSMSCSDKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQ







RALIGRCQNVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISWSAVP







EQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIARDKWPHSLRVQKLDTY







QEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQF
GGGGSGGGGSGGGGSDKKYSIGLAIGT






NSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRR





KNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYH





LRKKLVDSTDKADLRLIYLALAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEEN





PINASGVDAKAILSARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAED





AKLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIK





RYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDG





TEELLVKLNREDLLRKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFR





IPYYVGPLARGNSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLP





KHSLLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKK





IECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIE





ERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQ





LIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPE





NIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNG





RDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKN





YWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKY





DENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLE





SEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNG





ETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPK





KYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVK





KDLIIKLPKYSLFELENGRKRMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNE





QKQLFVEQHKHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTL





TNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGGD


(underline: nuclear localization signal; bold: linker


sequence)





Cas9: human ADAT1 fusion (-terminal)


(SEQ ID NO: 36)




MDSLLMNRRKFLYQFKNVRWAKGRRETYLCDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFK







VLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDD





SFFHRLEESFLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLA





LAHMIKFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKS





RRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQ





IGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVRQQL





PEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTF





DNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTR





KSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYFTVYNELTKVKY





VTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFDSVEISGVEDRFNASL





GTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKR





RRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSG





QGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQTTQKGQKNS





RERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVD





AIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLT





KAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLV





SDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKS





EQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVL





SMPQVNIVKKTEVQTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKV





EKGKSKKLKSVKELLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRK





RMLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQI





SEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKR





YTSTKEVLDATLIHQSITGLYETRIDLSQLGGDGGGGSGGGGSSMGTGTKCIGQSKMRKNGD






ILNDSHAEVIARRSFQRYLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCG







DASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLEPGTAA







REVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGLATVTRIAPGSAKVIDVYRTGAKCVPGE







AGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCSDKMARWNVLGCQGALLMHLLEEPIYLSAV







VIGKCPYSQEAMQRALIGRCQNVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRL







VPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIARDK







WPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQF



(underline: nuclear localization signal; bold: linker


sequence)






Example 2: Correction of a PI3K Point Mutation by a Cas9 Fusion Protein

An A3140G point mutation in exon 20 of the PI3KCA gene, resulting in an H1047R amino acid substitution in the PI3K protein is corrected by contacting a nucleic acid encoding the mutant protein with a Cas9:AID (SEQ ID NO: 30) or a Cas9:APOBEC1 (SEQ ID NO: 92) fusion protein and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the encoding PI3KCA gene. The A3140G point mutation is confirmed via genomic PCR of the respective exon 20 sequence, e.g., generation of a PCR amplicon of nucleotides 3000-3250, and subsequent sequencing of the PCT amplicon.


Cells expressing a mutant PI3K protein comprising an A3140G point mutation in exon 20 are contacted with an expression construct encoding the Cas9:AID (SEQ ID NO: 30) or a Cas9:APOBEC1 (SEQ ID NO: 92) fusion protein and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the antisense strand of the encoding PI3KCA gene. The sgRNA is of the sequence









(SEQ ID NO: 81)


5′-





aucggaauctauuuugacucguuuuagagcuagaaauagcaaguuaaaau





aaaggcuaguccguuaucaacuugaaaaaguggcaccgagucggugcuuu





uu 3′;





(SEQ ID NO: 82)


5′-





ucggaaucuauuuugacucgguuuuagagcuagaaauagcaaguuaaaau





aaaggcuaguccguuaucaacuugaaaaaguggcaccgagucggugcuuu





uu-3′;





(SEQ ID NO: 83)


5′-





cuuagauaaaacugagcaagguuuuagagcuagaaauagcaaguuaaaau





aaaggcuaguccguuaucaacuugaaaaaguggcaccgagucggugcuuu





uu-3′;





(SEQ ID NO: 84)


5′-





aucuauuuugacucguucucguuuuagagcuagaaauagcaaguuaaaau





aaaggcuaguccguuaucaacuugaaaaaguggcaccgagucggugcuuu





uu-3′;





(SEQ ID NO: 85)


5′-





uaaaacugagcaagaggcuuguuuuagagcuagaaauagcaaguuaaaau





aaaggcuaguccguuaucaacuugaaaaaguggcaccgagucggugcuuu





uu-3′;





(SEQ ID NO: 86)


5′-





ugguggcuggacaacaaaaaguuuuagagcuagaaauagcaaguuaaaau





aaaggcuaguccguuaucaacuugaaaaaguggcaccgagucggugcuuu





uu-3′;





(SEQ ID NO: 87)


5′-





gcuggacaacaaaaauggauguuuuagagcuagaaauagcaaguuaaaau





aaaggcuaguccguuaucaacuugaaaaaguggcaccgagucggugcuuu





uu-3′;


or





(SEQ ID NO: 88)


5′-





guguuaauuugucguacguaguuuuagagcuagaaauagcaaguuaaaau





aaaggcuaguccguuaucaacuugaaaaaguggcaccgagucggugcuuu





uu.






The cytosine deaminase activity of the Cas9:AID or the Cas9:APOBEC1 fusion protein results in deamination of the cytosine that is base-paired with the mutant G3140 to uridine. After one round of replication, the wild type A3140 is restored. Genomic DNA of the treated cells is extracted and a PCR amplicon of nucleotides 3000-3250 is amplified with suitable PCR primers. The correction of the A3140G point mutation after treatment of the cells with the fusion protein is confirmed by sequencing the PCR amplicon.


Example 3: Correction of a Presenilin 1 Point Mutation by a Cas9 Fusion Protein

An A→G point mutation in codon 143 of the presenilin1 (PSEN1) gene, resulting in an I143V amino acid substitution in the PSEN1 protein is corrected by contacting a nucleic acid encoding the mutant PSEN1 protein with a Cas9:AID (SEQ ID NO: 30) or a Cas9:APOBEC1 (SEQ ID NO: 92) fusion protein and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the encoding PSEN1 gene. See, e.g., Gallo et. al., J. Alzheimer's disease. 2011; 25: 425-431 for a description of an exemplary PSEN1 I143V mutation associated with familial Alzheimer's Disease. The A→G point mutation is confirmed via genomic PCR of the respective PSEN1 sequence, e.g., generation of a PCR amplicon of about 100-250 nucleotides around exon 143, and subsequent sequencing of the PCT amplicon.


Cells expressing the mutant PSEN1 protein are contacted with an expression construct encoding the Cas9:AID (SEQ ID NO: 30) or a Cas9:APOBEC1 (SEQ ID NO: 92) fusion protein and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the antisense strand of the encoding PSEN1 gene. The cytosine deaminase activity of the Cas9:AID or the Cas9:APOBEC1 fusion protein results in deamination of the cytosine that is base-paired with the mutant G in codon 143 to uridine. After one round of replication, the wild type A is restored. Genomic DNA of the treated cells is extracted and a PCR amplicon of 100-250 nucleotides is amplified with suitable PCR primers. The correction of the A→G point mutation after treatment of the cells with the fusion protein is confirmed by sequencing the PCR amplicon.


Example 4: Correction of an Ac-Antitrypsin Point Mutation by a Cas9 Fusion Protein

A T→C point mutation in codon 55 of the α1-antitrypsin gene, resulting in an L55P amino acid substitution in the α1-antitrypsin protein is corrected by contacting a nucleic acid encoding the mutant α1-antitrypsin protein with a Cas9:ADAT1 fusion protein (SEQ ID NO: 35 or 36) and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the encoding α1-antitrypsin gene. See, e.g., Poller et al., Genomics. 1993; 17: 740-743 for a more detailed description of an exemplary codon 55 T→C mutation associated with chronic obstructive pulmonary disease (COPD). The T→C point mutation is confirmed via genomic PCR of the respective α1-antitrypsin sequence encoding codon 55, e.g., generation of a PCR amplicon of about 100-250 nucleotides, and subsequent sequencing of the PCT amplicon.


Cells expressing the mutant α1-antitrypsin protein are contacted with an expression construct encoding the Cas9:AID (SEQ ID NO: 30) or a Cas9:APOBEC1 (SEQ ID NO: 92) fusion protein and an appropriately designed sgRNA targeting the fusion protein to the mutated nucleotide in codon 55 on the sense strand in the encoding α1-antitrypsin gene. The cytosine deaminase activity of the Cas9:ADAT1 fusion protein results in deamination of the mutant cytosine to uridine thus correcting the mutation. Genomic DNA of the treated cells is extracted and a PCR amplicon of 100-250 nucleotides is amplified with suitable PCR primers. The correction of the T→C point mutation in codon 55 of the α1-antitrypsin gene after treatment of the cells with the fusion protein is confirmed by sequencing the PCR amplicon


Example 5: Correction of a Von Willebrand Factor Point Mutation by a Cas9 Fusion Protein

A T→C point mutation in codon 509 of the von Willebrand factor gene, resulting in a C509A amino acid substitution in the von Willebrand factor protein is corrected by contacting a nucleic acid encoding the mutant von Willebrand factor protein with a Cas9:ADAT1 fusion protein (SEQ ID NO: 35 or 36) and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the sense strand of the encoding von Willebrand factor gene. See, e.g., Lavergne et al., Br. J. Haematol. 1992; 82: 66-7, for a description of an exemplary von Willebrand factor C509A mutation associated with von Willebrand disease (vWD). The T→C point mutation is confirmed via genomic PCR of the respective von Willebrand factor genomic sequence, e.g., generation of a PCR amplicon of about 100-250 nucleotides around exon 509, and subsequent sequencing of the PCT amplicon.


Cells expressing the mutant von Willebrand factor protein are contacted with an expression construct encoding the Cas9:ADAT1 fusion protein (SEQ ID NO: 35 or 36) and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the sense strand of the encoding von Willebrand factor gene. The cytosine deaminase activity of the Cas9:ADAT1 fusion protein results in deamination of the mutant cytosine in codon 509 to uridine, thus correcting the mutation. Genomic DNA of the treated cells is extracted and a PCR amplicon of 100-250 nucleotides is amplified with suitable PCR primers. The correction of the T→C point mutation in codon 509 of the von Willebrand factor gene after treatment of the cells with the fusion protein is confirmed by sequencing the PCR amplicon.


Example 6: Correction of a Caspase 9 Point Mutation by a Cas9 Fusion Protein-Neuroblastoma

A T→C point mutation in codon 197 of the Caspase-9 gene, resulting in an L197P amino acid substitution in the Caspase-9 protein is corrected by contacting a nucleic acid encoding the mutant Caspase-9 protein with a Cas9:ADAT1 fusion protein (SEQ ID NO: 35 or 36) and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the sense strand of the encoding Caspase-9 gene. See, e.g., Lenk et al., PLoS Genetics. 2011; 7: e1002104, for a description of an exemplary Caspase-9 L197P mutation associated with neuroblastoma (NB). The T→C point mutation is confirmed via genomic PCR of the respective Caspase-9 genomic sequence, e.g., generation of a PCR amplicon of about 100-250 nucleotides around exon 197, and subsequent sequencing of the PCT amplicon.


Cells expressing the mutant Caspase-9 protein are contacted with an expression construct encoding the Cas9:ADAT1 fusion protein (SEQ ID NO: 35 or 36) and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the sense strand of the encoding Caspase-9 gene. The cytosine deaminase activity of the Cas9:ADAT1 fusion protein results in deamination of the mutant cytosine in codon 197 to uridine, thus correcting the mutation. Genomic DNA of the treated cells is extracted and a PCR amplicon of 100-250 nucleotides is amplified with suitable PCR primers. The correction of the T→C point mutation in codon 197 of the Caspase-9 gene after treatment of the cells with the fusion protein is confirmed by sequencing the PCR amplicon.


Example 7: Deaminase Activity of Two dCas9-APOBEC1 Fusion Proteins

Two dCas9-APOBEC1 fusion proteins with different linkers were generated:









rAPOBEC1_GGS_dCas9:


(SEQ ID NO: 94)



MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSI







WRHTSQNTNKHVEVNFIEKFTTERYFCPNTRCSITWFLSWSPCGECSRAI







TEFLSRYPHVTLFIYIARLYHHADPRNRQGLRDLISSGVTIQIMTEQESG







YCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILGLPPCLNILRRKQ







PQLTFFTIALQSCHYQRLPPHILWATGLKGGSMDKKYSIGLAIGTNSVGW







AVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTA







RRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPI







FGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHF







LIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSK







SRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSK







DTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLS







ASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGAS







QEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGE







LHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRK







SEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYF







TVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDY







FKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILED







IVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLIN







GIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGD







SLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQ







TTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQN







GRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSD







NVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIK







RQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRK







DFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDV







RKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGE







TGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDK







LIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITI







MERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAG







ELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDE







IIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNL







GAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGG







D;



underline = rAPOBEC1; double underline = dCas9.





rAPOBEC1_(GGS)3_dCas9:


(SEQ ID NO: 95)



MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSI







WRHTSQNTNKHVEVNFIEKFTTERYFCPNTRCSITWFLSWSPCGECSRAI







TEFLSRYPHVTLFIYIARLYHHADPRNRQGLRDLISSGVTIQIMTEQESG







YCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILGLPPCLNILRRKQ







PQLTFFTIALQSCHYQRLPPHILWATGLKGGSGGSGGSMDKKYSIGLAIG







TNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEAT







RLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKK







HERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMI







KFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAIL







SARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDA







KLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEI







TKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGY







IDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPH







QIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRF







AWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHS







LLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVK







QLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEEN







EDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRL







SRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQ







VSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIE







MARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY







LYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDK







NRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELD







KAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKL







VSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGD







YKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPL







IETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILP







KRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKE







LLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKR







MLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQH







KHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHL







FTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDL







SQLGGD;



underline = rAPOBEC1; double underline = dCas9.






Deaminase activity of both fusion proteins were examined. A deaminase assay was adapted from Nuc. Acids Res. 2014, 42, p. 1095; J. Biol. Chem. 2004, 279, p 53379; J. Virology 2014, 88, p. 3850; and J. Virology 2006, 80, p. 5992, the entire contents of each of which are incorporated by reference.


Expression constructs encoding the fusion proteins were inserted into a CMV backbone plasmid (Addgene plasmid 52970; see Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82). The fusion proteins were expressed using a TNT Quick Coupled Transcription/Translation System (Promega). After 90 min, 5 μL of lysate was incubated with 5′-labeled ssDNA substrate (Cy3-ATTATTATTATTCCGCGGATTTATT TATTTATTTATTTATTT, SEQ ID NO: 96) and UDG (Uracil DNA Glycosylase) at 37° C. for 3 hr. A 1M solution of NaOH (10 μL) was then added to cleave the DNA at the abasic site. See FIG. 4. The DNA was resolved on a 10% TBE PAGE gel (FIG. 5). A negative control, where pUC19 was incubated in the TNT system, and a positive control, where the DNA has been synthesized with a “U” in place of the target C, were also included. FIG. 5 illustrates that both fusion proteins exhibit cytosine deaminase activity.


REFERENCES



  • 1. Humbert O, Davis L, Maizels N. Targeted gene therapies: tools, applications, optimization. Crit Rev Biochem Mol. 2012; 47(3):264-81. PMID: 22530743.

  • 2. Perez-Pinera P, Ousterout D G, Gersbach C A. Advances in targeted genome editing. Curr Opin Chem Biol. 2012; 16(3-4):268-77. PMID: 22819644.

  • 3. Urnov F D, Rebar E J, Holmes M C, Zhang H S, Gregory P D. Genome editing with engineered zinc finger nucleases. Nat Rev Genet. 2010; 11(9):636-46. PMID: 20717154.

  • 4. Joung J K, Sander J D. TALENs: a widely applicable technology for targeted genome editing. Nat Rev Mol Cell Biol. 2013; 14(1):49-55. PMID: 23169466.

  • 5. Charpentier E, Doudna J A. Biotechnology: Rewriting a genome. Nature. 2013; 495, (7439):50-1. PMID: 23467164.

  • 6. Pan Y, Xia L, Li A S, Zhang X, Sirois P, Zhang J, Li K. Biological and biomedical applications of engineered nucleases. Mol Biotechnol. 2013; 55(1):54-62. PMID: 23089945.

  • 7. De Souza, N. Primer: genome editing with engineered nucleases. Nat Methods. 2012; 9(1):27. PMID: 22312638.

  • 8. Santiago Y, Chan E, Liu P Q, Orlando S, Zhang L, Urnov F D, Holmes M C, Guschin D, Waite A, Miller J C, Rebar E J, Gregory P D, Klug A, Collingwood T N. Targeted gene knockout in mammalian cells by using engineered zinc-finger nucleases. Proc Natl Acad Sci USA. 2008; 105(15):5809-14. PMID: 18359850.

  • 9. Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Lane C R, Lim E P, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley G Q, Lander E S. Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. 1999; 22(3):231-8. PMID: 10391209.

  • 10. Jansen R, van Embden J D, Gaastra W, Schouls L M. Identification of genes that are associated with DNA repeats in prokaryotes. Mol Microbiol. 2002; 43(6):1565-75. PMID: 11952905.

  • 11. Mali P, Esvelt K M, Church G M. Cas9 as a versatile tool for engineering biology. Nat Methods. 2013; 10(10):957-63. PMID: 24076990.

  • 12. Jore M M, Lundgren M, van Duijin E, Bultema J B, Westra E R, Waghmare S P, Wiedenheft B, Pul U, Wurm R, Wagner R, Beijer M R, Barendregt A, Shou K, Snijders A P, Dickman M J, Doudna J A, Boekema E J, Heck A J, van der Oost J, Brouns S J. Structural basis for CRISPR RNA-guided DNA recognition by Cascade. Nat Struct Mol Biol. 2011; 18(5):529-36. PMID: 21460843.

  • 13. Horvath P, Barrangou R. CRISPR/Cas, the immune system of bacteria and archaea. Science. 2010; 327(5962):167-70. PMID: 20056882.

  • 14. Wiedenheft B, Sternberg S H, Doudna J A. RNA-guided genetic silencing systems in bacteria and archaea. Nature. 2012; 482(7385):331-8. PMID: 22337052.

  • 15. Gasiunas G, Siksnys V. RNA-dependent DNA endonuclease Cas9 of the CRISPR system: Holy Grail of genome editing? Trends Microbiol. 2013; 21(11):562-7. PMID: 24095303.

  • 16. Qi L S, Larson M H, Gilbert L A, Doudna J A, Weissman J S, Arkin A P, Lim W A. Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression. Cell. 2013; 152(5):1173-83. PMID: 23452860.

  • 17. Perez-Pinera P, Kocak D D, Vockley C M, Adler A F, Kabadi A M, Polstein L R, Thakore P I, Glass K A, Ousterout D G, Leong K W, Guilak F, Crawford G E, Reddy T E, Gersbach C A. RNA-guided gene activation by CRISPR-Cas9-based transcription factors. Nat Methods. 2013; 10(10):973-6. PMID: 23892895.

  • 18. Mali P, Aach J, Stranges P B, Esvelt K M, Moosburner M, Kosuri S, Yang L, Church G M. CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nat Biotechnol. 2013; 31(9):833-8. PMID: 23907171.

  • 19. Gilbert L A, Larson M H, Morsut L, Liu Z, Brar G A, Torres S E, Stern-Ginossar N, Brandman O, Whitehead E H, Doudna J A, Lim W A, Weissman J S, Qi L S. CRISPR-mediated modular RNA-guided regulation of transcription in eukaryotes. Cell. 2013; 154(2):442-51. PMID: 23849981.

  • 20. Larson M H, Gilbert L A, Wang X, Lim W A, Weissman J S, Qi L S. CRISPR interference (CRISPRi) for sequence-specific control of gene expression. Nat Protoc. 2013; 8(11):2180-96. PMID: 24136345.

  • 21. Mali P, Yang L, Esvelt K M, Aach J, Guell M, DiCarlo J E, Norville J E, Church G M. RNA-guided human genome engineering via Cas9. Science. 2013; 339(6121):823-6. PMID: 23287722.

  • 22. Cole-Strauss A, Yoon K, Xiang Y, Byrne B C, Rice M C, Gryn J, Holloman W K, Kmiec E B. Correction of the mutation responsible for sickle cell anemia by an RNA-DNA oligonucleotide. Science. 1996; 273(5280):1386-9. PMID: 8703073.

  • 23. Tagalakis A D, Owen J S, Simons J P. Lack of RNA-DNA oligonucleotide (chimeraplast) mutagenic activity in mouse embryos. Mol Reprod Dev. 2005; 71(2):140-4. PMID: 15791601.

  • 24. Ray A, Langer M. Homologous recombination: ends as the means. Trends Plant Sci. 2002; 7(10):435-40. PMID 12399177.

  • 25. Britt A B, May G D. Re-engineering plant gene targeting. Trends Plant Sci. 2003; 8(2):90-5. PMID: 12597876.

  • 26. Vagner V, Ehrlich S D. Efficiency of homologous DNA recombination varies along the Bacillus subtilis chromosome. J Bacteriol. 1988; 170(9):3978-82. PMID: 3137211.

  • 27. Saleh-Gohari N, Helleday T. Conservative homologous recombination preferentially repairs DNA double-strand breaks in the S phase of the cell cycle in human cells. Nucleic Acids Res. 2004; 32(12):3683-8. PMID: 15252152.

  • 28. Lombardo A, Genovese P, Beausejour C M, Colleoni S, Lee Y L, Kim K A, Ando D, Urnov F D, Galli C, Gregory P D, Holmes M C, Naldini L. Gene editing in human stem cells using zince finger nucleases and integrase-defective lentiviral vector delivery. Nat Biotechnol. 2007; 25(11):1298-306. PMID: 17965707.

  • 29. Conticello S G. The AID/APOBEC family of nucleic acid mutators. Genome Biol. 2008; 9(6):229. PMID: 18598372.

  • 30. Reynaud C A, Aoufouchi S, Faili A, Weill J C. What role for AID: mutator, or assembler of the immunoglobulin mutasome? Nat Immunol. 2003; 4(7):631-8.

  • 31. Bhagwat A S. DNA-cytosine deaminases: from antibody maturation to antiviral defense. DNA Repair (Amst). 2004; 3(1):85-9. PMID: 14697763.

  • 32. Navaratnam N, Sarwar R. An overview of cytidine deaminases. Int J Hematol. 2006; 83(3):195-200. PMID: 16720547.

  • 33. Holden L G, Prochnow C, Chang Y P, Bransteitter R, Chelico L, Sen U, Stevens R C, Goodman M F, Chen X S. Crystal structure of the anti-viral APOBEC3G catalytic domain and functional implications. Nature. 2008; 456(7218):121-4. PMID: 18849968.

  • 34. Chelico L, Pham P, Petruska J, Goodman M F. Biochemical basis of immunological and retroviral responses to DNA-targeted cytosine deamination by activation-induced cytidine deaminase and APOBEC3G. J Biol Chem. 2009; 284(41). 27761-5. PMID: 19684020.

  • 35. Pham P, Bransteitter R, Goodman M F. Reward versus risk: DNA cytidine deaminases triggering immunity and disease. Biochemistry. 2005; 44(8):2703-15. PMID 15723516.

  • 36. Barbas C F, Kim D H. Cytidine deaminase fusions and related methods. PCT Int Appl. 2010; WO 2010132092 A2 20101118.

  • 37. Chen X, Zaro J L, Shen W C. Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. 2013; 65(10):1357-69. PMID: 23026637.

  • 38. Gerber A P, Keller W. RNA editing by base deamination: more enzymes, more targets, new mysteries. Trends Biochem Sci. 2001; 26(6):376-84. PMID: 11406411.

  • 39. Yuan L, Kurek I, English J, Keenan R. Laboratory-directed protein evolution. Microbiol Mol Biol Rev. 2005; 69(3):373-92. PMID: 16148303.

  • 40. Cobb R E, Sun N, Zhao H. Directed evolution as a powerful synthetic biology tool. Methods. 2013; 60(1):81-90. PMID: 22465795.

  • 41. Bershtein S, Tawfik D S. Advances in laboratory evolution of enzymes. Curr Opin Chem Biol. 2008; 12(2):151-8. PMID: 18284924.

  • 42. Hida K, Hanes J, Ostermeier M. Directed evolution for drug and nucleic acid delivery. Adv Drug Deliv Rev. 2007; 59(15):1562-78. PMID: 17933418.

  • 43. Esvelt K M, Carlson J C, Liu D R. A system for the continuous directed evolution of biomolecules. Nature. 2011; 472(7344):499-503. PMID: 21478873.

  • 44. Husimi Y. Selection and evolution of bacteriophages in cellstat. Adv Biophys. 1989; 25:1-43. PMID: 2696338.

  • 45. Riechmann L, Holliger P. The C-terminal domain of TolA is the coreceptor for filamentous phage infection of E. coli. Cell. 1997; 90(2):351-60. PMID: 9244308.

  • 46. Nelson F K, Friedman S M, Smith G P. Filamentous phage DNA cloning vectors: a noninfective mutant with a nonpolar deletion in gene III. Virology. 1981; 108(2):338-50. PMID: 6258292.

  • 47. Rakonjac J, Model P. Roles of pIII in filamentous phage assembly. J Mol Biol. 1998; 282(1):25-41.

  • 48. Smith G P. Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface. Science. 1985; 228(4705):1315-7. PMID: 4001944.

  • 49. Sheridan C. Gene therapy finds its niche. Nat Biotechnol. 2011; 29(2):121-8. PMID: 21301435.

  • 50. Lee J W, Soung Y H, Kim S Y, Lee H W, Park W S, Nam S W, Kim S H, Lee J Y, Yoo N J, Lee S H. PIK3C A gene is frequently mutated in breast carcinomas and hepatocellular carcinomas. Oncogene. 2005; 24(8):1477-80. PMID: 15608678.

  • 51. Ikediobi O N, Davies H, Bignell G, Edkins S, Stevens C, O'Meara S, Santarius T, Avis T, Barthorpe S, Brackenbury L, Buck G, Butler A, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Hunter C, Jenkinson A, Jones D, Kosmidou V, Lugg R, Menzies A, Mironenko T, Parker A, Perry J, Raine K, Richardson D, Shepherd R, Small A, Smith R, Solomon H, Stephens P, Teaque J, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Reinhold W, Weinstein J N, Stratton M R, Futreal P A, Wooster R. Mutation analysis of 24 known cancer genes in the NCI-60 cell line set. Mol Cancer Ther. 2006; 5(11):2606-12. PMID: 17088437.



All publications, patents, patent applications, publication, and database entries (e.g., sequence database entries) mentioned herein, e.g., in the Background, Summary, Detailed Description, Examples, and/or References sections, are hereby incorporated by reference in their entirety as if each individual publication, patent, patent application, publication, and database entry was specifically and individually incorporated herein by reference. In case of conflict, the present application, including any definitions herein, will control.


EQUIVALENTS AND SCOPE

Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents of the embodiments described herein. The scope of the present disclosure is not intended to be limited to the above description, but rather is as set forth in the appended claims.


Articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between two or more members of a group are considered satisfied if one, more than one, or all of the group members are present, unless indicated to the contrary or otherwise evident from the context. The disclosure of a group that includes “or” between two or more group members provides embodiments in which exactly one member of the group is present, embodiments in which more than one members of the group are present, and embodiments in which all of the group members are present. For purposes of brevity those embodiments have not been individually spelled out herein, but it will be understood that each of these embodiments is provided herein and may be specifically claimed or disclaimed.


It is to be understood that the invention encompasses all variations, combinations, and permutations in which one or more limitation, element, clause, or descriptive term, from one or more of the claims or from one or more relevant portion of the description, is introduced into another claim. For example, a claim that is dependent on another claim can be modified to include one or more of the limitations found in any other claim that is dependent on the same base claim. Furthermore, where the claims recite a composition, it is to be understood that methods of making or using the composition according to any of the methods of making or using disclosed herein or according to methods known in the art, if any, are included, unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise.


Where elements are presented as lists, e.g., in Markush group format, it is to be understood that every possible subgroup of the elements is also disclosed, and that any element or subgroup of elements can be removed from the group. It is also noted that the term “comprising” is intended to be open and permits the inclusion of additional elements or steps. It should be understood that, in general, where an embodiment, product, or method is referred to as comprising particular elements, features, or steps, embodiments, products, or methods that consist, or consist essentially of, such elements, features, or steps, are provided as well. For purposes of brevity those embodiments have not been individually spelled out herein, but it will be understood that each of these embodiments is provided herein and may be specifically claimed or disclaimed.


Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and/or the understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value within the stated ranges in some embodiments, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise. For purposes of brevity, the values in each range have not been individually spelled out herein, but it will be understood that each of these values is provided herein and may be specifically claimed or disclaimed. It is also to be understood that unless otherwise indicated or otherwise evident from the context and/or the understanding of one of ordinary skill in the art, values expressed as ranges can assume any subrange within the given range, wherein the endpoints of the subrange are expressed to the same degree of accuracy as the tenth of the unit of the lower limit of the range.


In addition, it is to be understood that any particular embodiment of the present invention may be explicitly excluded from any one or more of the claims. Where ranges are given, any value within the range may explicitly be excluded from any one or more of the claims. Any embodiment, element, feature, application, or aspect of the compositions and/or methods of the invention, can be excluded from any one or more claims. For purposes of brevity, all of the embodiments in which one or more elements, features, purposes, or aspects is excluded are not set forth explicitly herein.

Claims
  • 1. A fusion protein comprising, in order, from N- to C-terminus: (i) a catalytic deaminase domain of an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase comprising an amino acid sequence that is at least 95% identical to SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, or SEQ ID NO: 24; and(ii) a nuclease-inactive Clustered Regulatory Interspaced Short Palindromic Repeat-associated protein 9 (dCas9) domain, wherein the dCas9 domain comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 2,wherein the catalytic deaminase domain of (i) and the dCas9 domain of (ii) are fused via a linker comprising the amino acid sequence SGSETPGTSESATPES (SEQ ID NO: 93).
  • 2. The fusion protein of claim 1, wherein the catalytic deaminase domain is a catalytic domain of an APOBEC1 family deaminase.
  • 3. A method of DNA editing, the method comprising contacting a DNA molecule with (a) the fusion protein of claim 1; and(b) a single guide RNA (sgRNA) targeting the fusion protein of (a) to a target DNA sequence of the DNA molecule;wherein the DNA molecule is contacted with the fusion protein and the sgRNA in an amount effective and under conditions suitable for the deamination of a nucleotide base of the DNA molecule.
  • 4. The method of claim 3, wherein the target DNA sequence comprises a sequence associated with a disease or disorder, and wherein the deamination of the nucleotide base results in a sequence that is not associated with the disease or disorder.
  • 5. The method of claim 4, wherein the target DNA sequence comprises a point mutation associated with a disease or disorder, and wherein the deamination corrects the point mutation.
  • 6. The method of claim 3, wherein the target DNA sequence comprises a T→C or A→G point mutation associated with a disease or disorder, and wherein the deamination of the mutant C or G base results in a sequence that is not associated with a disease or disorder.
  • 7. The method of claim 4, wherein the sequence associated with the disease or disorder encodes a protein, and wherein the deamination introduces a stop codon into the sequence associated with the disease or disorder, resulting in a truncation of the encoded protein.
  • 8. The method of claim 4, wherein the contacting is in vivo in a subject having or diagnosed with a disease or disorder.
  • 9. The method of claim 4, wherein the disease or disorder is cystic fibrosis, phenylketonuria, epidermolytic hyperkeratosis (EHK), Charcot-Marie-Toot disease type 4J, neuroblastoma (NB), von Willebrand disease (vWD), myotonia congenital, hereditary renal amyloidosis, dilated cardiomyopathy (DCM), hereditary lymphedema, familial Alzheimer's disease, Prion disease, chronic infantile neurologic cutaneous articular syndrome (CINCA), desmin-related myopathy (DRM), or a neoplastic disease associated with a mutant PI3KCA protein.
  • 10. The method of claim 3, wherein the method further comprises detecting the deamination of the nucleotide base.
  • 11. The method of claim 10, wherein the detecting is via PCR.
  • 12. A kit comprising a DNA or an RNA construct, comprising a sequence encoding the fusion protein of claim 1; andsuitable reagents, buffers, and/or instructions.
  • 13. The fusion protein of claim 1, wherein the catalytic deaminase domain of the APOBEC family deaminase is a catalytic domain of an APOBEC3 family deaminase.
  • 14. The fusion protein of claim 2, wherein the APOBEC1 family deaminase comprises the amino acid sequence at least 95% identical to SEQ ID NO: 22, SEQ ID NO: 23, or SEQ ID NO: 24.
  • 15. The fusion protein of claim 1 further comprising a nuclear localization signal (NLS).
  • 16. The fusion protein of claim 15, wherein the NLS is fused to the C-terminus of the dCas9 domain.
  • 17. The fusion protein of claim 1, wherein the dCas9 domain comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: 2.
  • 18. The fusion protein of claim 1, wherein the dCas9 domain comprises an amino acid sequence at least 99% identical to SEQ ID NO: 2.
  • 19. The fusion protein of claim 1, wherein the dCas9 domain comprises an alanine (A) at the residue corresponding to residue 10 in SEQ ID NO: 2.
  • 20. The fusion protein of claim 13, wherein the catalytic deaminase domain of the APOBEC family deaminase comprises an amino acid sequence at least 98% identical to SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, or SEQ ID NO: 21.
  • 21. The fusion protein of claim 1, wherein the catalytic deaminase domain of the APOBEC family deaminase comprises an amino acid sequence at least 98% identical to SEQ ID NO: 24.
  • 22. The fusion protein of claim 1, wherein the catalytic deaminase domain of the APOBEC family deaminase comprises an amino acid sequence at least 99% identical to SEQ ID NO: 24.
  • 23. A fusion protein comprising, in order, from N- to C-terminus: (i) a catalytic deaminase domain of an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase comprising an amino acid sequence that is at least 95% identical to SEQ ID NO:10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, or SEQ ID NO: 24; and(ii) a nuclease-inactive Clustered Regulatory Interspaced Short Palindromic Repeat-associated protein 9 (dCas9) domain, wherein the dCas9 domain comprises an amino acid sequence that is at least 95% identical to the amino acid sequence of SEQ ID NO: 37,wherein the catalytic deaminase domain of (i) and the dCas9 domain of (ii) are fused via a linker comprising the amino acid sequence SGSETPGTSESATPES (SEQ ID NO: 93).
  • 24. The fusion protein of claim 23, wherein the catalytic deaminase domain is a catalytic domain of an APOBEC1 family deaminase.
  • 25. A method of DNA editing, the method comprising contacting a DNA molecule with (a) the fusion protein of claim 23; and(b) a single guide RNA (sgRNA) targeting the fusion protein of (a) to a target DNA sequence of the DNA molecule;wherein the DNA molecule is contacted with the fusion protein and the sgRNA in an amount effective and under conditions suitable for the deamination of a nucleotide base of the DNA molecule.
  • 26. The method of claim 25, wherein the target DNA sequence comprises a sequence associated with a disease or disorder, and wherein the deamination of the nucleotide base results in a sequence that is not associated with the disease or disorder.
  • 27. The method of claim 26, wherein the target DNA sequence comprises a point mutation associated with a disease or disorder, and wherein the deamination corrects the point mutation.
  • 28. The method of claim 25, wherein the target DNA sequence comprises a T→C or A→G point mutation associated with a disease or disorder, and wherein the deamination of the mutant C or G base results in a sequence that is not associated with a disease or disorder.
  • 29. The method of claim 26, wherein the sequence associated with the disease or disorder encodes a protein, and wherein the deamination introduces a stop codon into the sequence associated with the disease or disorder, resulting in a truncation of the encoded protein.
  • 30. The method of claim 26, wherein the contacting is in vivo in a subject having or diagnosed with a disease or disorder.
  • 31. The method of claim 26, wherein the disease or disorder is cystic fibrosis, phenylketonuria, epidermolytic hyperkeratosis (EHK), Charcot-Marie-Toot disease type 4J, neuroblastoma (NB), von Willebrand disease (vWD), myotonia congenital, hereditary renal amyloidosis, dilated cardiomyopathy (DCM), hereditary lymphedema, familial Alzheimer's disease, Prion disease, chronic infantile neurologic cutaneous articular syndrome (CINCA), desmin-related myopathy (DRM), or a neoplastic disease associated with a mutant PI3KCA protein.
  • 32. The method of claim 25, wherein the method further comprises detecting the deamination of the nucleotide base.
  • 33. The method of claim 32, wherein the detecting is via PCR.
  • 34. A kit comprising a DNA or an RNA construct, comprising a sequence encoding the fusion protein of claim 23; andsuitable reagents, buffers, and/or instructions.
  • 35. The fusion protein of claim 23, wherein the catalytic deaminase domain of the APOBEC family deaminase is a catalytic domain of an APOBEC3 family deaminase.
  • 36. The fusion protein of claim 24, wherein the APOBEC1 family deaminase comprises the amino acid sequence at least 95% identical to SEQ ID NO: 22, SEQ ID NO: 23, or SEQ ID NO: 24.
  • 37. The fusion protein of claim 23 further comprising a nuclear localization signal (NLS).
  • 38. The fusion protein of claim 37, wherein the NLS is fused to the C-terminus of the dCas9 domain.
  • 39. The fusion protein of claim 23, wherein the dCas9 domain comprises an amino acid sequence that is at least 98% identical to the amino acid sequence of SEQ ID NO: 37.
  • 40. The fusion protein of claim 23, wherein the dCas9 domain comprises an amino acid sequence at least 99% identical to SEQ ID NO: 37.
  • 41. The fusion protein of claim 23, wherein the dCas9 domain comprises an alanine (A) at the residue corresponding to residue 10 in SEQ ID NO: 37.
  • 42. The fusion protein of claim 35, wherein the catalytic deaminase domain of the APOBEC family deaminase comprises an amino acid sequence at least 98% identical to SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, or SEQ ID NO: 21.
  • 43. The fusion protein of claim 23, wherein the catalytic deaminase domain of the APOBEC family deaminase comprises an amino acid sequence at least 98% identical to SEQ ID NO: 24.
  • 44. The fusion protein of claim 23, wherein the catalytic deaminase domain of the APOBEC family deaminase comprises an amino acid sequence at least 99% identical to SEQ ID NO: 24.
RELATED APPLICATIONS

This application is a national stage filing under 35 U.S.C. § 371 of international PCT application, PCT/US2014/070038, filed Dec. 12, 2014, which claims priority under 35 U.S.C. § 119(e) to U.S. provisional patent application, U.S. Ser. No. 61/915,386 filed Dec. 12, 2013, and U.S. provisional patent application, U.S. Ser. No. 61/980,333 filed Apr. 16, 2014; and also claims priority under 35 U.S.C. § 120 to U.S. patent applications, U.S. Ser. Nos. 14/325,815, 14/326,109, 14/326,140, 14/326,269, 14/326,290, 14/326,318, and 14/326,303, all filed on Jul. 8, 2014; each of which is incorporated herein by reference. This application is a continuation of and claims priority under 35 U.S.C. § 120 to U.S. patent applications, U.S. Ser. Nos. 14/325,815, 14/326,109, 14/326,140, 14/326,290, 14/326,318, and 14/326,303, all filed on Jul. 8, 2014, all of which claim priority under 35 U.S.C. § 119(e) to U.S. provisional patent application, U.S. Ser. No. 61/915,386, filed Dec. 12, 2013, and U.S. provisional patent application, U.S. Ser. No. 61/980,333 filed Apr. 16, 2014, each of which is incorporated herein by reference.

GOVERNMENT SUPPORT

This invention was made with Government support under HR0011-11-2-0003 and N66001-12-C-4207 awarded by the Department of Defense, and under GM095501 awarded by the National Institutes of Health. The Government has certain rights in this invention.

PCT Information
Filing Document Filing Date Country Kind
PCT/US2014/070038 12/12/2014 WO 00
Publishing Document Publishing Date Country Kind
WO2015/089406 6/18/2015 WO A
US Referenced Citations (288)
Number Name Date Kind
4182449 Kozlow Jan 1980 A
4235871 Papahadjopoulos et al. Nov 1980 A
4880635 Janoff et al. Nov 1989 A
4906477 Kurono et al. Mar 1990 A
4911928 Wallach Mar 1990 A
4917951 Wallach Apr 1990 A
4920016 Allen et al. Apr 1990 A
4921757 Wheatley et al. May 1990 A
5139941 Muzyczka et al. Aug 1992 A
5449639 Wei et al. Sep 1995 A
5780053 Ashley et al. Jul 1998 A
5835699 Kimura Nov 1998 A
5962313 Podsakoff et al. Oct 1999 A
6057153 George et al. May 2000 A
6453242 Eisenberg et al. Sep 2002 B1
6503717 Case et al. Jan 2003 B2
6534261 Cox, III et al. Mar 2003 B1
6599692 Case et al. Jul 2003 B1
6607882 Cox, III et al. Aug 2003 B1
6824978 Cox, III et al. Nov 2004 B1
6933113 Case et al. Aug 2005 B2
6979539 Cox, III et al. Dec 2005 B2
7013219 Case et al. Mar 2006 B2
7163824 Cox, III et al. Jan 2007 B2
7479573 Chu et al. Jan 2009 B2
7794931 Breaker et al. Sep 2010 B2
7919277 Russell et al. Apr 2011 B2
7993672 Huang et al. Aug 2011 B2
8097648 Littlefield et al. Jan 2012 B2
8361725 Russell et al. Jan 2013 B2
8394604 Liu et al. Mar 2013 B2
8492082 De Franciscis et al. Jul 2013 B2
8546553 Terns et al. Oct 2013 B2
8569256 Heyes et al. Oct 2013 B2
8680069 de Fougerolles et al. Mar 2014 B2
8691750 Constien et al. Apr 2014 B2
8697359 Zhang Apr 2014 B1
8709466 Coady et al. Apr 2014 B2
8728526 Heller May 2014 B2
8748667 Budzik et al. Jun 2014 B2
8758810 Okada et al. Jun 2014 B2
8759103 Kim et al. Jun 2014 B2
8759104 Unciti-Broceta et al. Jun 2014 B2
8771728 Huang et al. Jul 2014 B2
8790664 Pitard et al. Jul 2014 B2
8795965 Zhang Aug 2014 B2
8846578 McCray et al. Sep 2014 B2
8993233 Zhang et al. Mar 2015 B2
8999641 Zhang et al. Apr 2015 B2
9068179 Liu Jun 2015 B1
9163284 Liu et al. Oct 2015 B2
9228207 Liu et al. Jan 2016 B2
9234213 Wu Jan 2016 B2
9322006 Liu et al. Apr 2016 B2
9322037 Liu et al. Apr 2016 B2
9340799 Liu et al. May 2016 B2
9340800 Liu et al. May 2016 B2
9359599 Liu et al. Jun 2016 B2
9388430 Liu et al. Jul 2016 B2
9512446 Joung et al. Dec 2016 B1
9526724 Oshlack et al. Dec 2016 B2
9737604 Liu et al. Aug 2017 B2
9816093 Donohoue et al. Nov 2017 B1
9822372 Zhang et al. Nov 2017 B2
9840690 Karli et al. Dec 2017 B2
9840699 Liu Dec 2017 B2
9840713 Zhang Dec 2017 B2
9873907 Zeiner et al. Jan 2018 B2
9879270 Hittinger et al. Jan 2018 B2
9938288 Kishi et al. Apr 2018 B1
9944933 Storici et al. Apr 2018 B2
9982279 Gill et al. May 2018 B1
9999671 Liu et al. Jun 2018 B2
10059940 Zhong Aug 2018 B2
10077453 Liu et al. Sep 2018 B2
10113163 Liu et al. Oct 2018 B2
10167457 Liu et al. Jan 2019 B2
10227581 Liu et al. Mar 2019 B2
20040003420 Kuhn et al. Jan 2004 A1
20040115184 Smith et al. Jun 2004 A1
20050222030 Allison et al. Oct 2005 A1
20060088864 Smolke et al. Apr 2006 A1
20060104984 Littlefield et al. May 2006 A1
20060246568 Honjo et al. Nov 2006 A1
20070264692 Liu et al. Nov 2007 A1
20080124725 Barrangou et al. May 2008 A1
20080182254 Hall et al. Jul 2008 A1
20090130718 Short May 2009 A1
20090234109 Han et al. Sep 2009 A1
20100076057 Sontheimer et al. Mar 2010 A1
20100093617 Barrangou et al. Apr 2010 A1
20100104690 Barrangou et al. Apr 2010 A1
20100316643 Eckert et al. Dec 2010 A1
20110059160 Essner et al. Mar 2011 A1
20110104787 Church et al. May 2011 A1
20110189776 Terns et al. Aug 2011 A1
20110217739 Terns et al. Sep 2011 A1
20120129759 Liu et al. May 2012 A1
20120141523 Castado et al. Jun 2012 A1
20120244601 Bertozzi et al. Sep 2012 A1
20120270273 Zhang et al. Oct 2012 A1
20130117869 Duchateau et al. May 2013 A1
20130130248 Haurwitz et al. May 2013 A1
20130158245 Russell et al. Jun 2013 A1
20130165389 Schellenberger et al. Jun 2013 A1
20130309720 Schultz et al. Nov 2013 A1
20130344117 Mirosevich et al. Dec 2013 A1
20140004280 Loomis Jan 2014 A1
20140005269 Ngwuluka et al. Jan 2014 A1
20140017214 Cost Jan 2014 A1
20140018404 Chen et al. Jan 2014 A1
20140044793 Goll et al. Feb 2014 A1
20140065711 Liu et al. Mar 2014 A1
20140068797 Doudna et al. Mar 2014 A1
20140127752 Zhou et al. May 2014 A1
20140141094 Smyth et al. May 2014 A1
20140141487 Feldman et al. May 2014 A1
20140186843 Zhang et al. Jul 2014 A1
20140186958 Zhang et al. Jul 2014 A1
20140234289 Liu et al. Aug 2014 A1
20140248702 Cong Sep 2014 A1
20140273037 Wu Sep 2014 A1
20140273226 Wu Sep 2014 A1
20140273230 Chen et al. Sep 2014 A1
20140295556 Joung et al. Oct 2014 A1
20140295557 Joung et al. Oct 2014 A1
20140342456 Mali et al. Nov 2014 A1
20140342457 Mali et al. Nov 2014 A1
20140342458 Mali et al. Nov 2014 A1
20140349400 Jakimo et al. Nov 2014 A1
20140356867 Peter et al. Dec 2014 A1
20140356956 Church et al. Dec 2014 A1
20140356958 Mali et al. Dec 2014 A1
20140356959 Church et al. Dec 2014 A1
20140357523 Zeiner et al. Dec 2014 A1
20140377868 Joung et al. Dec 2014 A1
20150010526 Liu et al. Jan 2015 A1
20150031089 Lindstrom Jan 2015 A1
20150031132 Church et al. Jan 2015 A1
20150031133 Church et al. Jan 2015 A1
20150044191 Liu et al. Feb 2015 A1
20150044192 Liu et al. Feb 2015 A1
20150044772 Zhao Feb 2015 A1
20150050699 Siksnys et al. Feb 2015 A1
20150056177 Liu et al. Feb 2015 A1
20150056629 Guthrie-Honea Feb 2015 A1
20150064138 Lu et al. Mar 2015 A1
20150064789 Paschon et al. Mar 2015 A1
20150071898 Liu et al. Mar 2015 A1
20150071899 Liu et al. Mar 2015 A1
20150071900 Liu et al. Mar 2015 A1
20150071901 Liu et al. Mar 2015 A1
20150071902 Liu et al. Mar 2015 A1
20150071903 Liu et al. Mar 2015 A1
20150071906 Liu et al. Mar 2015 A1
20150079680 Bradley et al. Mar 2015 A1
20150079681 Zhang Mar 2015 A1
20150098954 Hyde et al. Apr 2015 A1
20150118216 Liu et al. Apr 2015 A1
20150132269 Orkin et al. May 2015 A1
20150140664 Byrne et al. May 2015 A1
20150159172 Miller et al. Jun 2015 A1
20150165054 Liu et al. Jun 2015 A1
20150166980 Liu et al. Jun 2015 A1
20150166981 Liu et al. Jun 2015 A1
20150166982 Liu et al. Jun 2015 A1
20150166984 Liu et al. Jun 2015 A1
20150166985 Liu et al. Jun 2015 A1
20150191744 Wolfe et al. Jul 2015 A1
20150197759 Xu et al. Jul 2015 A1
20150211058 Carstens et al. Jul 2015 A1
20150218573 Loque et al. Aug 2015 A1
20150225773 Farmer et al. Aug 2015 A1
20150252358 Maeder et al. Sep 2015 A1
20150307889 Petolino et al. Oct 2015 A1
20150315252 Haugwitz et al. Nov 2015 A1
20160015682 Cawthorne et al. Jan 2016 A2
20160017393 Jacobson et al. Jan 2016 A1
20160017396 Cann et al. Jan 2016 A1
20160032292 Storici et al. Feb 2016 A1
20160032353 Braman et al. Feb 2016 A1
20160046952 Hittinger et al. Feb 2016 A1
20160046961 Jinek et al. Feb 2016 A1
20160046962 May et al. Feb 2016 A1
20160053272 Wurtzel et al. Feb 2016 A1
20160053304 Wurtzel et al. Feb 2016 A1
20160074535 Ranganathan et al. Mar 2016 A1
20160076093 Shendure et al. Mar 2016 A1
20160090603 Carnes et al. Mar 2016 A1
20160090622 Liu et al. Mar 2016 A1
20160115488 Zhang et al. Apr 2016 A1
20160138046 Wu et al. May 2016 A1
20160186214 Brouns et al. Jun 2016 A1
20160200779 Liu et al. Jul 2016 A1
20160201040 Liu et al. Jul 2016 A1
20160201089 Gersbach et al. Jul 2016 A1
20160206566 Lu et al. Jul 2016 A1
20160208243 Zhang et al. Jul 2016 A1
20160208288 Liu et al. Jul 2016 A1
20160215275 Zhong Jul 2016 A1
20160215276 Liu et al. Jul 2016 A1
20160215300 May et al. Jul 2016 A1
20160244784 Jacobson et al. Aug 2016 A1
20160244829 Bang et al. Aug 2016 A1
20160272965 Zhang et al. Sep 2016 A1
20160281072 Zhang Sep 2016 A1
20160304855 Stark et al. Oct 2016 A1
20160312304 Sorrentino et al. Oct 2016 A1
20160333389 Liu et al. Nov 2016 A1
20160340662 Zhang et al. Nov 2016 A1
20160345578 Barrangou et al. Dec 2016 A1
20160346360 Quake et al. Dec 2016 A1
20160346361 Quake et al. Dec 2016 A1
20160346362 Quake et al. Dec 2016 A1
20160348074 Quake et al. Dec 2016 A1
20160350476 Quake et al. Dec 2016 A1
20160369262 Reik et al. Dec 2016 A1
20170009242 McKinley et al. Jan 2017 A1
20170014449 Bangera et al. Jan 2017 A1
20170020922 Wagner et al. Jan 2017 A1
20170037432 Donohoue et al. Feb 2017 A1
20170044520 Liu et al. Feb 2017 A1
20170044592 Peter et al. Feb 2017 A1
20170053729 Kotani et al. Feb 2017 A1
20170058271 Joung et al. Mar 2017 A1
20170058272 Carter et al. Mar 2017 A1
20170058298 Kennedy et al. Mar 2017 A1
20170073663 Wang et al. Mar 2017 A1
20170087224 Quake Mar 2017 A1
20170087225 Quake Mar 2017 A1
20170088587 Quake Mar 2017 A1
20170088828 Quake Mar 2017 A1
20170107536 Zhang et al. Apr 2017 A1
20170107560 Peter et al. Apr 2017 A1
20170114367 Hu et al. Apr 2017 A1
20170121693 Liu et al. May 2017 A1
20170145394 Yeo et al. May 2017 A1
20170145405 Tang et al. May 2017 A1
20170145438 Kantor May 2017 A1
20170152528 Zhang Jun 2017 A1
20170152787 Kubo et al. Jun 2017 A1
20170159033 Kamtekar et al. Jun 2017 A1
20170166928 Vyas et al. Jun 2017 A1
20170175104 Doudna et al. Jun 2017 A1
20170175142 Zhang et al. Jun 2017 A1
20170191047 Terns et al. Jul 2017 A1
20170191078 Zhang et al. Jul 2017 A1
20170198269 Zhang et al. Jul 2017 A1
20170198277 Kmiec et al. Jul 2017 A1
20170198302 Feng et al. Jul 2017 A1
20170226522 Hu et al. Aug 2017 A1
20170233703 Xie et al. Aug 2017 A1
20170233756 Begemann et al. Aug 2017 A1
20170247671 Yung et al. Aug 2017 A1
20170247703 Sloan et al. Aug 2017 A1
20170268022 Liu et al. Sep 2017 A1
20170283797 Robb et al. Oct 2017 A1
20170314016 Kim et al. Nov 2017 A1
20170362635 Chamberlain et al. Dec 2017 A1
20180064077 Dunham et al. Mar 2018 A1
20180066258 Powell Mar 2018 A1
20180068062 Zhang et al. Mar 2018 A1
20180073012 Liu et al. Mar 2018 A1
20180100147 Yates et al. Apr 2018 A1
20180105867 Xiao et al. Apr 2018 A1
20180119118 Lu et al. May 2018 A1
20180127780 Liu et al. May 2018 A1
20180155720 Donohoue et al. Jun 2018 A1
20180163213 Aneja et al. Jun 2018 A1
20180170984 Harris et al. Jun 2018 A1
20180179503 Maianti et al. Jun 2018 A1
20180179547 Zhang et al. Jun 2018 A1
20180201921 Malcolm Jul 2018 A1
20180230464 Zhong Aug 2018 A1
20180230471 Storici et al. Aug 2018 A1
20180236081 Liu et al. Aug 2018 A1
20180237787 Maianti et al. Aug 2018 A1
20180245066 Yao et al. Aug 2018 A1
20180265864 Li et al. Sep 2018 A1
20180273939 Yu et al. Sep 2018 A1
20180282722 Jakimo et al. Oct 2018 A1
20180305688 Zhong Oct 2018 A1
20180305704 Zhang Oct 2018 A1
20180312825 Liu et al. Nov 2018 A1
20180312828 Liu et al. Nov 2018 A1
20180312835 Yao et al. Nov 2018 A1
20180327756 Zhang et al. Nov 2018 A1
20190093099 Liu et al. Mar 2019 A1
Foreign Referenced Citations (1486)
Number Date Country
2012244264 Nov 2012 AU
2015252023 Nov 2015 AU
2015101792 Jan 2016 AU
112015013786 Jul 2017 BR
2894668 Jun 2014 CA
2894681 Jun 2014 CA
2894684 Jun 2014 CA
2 852 593 Nov 2015 CA
1069962 Mar 1993 CN
103224947 Jul 2013 CN
103233028 Aug 2013 CN
103388006 Nov 2013 CN
103614415 Mar 2014 CN
103642836 Mar 2014 CN
103668472 Mar 2014 CN
103820441 May 2014 CN
103820454 May 2014 CN
103911376 Jul 2014 CN
103923911 Jul 2014 CN
103981211 Aug 2014 CN
103981212 Aug 2014 CN
104004778 Aug 2014 CN
104004782 Aug 2014 CN
104017821 Sep 2014 CN
104109687 Oct 2014 CN
104178461 Dec 2014 CN
104342457 Feb 2015 CN
104404036 Mar 2015 CN
104450774 Mar 2015 CN
104480144 Apr 2015 CN
104498493 Apr 2015 CN
104504304 Apr 2015 CN
104531704 Apr 2015 CN
104531705 Apr 2015 CN
104560864 Apr 2015 CN
104561095 Apr 2015 CN
104593418 May 2015 CN
104593422 May 2015 CN
104611370 May 2015 CN
104651392 May 2015 CN
104651398 May 2015 CN
104651399 May 2015 CN
104651401 May 2015 CN
104673816 Jun 2015 CN
104725626 Jun 2015 CN
104726449 Jun 2015 CN
104726494 Jun 2015 CN
104745626 Jul 2015 CN
104762321 Jul 2015 CN
104805078 Jul 2015 CN
104805099 Jul 2015 CN
104805118 Jul 2015 CN
104846010 Aug 2015 CN
104894068 Sep 2015 CN
104894075 Sep 2015 CN
104928321 Sep 2015 CN
105039339 Nov 2015 CN
105039399 Nov 2015 CN
105063061 Nov 2015 CN
105087620 Nov 2015 CN
105112422 Dec 2015 CN
105112445 Dec 2015 CN
105112519 Dec 2015 CN
105121648 Dec 2015 CN
105132427 Dec 2015 CN
105132451 Dec 2015 CN
105177038 Dec 2015 CN
105177126 Dec 2015 CN
105210981 Jan 2016 CN
105219799 Jan 2016 CN
105238806 Jan 2016 CN
105255937 Jan 2016 CN
105274144 Jan 2016 CN
105296518 Feb 2016 CN
105296537 Feb 2016 CN
105316324 Feb 2016 CN
105316327 Feb 2016 CN
105316337 Feb 2016 CN
105331607 Feb 2016 CN
105331608 Feb 2016 CN
105331609 Feb 2016 CN
105331627 Feb 2016 CN
105400773 Mar 2016 CN
105400779 Mar 2016 CN
105400810 Mar 2016 CN
105441451 Mar 2016 CN
105462968 Apr 2016 CN
105463003 Apr 2016 CN
105463027 Apr 2016 CN
105492608 Apr 2016 CN
105492609 Apr 2016 CN
105505976 Apr 2016 CN
105505979 Apr 2016 CN
105518134 Apr 2016 CN
105518135 Apr 2016 CN
105518137 Apr 2016 CN
105518138 Apr 2016 CN
105518139 Apr 2016 CN
105518140 Apr 2016 CN
105543228 May 2016 CN
105543266 May 2016 CN
105543270 May 2016 CN
105567688 May 2016 CN
105567689 May 2016 CN
105567734 May 2016 CN
105567735 May 2016 CN
105567738 May 2016 CN
105593367 May 2016 CN
105594664 May 2016 CN
105602987 May 2016 CN
105624146 Jun 2016 CN
105624187 Jun 2016 CN
105646719 Jun 2016 CN
105647922 Jun 2016 CN
105647962 Jun 2016 CN
105647968 Jun 2016 CN
105647969 Jun 2016 CN
105671070 Jun 2016 CN
105671083 Jun 2016 CN
105695485 Jun 2016 CN
105779448 Jul 2016 CN
105779449 Jul 2016 CN
105802980 Jul 2016 CN
105821039 Aug 2016 CN
105821040 Aug 2016 CN
105821049 Aug 2016 CN
105821072 Aug 2016 CN
105821075 Aug 2016 CN
105821116 Aug 2016 CN
105838733 Aug 2016 CN
105861547 Aug 2016 CN
105861552 Aug 2016 CN
105861554 Aug 2016 CN
105886498 Aug 2016 CN
105886534 Aug 2016 CN
105886616 Aug 2016 CN
105907758 Aug 2016 CN
105907785 Aug 2016 CN
105925608 Sep 2016 CN
105950560 Sep 2016 CN
105950626 Sep 2016 CN
105950633 Sep 2016 CN
105950639 Sep 2016 CN
105985985 Oct 2016 CN
106011104 Oct 2016 CN
106011150 Oct 2016 CN
106011167 Oct 2016 CN
106011171 Oct 2016 CN
106032540 Oct 2016 CN
106047803 Oct 2016 CN
106047877 Oct 2016 CN
106047930 Oct 2016 CN
106086008 Nov 2016 CN
106086028 Nov 2016 CN
106086061 Nov 2016 CN
106086062 Nov 2016 CN
106109417 Nov 2016 CN
106119275 Nov 2016 CN
106119283 Nov 2016 CN
106148286 Nov 2016 CN
106148370 Nov 2016 CN
106148416 Nov 2016 CN
106167525 Nov 2016 CN
106167808 Nov 2016 CN
106167810 Nov 2016 CN
106167821 Nov 2016 CN
106172238 Dec 2016 CN
106190903 Dec 2016 CN
106191057 Dec 2016 CN
106191061 Dec 2016 CN
106191062 Dec 2016 CN
106191064 Dec 2016 CN
106191071 Dec 2016 CN
106191099 Dec 2016 CN
106191107 Dec 2016 CN
106191113 Dec 2016 CN
106191114 Dec 2016 CN
106191116 Dec 2016 CN
106191124 Dec 2016 CN
106222177 Dec 2016 CN
106222193 Dec 2016 CN
106222203 Dec 2016 CN
106244555 Dec 2016 CN
106244591 Dec 2016 CN
106244609 Dec 2016 CN
106282241 Jan 2017 CN
106318934 Jan 2017 CN
106318973 Jan 2017 CN
106350540 Jan 2017 CN
106367435 Feb 2017 CN
106399306 Feb 2017 CN
106399311 Feb 2017 CN
106399360 Feb 2017 CN
106399367 Feb 2017 CN
106399375 Feb 2017 CN
106399377 Feb 2017 CN
106434651 Feb 2017 CN
106434663 Feb 2017 CN
106434688 Feb 2017 CN
106434737 Feb 2017 CN
106434748 Feb 2017 CN
106434752 Feb 2017 CN
106434782 Feb 2017 CN
106446600 Feb 2017 CN
106479985 Mar 2017 CN
106480027 Mar 2017 CN
106480036 Mar 2017 CN
106480067 Mar 2017 CN
106480080 Mar 2017 CN
106480083 Mar 2017 CN
106480097 Mar 2017 CN
106544351 Mar 2017 CN
106544353 Mar 2017 CN
106544357 Mar 2017 CN
106554969 Apr 2017 CN
106566838 Apr 2017 CN
106701763 May 2017 CN
106701808 May 2017 CN
106701818 May 2017 CN
106701823 May 2017 CN
106701830 May 2017 CN
106754912 May 2017 CN
106755026 May 2017 CN
106755077 May 2017 CN
106755088 May 2017 CN
106755091 May 2017 CN
106755097 May 2017 CN
106755424 May 2017 CN
106801056 Jun 2017 CN
106834323 Jun 2017 CN
106834341 Jun 2017 CN
106834347 Jun 2017 CN
106845151 Jun 2017 CN
106868008 Jun 2017 CN
106868031 Jun 2017 CN
106906240 Jun 2017 CN
106906242 Jun 2017 CN
106916820 Jul 2017 CN
106916852 Jul 2017 CN
106939303 Jul 2017 CN
106947750 Jul 2017 CN
106947780 Jul 2017 CN
106957830 Jul 2017 CN
106957831 Jul 2017 CN
106957844 Jul 2017 CN
106957855 Jul 2017 CN
106957858 Jul 2017 CN
106967697 Jul 2017 CN
106967726 Jul 2017 CN
106978428 Jul 2017 CN
106987570 Jul 2017 CN
106987757 Jul 2017 CN
107012164 Aug 2017 CN
107012174 Aug 2017 CN
107012213 Aug 2017 CN
107012250 Aug 2017 CN
107022562 Aug 2017 CN
107034188 Aug 2017 CN
107034218 Aug 2017 CN
107034229 Aug 2017 CN
107043775 Aug 2017 CN
107043779 Aug 2017 CN
107043787 Aug 2017 CN
107058320 Aug 2017 CN
107058328 Aug 2017 CN
107058358 Aug 2017 CN
107058372 Aug 2017 CN
107083392 Aug 2017 CN
107099533 Aug 2017 CN
107099850 Aug 2017 CN
107119053 Sep 2017 CN
107119071 Sep 2017 CN
107129999 Sep 2017 CN
107130000 Sep 2017 CN
107142272 Sep 2017 CN
107142282 Sep 2017 CN
107177591 Sep 2017 CN
107177595 Sep 2017 CN
107177631 Sep 2017 CN
107190006 Sep 2017 CN
107190008 Sep 2017 CN
107217042 Sep 2017 CN
107217075 Sep 2017 CN
107227307 Oct 2017 CN
107227352 Oct 2017 CN
107236737 Oct 2017 CN
107236739 Oct 2017 CN
107236741 Oct 2017 CN
107245502 Oct 2017 CN
107254485 Oct 2017 CN
107266541 Oct 2017 CN
107267515 Oct 2017 CN
107287245 Oct 2017 CN
107298701 Oct 2017 CN
107299114 Oct 2017 CN
107304435 Oct 2017 CN
107312785 Nov 2017 CN
107312793 Nov 2017 CN
107312795 Nov 2017 CN
107312798 Nov 2017 CN
107326042 Nov 2017 CN
107326046 Nov 2017 CN
107354156 Nov 2017 CN
107354173 Nov 2017 CN
107356793 Nov 2017 CN
107362372 Nov 2017 CN
107365786 Nov 2017 CN
107365804 Nov 2017 CN
107384894 Nov 2017 CN
107384922 Nov 2017 CN
107384926 Nov 2017 CN
107400677 Nov 2017 CN
107418974 Dec 2017 CN
107435051 Dec 2017 CN
107435069 Dec 2017 CN
107446922 Dec 2017 CN
107446923 Dec 2017 CN
107446924 Dec 2017 CN
107446932 Dec 2017 CN
107446951 Dec 2017 CN
107446954 Dec 2017 CN
107460196 Dec 2017 CN
107474129 Dec 2017 CN
107475300 Dec 2017 CN
107488649 Dec 2017 CN
107502608 Dec 2017 CN
107502618 Dec 2017 CN
107513531 Dec 2017 CN
107519492 Dec 2017 CN
107523567 Dec 2017 CN
107523583 Dec 2017 CN
107541525 Jan 2018 CN
107557373 Jan 2018 CN
107557378 Jan 2018 CN
107557381 Jan 2018 CN
107557390 Jan 2018 CN
107557393 Jan 2018 CN
107557394 Jan 2018 CN
107557455 Jan 2018 CN
107574179 Jan 2018 CN
107586777 Jan 2018 CN
107586779 Jan 2018 CN
107604003 Jan 2018 CN
107619829 Jan 2018 CN
107619837 Jan 2018 CN
107630006 Jan 2018 CN
107630041 Jan 2018 CN
107630042 Jan 2018 CN
107630043 Jan 2018 CN
107641631 Jan 2018 CN
107653256 Feb 2018 CN
107686848 Feb 2018 CN
206970581 Feb 2018 CN
107760652 Mar 2018 CN
107760663 Mar 2018 CN
107760684 Mar 2018 CN
107760715 Mar 2018 CN
107784200 Mar 2018 CN
107794272 Mar 2018 CN
107794276 Mar 2018 CN
107815463 Mar 2018 CN
107828738 Mar 2018 CN
107828794 Mar 2018 CN
107828826 Mar 2018 CN
107828874 Mar 2018 CN
107858346 Mar 2018 CN
107858373 Mar 2018 CN
107880132 Apr 2018 CN
107881184 Apr 2018 CN
107893074 Apr 2018 CN
107893075 Apr 2018 CN
107893076 Apr 2018 CN
107893080 Apr 2018 CN
107893086 Apr 2018 CN
107904261 Apr 2018 CN
107937427 Apr 2018 CN
107937432 Apr 2018 CN
107937501 Apr 2018 CN
107974466 May 2018 CN
107988229 May 2018 CN
107988246 May 2018 CN
107988256 May 2018 CN
107988268 May 2018 CN
108018316 May 2018 CN
108034656 May 2018 CN
108048466 May 2018 CN
108102940 Jun 2018 CN
108103092 Jun 2018 CN
108103098 Jun 2018 CN
108103586 Jun 2018 CN
108148835 Jun 2018 CN
108148837 Jun 2018 CN
108148873 Jun 2018 CN
108192956 Jun 2018 CN
108251423 Jul 2018 CN
108251451 Jul 2018 CN
108251452 Jul 2018 CN
108342480 Jul 2018 CN
108359691 Aug 2018 CN
108359712 Aug 2018 CN
108384784 Aug 2018 CN
108396027 Aug 2018 CN
108410877 Aug 2018 CN
108410906 Aug 2018 CN
108410907 Aug 2018 CN
108410911 Aug 2018 CN
108424931 Aug 2018 CN
108441519 Aug 2018 CN
108441520 Aug 2018 CN
108486108 Sep 2018 CN
108486111 Sep 2018 CN
108486145 Sep 2018 CN
108486146 Sep 2018 CN
108486154 Sep 2018 CN
108486159 Sep 2018 CN
108486234 Sep 2018 CN
108504657 Sep 2018 CN
108504685 Sep 2018 CN
108504693 Sep 2018 CN
108546712 Sep 2018 CN
108546717 Sep 2018 CN
108546718 Sep 2018 CN
108559730 Sep 2018 CN
108559732 Sep 2018 CN
108559745 Sep 2018 CN
108559760 Sep 2018 CN
108570479 Sep 2018 CN
108588071 Sep 2018 CN
108588123 Sep 2018 CN
108588128 Sep 2018 CN
108588182 Sep 2018 CN
108610399 Oct 2018 CN
108611364 Oct 2018 CN
108624622 Oct 2018 CN
108642053 Oct 2018 CN
108642055 Oct 2018 CN
108642077 Oct 2018 CN
108642078 Oct 2018 CN
108642090 Oct 2018 CN
108690844 Oct 2018 CN
108707604 Oct 2018 CN
108707620 Oct 2018 CN
108707621 Oct 2018 CN
108707628 Oct 2018 CN
108707629 Oct 2018 CN
108715850 Oct 2018 CN
108728476 Nov 2018 CN
108728486 Nov 2018 CN
108753772 Nov 2018 CN
108753783 Nov 2018 CN
108753813 Nov 2018 CN
108753817 Nov 2018 CN
108753832 Nov 2018 CN
108753835 Nov 2018 CN
108753836 Nov 2018 CN
108795902 Nov 2018 CN
108822217 Nov 2018 CN
108823248 Nov 2018 CN
108823249 Nov 2018 CN
108823291 Nov 2018 CN
108841845 Nov 2018 CN
108853133 Nov 2018 CN
108866093 Nov 2018 CN
108893529 Nov 2018 CN
108913664 Nov 2018 CN
108913691 Nov 2018 CN
108913714 Nov 2018 CN
108913717 Nov 2018 CN
208034188 Nov 2018 CN
2 604 255 Jun 2013 EP
2840140 Feb 2015 EP
2 966 170 Jan 2016 EP
3 009 511 Apr 2016 EP
3031921 Jun 2016 EP
3045537 Jul 2016 EP
3144390 Mar 2017 EP
3199632 Aug 2017 EP
3216867 Sep 2017 EP
3252160 Dec 2017 EP
2 528 177 Jan 2016 GB
2 531 454 Apr 2016 GB
2531454 Apr 2016 GB
2542653 Mar 2017 GB
1208045 Feb 2016 HK
2007-501626 Feb 2007 JP
2008-515405 May 2008 JP
2010-539929 Dec 2010 JP
2011-081011 Apr 2011 JP
2011-523353 Aug 2011 JP
2012-525146 Oct 2012 JP
2012-531909 Dec 2012 JP
101584933 Jan 2016 KR
20160133380 Nov 2016 KR
20170037025 Apr 2017 KR
20170037028 Apr 2017 KR
101748575 Jun 2017 KR
2018-0022465 Mar 2018 KR
2016104674 Aug 2017 RU
2634395 Oct 2017 RU
2652899 May 2018 RU
1608100 Dec 2017 TW
2018-29773 Aug 2018 TW
WO 2001036452 May 2001 WO
WO 200138547 May 2001 WO
WO 2002059296 Aug 2002 WO
WO 2002068676 Sep 2002 WO
WO 2002103028 Dec 2002 WO
WO 2004007684 Jan 2004 WO
WO 2005014791 Feb 2005 WO
WO 2006002547 Jan 2006 WO
WO 2006042112 Apr 2006 WO
WO 2007025097 Mar 2007 WO
WO 2007136815 Nov 2007 WO
WO 2008108989 Sep 2008 WO
WO 2010011565 Jan 2010 WO
WO 2010011961 Jan 2010 WO
WO 2010054108 May 2010 WO
WO 2010054154 May 2010 WO
WO 2010068289 Jun 2010 WO
WO 2010075424 Jul 2010 WO
WO 2010102257 Sep 2010 WO
WO 2010129019 Nov 2010 WO
WO 2010129023 Nov 2010 WO
WO 2010132092 Nov 2010 WO
WO 2010144150 Dec 2010 WO
WO 2011002503 Jan 2011 WO
WO 2011017293 Feb 2011 WO
WO 2011053868 May 2011 WO
WO 2011053982 May 2011 WO
WO 2011075627 Jun 2011 WO
WO 2011091311 Jul 2011 WO
WO 2011109031 Sep 2011 WO
WO 2011143124 Nov 2011 WO
WO 2012054726 Apr 2012 WO
WO 2012065043 May 2012 WO
WO 2012125445 Sep 2012 WO
WO 2012138927 Oct 2012 WO
WO 2012149470 Nov 2012 WO
WO 2012158985 Nov 2012 WO
WO 2012158986 Nov 2012 WO
WO 2012164565 Dec 2012 WO
WO 2013012674 Jan 2013 WO
WO 2013013105 Jan 2013 WO
WO 2013047844 Apr 2013 WO
WO 2013066438 May 2013 WO
WO 2013098244 Jul 2013 WO
WO 2013119602 Aug 2013 WO
WO 2013126794 Aug 2013 WO
WO 2013130824 Sep 2013 WO
WO 2013141680 Sep 2013 WO
WO 2013142378 Sep 2013 WO
WO 2013142578 Sep 2013 WO
WO 2013142578 Sep 2013 WO
WO 2013160230 Oct 2013 WO
WO 2013166315 Nov 2013 WO
WO 2013169398 Nov 2013 WO
WO 2013169802 Nov 2013 WO
WO 2013176772 Nov 2013 WO
WO 2013176772 Nov 2013 WO
WO 2013176915 Nov 2013 WO
WO 2013176916 Nov 2013 WO
WO 2013181440 Dec 2013 WO
WO 2013186754 Dec 2013 WO
WO 2013188037 Dec 2013 WO
WO 2013188522 Dec 2013 WO
WO 2013188638 Dec 2013 WO
WO 2013192278 Dec 2013 WO
WO 2014005042 Jan 2014 WO
WO 2014011237 Jan 2014 WO
WO 2014011901 Jan 2014 WO
WO 2014018423 Jan 2014 WO
WO 2014020608 Feb 2014 WO
WO 2014022120 Feb 2014 WO
WO 2014022702 Feb 2014 WO
WO 2014022702 Feb 2014 WO
WO 2014036219 Mar 2014 WO
WO 2014039513 Mar 2014 WO
WO 2014039523 Mar 2014 WO
WO 2014039684 Mar 2014 WO
WO 2014039692 Mar 2014 WO
WO 2014039702 Mar 2014 WO
WO 2014039872 Mar 2014 WO
WO 2014039970 Mar 2014 WO
WO 2014041327 Mar 2014 WO
WO 2014043143 Mar 2014 WO
WO 2014047103 Mar 2014 WO
WO 2014059173 Apr 2014 WO
WO 2014059255 Apr 2014 WO
WO 2014065596 May 2014 WO
WO 2014066505 May 2014 WO
WO 2014068346 May 2014 WO
WO 2014070887 May 2014 WO
WO 2014071006 May 2014 WO
WO 2014071219 May 2014 WO
WO 2014071235 May 2014 WO
WO 2014072941 May 2014 WO
WO 2014081729 May 2014 WO
WO 2014081730 May 2014 WO
WO 2014081855 May 2014 WO
WO 2014082644 Jun 2014 WO
WO 2014085261 Jun 2014 WO
WO 2014085593 Jun 2014 WO
WO 2014085830 Jun 2014 WO
WO 2014089212 Jun 2014 WO
WO 2014089290 Jun 2014 WO
WO 2014089348 Jun 2014 WO
WO 2014089513 Jun 2014 WO
WO 2014089533 Jun 2014 WO
WO 2014089541 Jun 2014 WO
WO 2014093479 Jun 2014 WO
WO 2014093595 Jun 2014 WO
WO 2014093622 Jun 2014 WO
WO 2014093635 Jun 2014 WO
WO 2014093655 Jun 2014 WO
WO 2014093661 Jun 2014 WO
WO 2014093694 Jun 2014 WO
WO 2014093701 Jun 2014 WO
WO 2014093709 Jun 2014 WO
WO 2014093712 Jun 2014 WO
WO 2014093718 Jun 2014 WO
WO 2014093736 Jun 2014 WO
WO 2014093768 Jun 2014 WO
WO 2014093852 Jun 2014 WO
WO 2014096972 Jun 2014 WO
WO 2014099744 Jun 2014 WO
WO 2014099750 Jun 2014 WO
WO 2014104878 Jul 2014 WO
WO 2014110006 Jul 2014 WO
WO 2014110552 Jul 2014 WO
WO 2014113493 Jul 2014 WO
WO 2014123967 Aug 2014 WO
WO 2014124226 Aug 2014 WO
WO 2014125668 Aug 2014 WO
WO 2014127287 Aug 2014 WO
WO 2014128324 Aug 2014 WO
WO 2014128659 Aug 2014 WO
WO 2014130706 Aug 2014 WO
WO 2014130955 Aug 2014 WO
WO 2014131833 Sep 2014 WO
WO 2014138379 Sep 2014 WO
WO 2014143381 Sep 2014 WO
WO 2014144094 Sep 2014 WO
WO 2014144155 Sep 2014 WO
WO 2014144288 Sep 2014 WO
WO 2014144592 Sep 2014 WO
WO 2014144761 Sep 2014 WO
WO 2014144951 Sep 2014 WO
WO 2014145599 Sep 2014 WO
WO 2014145736 Sep 2014 WO
WO 2014150624 Sep 2014 WO
WO 2014152432 Sep 2014 WO
WO 2014153118 Sep 2014 WO
WO 2014153470 Sep 2014 WO
WO 2014161821 Oct 2014 WO
WO 2014164466 Oct 2014 WO
WO 2014165177 Oct 2014 WO
WO 2014165349 Oct 2014 WO
WO 2014165612 Oct 2014 WO
WO 2014165707 Oct 2014 WO
WO 2014165825 Oct 2014 WO
WO 2014172458 Oct 2014 WO
WO 2014172470 Oct 2014 WO
WO 2014172489 Oct 2014 WO
WO 2014173955 Oct 2014 WO
WO 2014182700 Nov 2014 WO
WO 2014183071 Nov 2014 WO
WO 2014184143 Nov 2014 WO
WO 2014184741 Nov 2014 WO
WO 2014184744 Nov 2014 WO
WO 2014186585 Nov 2014 WO
WO 2014186686 Nov 2014 WO
WO 2014190181 Nov 2014 WO
WO 2014191128 Dec 2014 WO
WO 2014191518 Dec 2014 WO
WO 2014191521 Dec 2014 WO
WO 2014191525 Dec 2014 WO
WO 2014191527 Dec 2014 WO
WO 2014193583 Dec 2014 WO
WO 2014194190 Dec 2014 WO
WO 2014197568 Dec 2014 WO
WO 2014197748 Dec 2014 WO
WO 2014199358 Dec 2014 WO
WO 2014200659 Dec 2014 WO
WO 2014201015 Dec 2014 WO
WO 2014204578 Dec 2014 WO
WO 2014204723 Dec 2014 WO
WO 2014204724 Dec 2014 WO
WO 2014204725 Dec 2014 WO
WO 2014204726 Dec 2014 WO
WO 2014204727 Dec 2014 WO
WO 2014204728 Dec 2014 WO
WO 2014204729 Dec 2014 WO
WO 2014205192 Dec 2014 WO
WO 2014207043 Dec 2014 WO
WO 2015002780 Jan 2015 WO
WO 2015004241 Jan 2015 WO
WO 2015006290 Jan 2015 WO
WO 2015006294 Jan 2015 WO
WO 2015006437 Jan 2015 WO
WO 2015006498 Jan 2015 WO
WO 2015006747 Jan 2015 WO
WO 2015007194 Jan 2015 WO
WO 2015010114 Jan 2015 WO
WO 2015011483 Jan 2015 WO
WO 2015013583 Jan 2015 WO
WO 2015017866 Feb 2015 WO
WO 2015018503 Feb 2015 WO
WO 2015021353 Feb 2015 WO
WO 2015021426 Feb 2015 WO
WO 2015021990 Feb 2015 WO
WO 2015024017 Feb 2015 WO
WO 2015024986 Feb 2015 WO
WO 2015026883 Feb 2015 WO
WO 2015026885 Feb 2015 WO
WO 2015026886 Feb 2015 WO
WO 2015026887 Feb 2015 WO
WO 2015027134 Feb 2015 WO
WO 2015028969 Mar 2015 WO
WO 2015030881 Mar 2015 WO
WO 2015031619 Mar 2015 WO
WO 2015031775 Mar 2015 WO
WO 2015032494 Mar 2015 WO
WO 2015033293 Mar 2015 WO
WO 2015034872 Mar 2015 WO
WO 2015034885 Mar 2015 WO
WO 2015035136 Mar 2015 WO
WO 2015035139 Mar 2015 WO
WO 2015035162 Mar 2015 WO
WO 2015040075 Mar 2015 WO
WO 2015040402 Mar 2015 WO
WO 2015042585 Mar 2015 WO
WO 2015048577 Apr 2015 WO
WO 2015048690 Apr 2015 WO
WO 2015048707 Apr 2015 WO
WO 2015049897 Apr 2015 WO
WO 2015051191 Apr 2015 WO
WO 2015052133 Apr 2015 WO
WO 2015052231 Apr 2015 WO
WO 2015052335 Apr 2015 WO
WO 2015053995 Apr 2015 WO
WO 2015054253 Apr 2015 WO
WO 2015054315 Apr 2015 WO
WO 2015057671 Apr 2015 WO
WO 2015057834 Apr 2015 WO
WO 2015057852 Apr 2015 WO
WO 2015057976 Apr 2015 WO
WO 2015057980 Apr 2015 WO
WO 2015059265 Apr 2015 WO
WO 2015065964 May 2015 WO
WO 2015066119 May 2015 WO
WO 2015066634 May 2015 WO
WO 2015066636 May 2015 WO
WO 2015066637 May 2015 WO
WO 2015066638 May 2015 WO
WO 2015066643 May 2015 WO
WO 2015069682 May 2015 WO
WO 2015070083 May 2015 WO
WO 2015070193 May 2015 WO
WO 2015070212 May 2015 WO
WO 2015071474 May 2015 WO
WO 2015073683 May 2015 WO
WO 2015073867 May 2015 WO
WO 2015073990 May 2015 WO
WO 2015075056 May 2015 WO
WO 2015075154 May 2015 WO
WO 2015075175 May 2015 WO
WO 2015075195 May 2015 WO
WO 2015075557 May 2015 WO
WO 2015077058 May 2015 WO
WO 2015077290 May 2015 WO
WO 2015077318 May 2015 WO
WO 2015079056 Jun 2015 WO
WO 2015079057 Jun 2015 WO
WO 2015086795 Jun 2015 WO
WO 2015086798 Jun 2015 WO
WO 2015088643 Jun 2015 WO
WO 2015089046 Jun 2015 WO
WO 2015089077 Jun 2015 WO
WO 2015089277 Jun 2015 WO
WO 2015089351 Jun 2015 WO
WO 2015089354 Jun 2015 WO
WO 2015089364 Jun 2015 WO
WO 2015089406 Jun 2015 WO
WO 2015089419 Jun 2015 WO
WO 2015089427 Jun 2015 WO
WO 2015089462 Jun 2015 WO
WO 2015089465 Jun 2015 WO
WO 2015089473 Jun 2015 WO
WO 2015089486 Jun 2015 WO
WO 2015095804 Jun 2015 WO
WO 2015099850 Jul 2015 WO
WO 2015100929 Jul 2015 WO
WO 2015103057 Jul 2015 WO
WO 2015103153 Jul 2015 WO
WO 2015105928 Jul 2015 WO
WO 2015108993 Jul 2015 WO
WO 2015109752 Jul 2015 WO
WO 2015110474 Jul 2015 WO
WO 2015112790 Jul 2015 WO
WO 2015112896 Jul 2015 WO
WO 2015113063 Jul 2015 WO
WO 2015114365 Aug 2015 WO
WO 2015115903 Aug 2015 WO
WO 2015116686 Aug 2015 WO
WO 2015116969 Aug 2015 WO
WO 2015117021 Aug 2015 WO
WO 2015117041 Aug 2015 WO
WO 2015117081 Aug 2015 WO
WO 2015118156 Aug 2015 WO
WO 2015119941 Aug 2015 WO
WO 2015121454 Aug 2015 WO
WO 2015122967 Aug 2015 WO
WO 2015123339 Aug 2015 WO
WO 2015124715 Aug 2015 WO
WO 2015124718 Aug 2015 WO
WO 2015126927 Aug 2015 WO
WO 2015127428 Aug 2015 WO
WO 2015127439 Aug 2015 WO
WO 2015129686 Sep 2015 WO
WO 2015131101 Sep 2015 WO
WO 2015133554 Sep 2015 WO
WO 2015134812 Sep 2015 WO
WO 2015136001 Sep 2015 WO
WO 2015138510 Sep 2015 WO
WO 2015138739 Sep 2015 WO
WO 2015138855 Sep 2015 WO
WO 2015138870 Sep 2015 WO
WO 2015139008 Sep 2015 WO
WO 2015139139 Sep 2015 WO
WO 2015143046 Sep 2015 WO
WO 2015143177 Sep 2015 WO
WO 2015145417 Oct 2015 WO
WO 2015148431 Oct 2015 WO
WO 2015148670 Oct 2015 WO
WO 2015148680 Oct 2015 WO
WO 2015148761 Oct 2015 WO
WO 2015148860 Oct 2015 WO
WO 2015148863 Oct 2015 WO
WO 2015153760 Oct 2015 WO
WO 2015153780 Oct 2015 WO
WO 2015153789 Oct 2015 WO
WO 2015153791 Oct 2015 WO
WO 2015153889 Oct 2015 WO
WO 2015153940 Oct 2015 WO
WO 2015155341 Oct 2015 WO
WO 2015155686 Oct 2015 WO
WO 2015157070 Oct 2015 WO
WO 2015157534 Oct 2015 WO
WO 2015159068 Oct 2015 WO
WO 2015159086 Oct 2015 WO
WO 2015159087 Oct 2015 WO
WO 2015160683 Oct 2015 WO
WO 2015161276 Oct 2015 WO
WO 2015163733 Oct 2015 WO
WO 2015164740 Oct 2015 WO
WO 2015164748 Oct 2015 WO
WO 2015165274 Nov 2015 WO
WO 2015165275 Nov 2015 WO
WO 2015165276 Nov 2015 WO
WO 2015166272 Nov 2015 WO
WO 2015167766 Nov 2015 WO
WO 2015167956 Nov 2015 WO
WO 2015168125 Nov 2015 WO
WO 2015168158 Nov 2015 WO
WO 2015168404 Nov 2015 WO
WO 2015168547 Nov 2015 WO
WO 2015168800 Nov 2015 WO
WO 2015171603 Nov 2015 WO
WO 2015171894 Nov 2015 WO
WO 2015171932 Nov 2015 WO
WO 2015172128 Nov 2015 WO
WO 2015173436 Nov 2015 WO
WO 2015175642 Nov 2015 WO
WO 2015179540 Nov 2015 WO
WO 2015183025 Dec 2015 WO
WO 2015183026 Dec 2015 WO
WO 2015183885 Dec 2015 WO
WO 2015184259 Dec 2015 WO
WO 2015184262 Dec 2015 WO
WO 2015184268 Dec 2015 WO
WO 2015188056 Dec 2015 WO
WO 2015188065 Dec 2015 WO
WO 2015188094 Dec 2015 WO
WO 2015188109 Dec 2015 WO
WO 2015188132 Dec 2015 WO
WO 2015188135 Dec 2015 WO
WO 2015188191 Dec 2015 WO
WO 2015189693 Dec 2015 WO
WO 2015191693 Dec 2015 WO
WO 2015191899 Dec 2015 WO
WO 2015191911 Dec 2015 WO
WO 2015193858 Dec 2015 WO
WO 2015195547 Dec 2015 WO
WO 2015195621 Dec 2015 WO
WO 2015195798 Dec 2015 WO
WO 2015198020 Dec 2015 WO
WO 2015200334 Dec 2015 WO
WO 2015200378 Dec 2015 WO
WO 2015200555 Dec 2015 WO
WO 2015200805 Dec 2015 WO
WO 2016001978 Jan 2016 WO
WO 2016004010 Jan 2016 WO
WO 2016007347 Jan 2016 WO
WO 2016007604 Jan 2016 WO
WO 2016007948 Jan 2016 WO
WO 2016011080 Jan 2016 WO
WO 2016011210 Jan 2016 WO
WO 2016011428 Jan 2016 WO
WO 2016012544 Jan 2016 WO
WO 2016012552 Jan 2016 WO
WO 2016014409 Jan 2016 WO
WO 2016014565 Jan 2016 WO
WO 2016014794 Jan 2016 WO
WO 2016014837 Jan 2016 WO
WO 2016016119 Feb 2016 WO
WO 2016016358 Feb 2016 WO
WO 2016019144 Feb 2016 WO
WO 2016020399 Feb 2016 WO
WO 2016021972 Feb 2016 WO
WO 2016021973 Feb 2016 WO
WO 2016022363 Feb 2016 WO
WO 2016022866 Feb 2016 WO
WO 2016022931 Feb 2016 WO
WO 2016025131 Feb 2016 WO
WO 2016025469 Feb 2016 WO
WO 2016025759 Feb 2016 WO
WO 2016026444 Feb 2016 WO
WO 2016028682 Feb 2016 WO
WO 2016028843 Feb 2016 WO
WO 2016028887 Feb 2016 WO
WO 2016033088 Mar 2016 WO
WO 2016033230 Mar 2016 WO
WO 2016033246 Mar 2016 WO
WO 2016033298 Mar 2016 WO
WO 2016035044 Mar 2016 WO
WO 2016036754 Mar 2016 WO
WO 2016037157 Mar 2016 WO
WO 2016040030 Mar 2016 WO
WO 2016040594 Mar 2016 WO
WO 2016044182 Mar 2016 WO
WO 2016044416 Mar 2016 WO
WO 2016046635 Mar 2016 WO
WO 2016049024 Mar 2016 WO
WO 2016049163 Mar 2016 WO
WO 2016049230 Mar 2016 WO
WO 2016049251 Mar 2016 WO
WO 2016049258 Mar 2016 WO
WO 2015048801 Apr 2016 WO
WO 2016053397 Apr 2016 WO
WO 2016054326 Apr 2016 WO
WO 2016057061 Apr 2016 WO
WO 2016057821 Apr 2016 WO
WO 2016057835 Apr 2016 WO
WO 2016057850 Apr 2016 WO
WO 2016057951 Apr 2016 WO
WO 2016057961 Apr 2016 WO
WO 2016061073 Apr 2016 WO
WO 2016061374 Apr 2016 WO
WO 2016061481 Apr 2016 WO
WO 2016061523 Apr 2016 WO
WO 2016064894 Apr 2016 WO
WO 2016069282 May 2016 WO
WO 2016069283 May 2016 WO
WO 2016069591 May 2016 WO
WO 2016069910 May 2016 WO
WO 2016069912 May 2016 WO
WO 2016070037 May 2016 WO
WO 2016070070 May 2016 WO
WO 2016070129 May 2016 WO
WO 2016072399 May 2016 WO
WO 2016072936 May 2016 WO
WO 2016073433 May 2016 WO
WO 2016073559 May 2016 WO
WO 2016073990 May 2016 WO
WO 2016075662 May 2016 WO
WO 2016076672 May 2016 WO
WO 2016077273 May 2016 WO
WO 2016077350 May 2016 WO
WO 2016080097 May 2016 WO
WO 2016080795 May 2016 WO
WO 2016081923 May 2016 WO
WO 2016081924 May 2016 WO
WO 2016082135 Jun 2016 WO
WO 2016083811 Jun 2016 WO
WO 2016084084 Jun 2016 WO
WO 2016084088 Jun 2016 WO
WO 2016086177 Jun 2016 WO
WO 2016089433 Jun 2016 WO
WO 2016089866 Jun 2016 WO
WO 2016089883 Jun 2016 WO
WO 2016090385 Jun 2016 WO
WO 2016094679 Jun 2016 WO
WO 2016094845 Jun 2016 WO
WO 2016094867 Jun 2016 WO
WO 2016094872 Jun 2016 WO
WO 2016094874 Jun 2016 WO
WO 2016094880 Jun 2016 WO
WO 2016094888 Jun 2016 WO
WO 2016097212 Jun 2016 WO
WO 2016097231 Jun 2016 WO
WO 2016097751 Jun 2016 WO
WO 2016099887 Jun 2016 WO
WO 2016100272 Jun 2016 WO
WO 2016100389 Jun 2016 WO
WO 2016100568 Jun 2016 WO
WO 2016100571 Jun 2016 WO
WO 2016100951 Jun 2016 WO
WO 2016100955 Jun 2016 WO
WO 2016100974 Jun 2016 WO
WO 2016103233 Jun 2016 WO
WO 2016104716 Jun 2016 WO
WO 2016106236 Jun 2016 WO
WO 2016106239 Jun 2016 WO
WO 2016106244 Jun 2016 WO
WO 2016106338 Jun 2016 WO
WO 2016108926 Jul 2016 WO
WO 2016109255 Jul 2016 WO
WO 2016109840 Jul 2016 WO
WO 2016110214 Jul 2016 WO
WO 2016110453 Jul 2016 WO
WO 2016110511 Jul 2016 WO
WO 2016110512 Jul 2016 WO
WO 2016111546 Jul 2016 WO
WO 2016112242 Jul 2016 WO
WO 2016112351 Jul 2016 WO
WO 2016112963 Jul 2016 WO
WO 2016114972 Jul 2016 WO
WO 2016115179 Jul 2016 WO
WO 2016115326 Jul 2016 WO
WO 2016115355 Jul 2016 WO
WO 2016116032 Jul 2016 WO
WO 2016120480 Aug 2016 WO
WO 2016123071 Aug 2016 WO
WO 2016123230 Aug 2016 WO
WO 2016123243 Aug 2016 WO
WO 2016123578 Aug 2016 WO
WO 2016126747 Aug 2016 WO
WO 2016130600 Aug 2016 WO
WO 2016130697 Aug 2016 WO
WO 2016131009 Aug 2016 WO
WO 2016132122 Aug 2016 WO
WO 2016133165 Aug 2016 WO
WO 2016135507 Sep 2016 WO
WO 2016135557 Sep 2016 WO
WO 2016135558 Sep 2016 WO
WO 2016135559 Sep 2016 WO
WO 2016137774 Sep 2016 WO
WO 2016137949 Sep 2016 WO
WO 2016141224 Sep 2016 WO
WO 2016141893 Sep 2016 WO
WO 2016142719 Sep 2016 WO
WO 2016145150 Sep 2016 WO
WO 2016148994 Sep 2016 WO
WO 2016149484 Sep 2016 WO
WO 2016149547 Sep 2016 WO
WO 2016150336 Sep 2016 WO
WO 2016150855 Sep 2016 WO
WO 2016154016 Sep 2016 WO
WO 2016154579 Sep 2016 WO
WO 2016154596 Sep 2016 WO
WO 2016155482 Oct 2016 WO
WO 2016161004 Oct 2016 WO
WO 2016161207 Oct 2016 WO
WO 2016161260 Oct 2016 WO
WO 2016161380 Oct 2016 WO
WO 2016161446 Oct 2016 WO
WO 2016164356 Oct 2016 WO
WO 2016164797 Oct 2016 WO
WO 2016166340 Oct 2016 WO
WO 2016167300 Oct 2016 WO
WO 2016170484 Oct 2016 WO
WO 2016172359 Oct 2016 WO
WO 2016172727 Oct 2016 WO
WO 2016174056 Nov 2016 WO
WO 2016174151 Nov 2016 WO
WO 2016174250 Nov 2016 WO
WO 2016176191 Nov 2016 WO
WO 2016176404 Nov 2016 WO
WO 2016176690 Nov 2016 WO
WO 2016177682 Nov 2016 WO
WO 2016178207 Nov 2016 WO
WO 2016179038 Nov 2016 WO
WO 2016179112 Nov 2016 WO
WO 2016181357 Nov 2016 WO
WO 2016182893 Nov 2016 WO
WO 2016182917 Nov 2016 WO
WO 2016182959 Nov 2016 WO
WO 2016183236 Nov 2016 WO
WO 2016183298 Nov 2016 WO
WO 2016183345 Nov 2016 WO
WO 2016183402 Nov 2016 WO
WO 2016183438 Nov 2016 WO
WO 2016183448 Nov 2016 WO
WO 2016184955 Nov 2016 WO
WO 2016184989 Nov 2016 WO
WO 2016185411 Nov 2016 WO
WO 2016186745 Nov 2016 WO
WO 2016186772 Nov 2016 WO
WO 2016186946 Nov 2016 WO
WO 2016186953 Nov 2016 WO
WO 2016187717 Dec 2016 WO
WO 2016187904 Dec 2016 WO
WO 2016191684 Dec 2016 WO
WO 2016191869 Dec 2016 WO
WO 2016196273 Dec 2016 WO
WO 2016196282 Dec 2016 WO
WO 2016196308 Dec 2016 WO
WO 2016196361 Dec 2016 WO
WO 2016196499 Dec 2016 WO
WO 2016196539 Dec 2016 WO
WO 2016196655 Dec 2016 WO
WO 2016196805 Dec 2016 WO
WO 2016196887 Dec 2016 WO
WO 2016197132 Dec 2016 WO
WO 2016197133 Dec 2016 WO
WO 2016197354 Dec 2016 WO
WO 2016197355 Dec 2016 WO
WO 2016197356 Dec 2016 WO
WO 2016197357 Dec 2016 WO
WO 2016197358 Dec 2016 WO
WO 2016197359 Dec 2016 WO
WO 2016197360 Dec 2016 WO
WO 2016197361 Dec 2016 WO
WO 2016197362 Dec 2016 WO
WO 2016198361 Dec 2016 WO
WO 2016198500 Dec 2016 WO
WO 2016200263 Dec 2016 WO
WO 2016201047 Dec 2016 WO
WO 2016201138 Dec 2016 WO
WO 2016201152 Dec 2016 WO
WO 2016201153 Dec 2016 WO
WO 2016201155 Dec 2016 WO
WO 2016205276 Dec 2016 WO
WO 2016205613 Dec 2016 WO
WO 2016205623 Dec 2016 WO
WO 2016205680 Dec 2016 WO
WO 2016205688 Dec 2016 WO
WO 2016205703 Dec 2016 WO
WO 2016205711 Dec 2016 WO
WO 2016205728 Dec 2016 WO
WO 2016205745 Dec 2016 WO
WO 2016205749 Dec 2016 WO
WO 2016205759 Dec 2016 WO
WO 2016205764 Dec 2016 WO
WO 2017001572 Jan 2017 WO
WO 2017001988 Jan 2017 WO
WO 2017004261 Jan 2017 WO
WO 2017004279 Jan 2017 WO
WO 2017004616 Jan 2017 WO
WO 2017005807 Jan 2017 WO
WO 2017009399 Jan 2017 WO
WO 2017010556 Jan 2017 WO
WO 2017011519 Jan 2017 WO
WO 2017011721 Jan 2017 WO
WO 2017011804 Jan 2017 WO
WO 2017015015 Jan 2017 WO
WO 2017015101 Jan 2017 WO
WO 2017015567 Jan 2017 WO
WO 2017015637 Jan 2017 WO
WO 2017017016 Feb 2017 WO
WO 2017019867 Feb 2017 WO
WO 2017019895 Feb 2017 WO
WO 2017023803 Feb 2017 WO
WO 2017023974 Feb 2017 WO
WO 2017024047 Feb 2017 WO
WO 2017024319 Feb 2017 WO
WO 2017024343 Feb 2017 WO
WO 2017024602 Feb 2017 WO
WO 2017025323 Feb 2017 WO
WO 2017027423 Feb 2017 WO
WO 2017028768 Feb 2017 WO
WO 2017029664 Feb 2017 WO
WO 2017031360 Feb 2017 WO
WO 2017031483 Feb 2017 WO
WO 2017035416 Mar 2017 WO
WO 2017040348 Mar 2017 WO
WO 2017040511 Mar 2017 WO
WO 2017040709 Mar 2017 WO
WO 2017040786 Mar 2017 WO
WO 2017040793 Mar 2017 WO
WO 2017040813 Mar 2017 WO
WO 2017043573 Mar 2017 WO
WO 2017043656 Mar 2017 WO
WO 2017044419 Mar 2017 WO
WO 2017044776 Mar 2017 WO
WO 2017044857 Mar 2017 WO
WO 2017049129 Mar 2017 WO
WO 2017050963 Mar 2017 WO
WO 2017053312 Mar 2017 WO
WO 2017053431 Mar 2017 WO
WO 2017053713 Mar 2017 WO
WO 2017053729 Mar 2017 WO
WO 2017053753 Mar 2017 WO
WO 2017053762 Mar 2017 WO
WO 2017053879 Mar 2017 WO
WO 2017054721 Apr 2017 WO
WO 2017058658 Apr 2017 WO
WO 2017059241 Apr 2017 WO
WO 2017062605 Apr 2017 WO
WO 2017062723 Apr 2017 WO
WO 2017062754 Apr 2017 WO
WO 2017062855 Apr 2017 WO
WO 2017062886 Apr 2017 WO
WO 2017062983 Apr 2017 WO
WO 2017064439 Apr 2017 WO
WO 2017064546 Apr 2017 WO
WO 2017064566 Apr 2017 WO
WO 2017066175 Apr 2017 WO
WO 2017066497 Apr 2017 WO
WO 2017066588 Apr 2017 WO
WO 2017066707 Apr 2017 WO
WO 2017068077 Apr 2017 WO
WO 2017068377 Apr 2017 WO
WO 2017069829 Apr 2017 WO
WO 2017070029 Apr 2017 WO
WO 2017070032 Apr 2017 WO
WO 2017070169 Apr 2017 WO
WO 2017070284 Apr 2017 WO
WO 2017070598 Apr 2017 WO
WO 2017070605 Apr 2017 WO
WO 2017070632 Apr 2017 WO
WO 2017070633 Apr 2017 WO
WO 2017072590 May 2017 WO
WO 2017074526 May 2017 WO
WO 2017074962 May 2017 WO
WO 2017075261 May 2017 WO
WO 2017075335 May 2017 WO
WO 2017075475 May 2017 WO
WO 2017077135 May 2017 WO
WO 2017077329 May 2017 WO
WO 2017078751 May 2017 WO
WO 2017079400 May 2017 WO
WO 2017079428 May 2017 WO
WO 2017079673 May 2017 WO
WO 2017079724 May 2017 WO
WO 2017081097 May 2017 WO
WO 2017081288 May 2017 WO
WO 2017083368 May 2017 WO
WO 2017083722 May 2017 WO
WO 2017083766 May 2017 WO
WO 2017087395 May 2017 WO
WO 2017090724 Jun 2017 WO
WO 2017091510 Jun 2017 WO
WO 2017091630 Jun 2017 WO
WO 2017092201 Jun 2017 WO
WO 2017093370 Jun 2017 WO
WO 2017095111 Jun 2017 WO
WO 2017096041 Jun 2017 WO
WO 2017096237 Jun 2017 WO
WO 2017100158 Jun 2017 WO
WO 2017100431 Jun 2017 WO
WO 2017104404 Jun 2017 WO
WO 2017105251 Jun 2017 WO
WO 2017105350 Jun 2017 WO
WO 2017105991 Jun 2017 WO
WO 2017106414 Jun 2017 WO
WO 2017106528 Jun 2017 WO
WO 2017106537 Jun 2017 WO
WO 2017106569 Jun 2017 WO
WO 2017106616 Jun 2017 WO
WO 2017106657 Jun 2017 WO
WO 2017106767 Jun 2017 WO
WO 2017109134 Jun 2017 WO
WO 2017109757 Jun 2017 WO
WO 2017112620 Jun 2017 WO
WO 2017115268 Jul 2017 WO
WO 2017115268 Jul 2017 WO
WO 2017117395 Jul 2017 WO
WO 2017118598 Jul 2017 WO
WO 2017118720 Jul 2017 WO
WO 2017123609 Jul 2017 WO
WO 2017123910 Jul 2017 WO
WO 2017124086 Jul 2017 WO
WO 2017124100 Jul 2017 WO
WO 2017124652 Jul 2017 WO
WO 2017126987 Jul 2017 WO
WO 2017127807 Jul 2017 WO
WO 2017131237 Aug 2017 WO
WO 2017132112 Aug 2017 WO
WO 2017136520 Aug 2017 WO
WO 2017136629 Aug 2017 WO
WO 2017136794 Aug 2017 WO
WO 2017139264 Aug 2017 WO
WO 2017139505 Aug 2017 WO
WO 2017141173 Aug 2017 WO
WO 2017142835 Aug 2017 WO
WO 2017142999 Aug 2017 WO
WO 2017143042 Aug 2017 WO
WO 2017147278 Aug 2017 WO
WO 2017147432 Aug 2017 WO
WO 2017147446 Aug 2017 WO
WO 2017147555 Aug 2017 WO
WO 2017151444 Sep 2017 WO
WO 2017152015 Sep 2017 WO
WO 2017155717 Sep 2017 WO
WO 2017157422 Sep 2017 WO
WO 2017158153 Sep 2017 WO
WO 2017160689 Sep 2017 WO
WO 2017160752 Sep 2017 WO
WO 2017160890 Sep 2017 WO
WO 2017161068 Sep 2017 WO
WO 2017165826 Sep 2017 WO
WO 2017165862 Sep 2017 WO
WO 2017172644 Oct 2017 WO
WO 2017172645 Oct 2017 WO
WO 2017172860 Oct 2017 WO
WO 2017173004 Oct 2017 WO
WO 2017173054 Oct 2017 WO
WO 2017173092 Oct 2017 WO
WO 2017174329 Oct 2017 WO
WO 2017176529 Oct 2017 WO
WO 2017176806 Oct 2017 WO
WO 2017178590 Oct 2017 WO
WO 2017180694 Oct 2017 WO
WO 2017180711 Oct 2017 WO
WO 2017180915 Oct 2017 WO
WO 2017180926 Oct 2017 WO
WO 2017181107 Oct 2017 WO
WO 2017181735 Oct 2017 WO
WO 2017182468 Oct 2017 WO
WO 2017184334 Oct 2017 WO
WO 2017184768 Oct 2017 WO
WO 2017184786 Oct 2017 WO
WO 2017186550 Nov 2017 WO
WO 2017189308 Nov 2017 WO
WO 2017189336 Nov 2017 WO
WO 2017190257 Nov 2017 WO
WO 2017190664 Nov 2017 WO
WO 2017191210 Nov 2017 WO
WO 2017192172 Nov 2017 WO
WO 2017192512 Nov 2017 WO
WO 2017192544 Nov 2017 WO
WO 2017192573 Nov 2017 WO
WO 2017193029 Nov 2017 WO
WO 2017193053 Nov 2017 WO
WO 2017196768 Nov 2017 WO
WO 2017197038 Nov 2017 WO
WO 2017197238 Nov 2017 WO
WO 2017197301 Nov 2017 WO
WO 2017201476 Nov 2017 WO
WO 2017205290 Nov 2017 WO
WO 2017205423 Nov 2017 WO
WO 2017207589 Dec 2017 WO
WO 2017208247 Dec 2017 WO
WO 2017209809 Dec 2017 WO
WO 2017213896 Dec 2017 WO
WO 2017213898 Dec 2017 WO
WO 2017214460 Dec 2017 WO
WO 2017216392 Dec 2017 WO
WO 2017216771 Dec 2017 WO
WO 2017218185 Dec 2017 WO
WO 2017219027 Dec 2017 WO
WO 2017219033 Dec 2017 WO
WO 2017220751 Dec 2017 WO
WO 2017222370 Dec 2017 WO
WO 2017222773 Dec 2017 WO
WO 2017222834 Dec 2017 WO
WO 2017223107 Dec 2017 WO
WO 2017223330 Dec 2017 WO
WO 2018000657 Jan 2018 WO
WO 2018002719 Jan 2018 WO
WO 2018005117 Jan 2018 WO
WO 2018005289 Jan 2018 WO
WO 2018005691 Jan 2018 WO
WO 2018005782 Jan 2018 WO
WO 2018005873 Jan 2018 WO
WO 201806693 Jan 2018 WO
WO 2018009520 Jan 2018 WO
WO 2018009562 Jan 2018 WO
WO 2018009822 Jan 2018 WO
WO 2018013821 Jan 2018 WO
WO 2018013990 Jan 2018 WO
WO 2018014384 Jan 2018 WO
WO 2018015444 Jan 2018 WO
WO 2018015936 Jan 2018 WO
WO 2018017754 Jan 2018 WO
WO 2018018979 Feb 2018 WO
WO 2018020248 Feb 2018 WO
WO 2018022480 Feb 2018 WO
WO 2018022634 Feb 2018 WO
WO 2018025206 Feb 2018 WO
WO 2018026723 Feb 2018 WO
WO 2018026976 Feb 2018 WO
WO 2018027078 Feb 2018 WO
WO 2018030608 Feb 2018 WO
WO 2018031683 Feb 2018 WO
WO 2018035250 Feb 2018 WO
WO 2018035300 Feb 2018 WO
WO 2018035423 Feb 2018 WO
WO 2018035503 Feb 2018 WO
WO 2018039145 Mar 2018 WO
WO 2018039438 Mar 2018 WO
WO 2018039440 Mar 2018 WO
WO 2018039448 Mar 2018 WO
WO 2018045630 Mar 2018 WO
WO 2018048827 Mar 2018 WO
WO 2018049168 Mar 2018 WO
WO 2018051347 Mar 2018 WO
WO 2018058064 Mar 2018 WO
WO 2018062866 Apr 2018 WO
WO 2018064352 Apr 2018 WO
WO 2018064371 Apr 2018 WO
WO 2018064516 Apr 2018 WO
WO 2018067546 Apr 2018 WO
WO 2018067846 Apr 2018 WO
WO 2018068053 Apr 2018 WO
WO 2018069474 Apr 2018 WO
WO 2018071623 Apr 2018 WO
WO 2018071663 Apr 2018 WO
WO 2018071868 Apr 2018 WO
WO 2018071892 Apr 2018 WO
WO 2018074979 Apr 2018 WO
WO 2018079134 May 2018 WO
WO 2018080573 May 2018 WO
WO 2018081504 May 2018 WO
WO 2018081535 May 2018 WO
WO 2018081728 May 2018 WO
WO 2018083128 May 2018 WO
WO 2018083606 May 2018 WO
WO 2018085288 May 2018 WO
WO 2018086623 May 2018 WO
WO 2018093990 May 2018 WO
WO 2018098383 May 2018 WO
WO 2018098480 May 2018 WO
WO 2018098587 Jun 2018 WO
WO 2018099256 Jun 2018 WO
WO 2018103686 Jun 2018 WO
WO 2018106268 Jun 2018 WO
WO 2018107028 Jun 2018 WO
WO 2018107103 Jun 2018 WO
WO 2018107129 Jun 2018 WO
WO 2018108272 Jun 2018 WO
WO 2018109101 Jun 2018 WO
WO 2018111946 Jun 2018 WO
WO 2018111947 Jun 2018 WO
WO 2018112336 Jun 2018 WO
WO 2018112446 Jun 2018 WO
WO 2018119354 Jun 2018 WO
WO 2018119359 Jun 2018 WO
WO 2018130830 Jul 2018 WO
WO 2018135838 Jul 2018 WO
WO 2018136396 Jul 2018 WO
WO 2018138385 Aug 2018 WO
WO 2018148246 Aug 2018 WO
WO 2018148256 Aug 2018 WO
WO 2018148647 Aug 2018 WO
WO 2018149418 Aug 2018 WO
WO 2018149888 Aug 2018 WO
WO 2018152418 Aug 2018 WO
WO 2018154380 Aug 2018 WO
WO 2018154387 Aug 2018 WO
WO 2018154412 Aug 2018 WO
WO 2018154413 Aug 2018 WO
WO 2018154418 Aug 2018 WO
WO 2018154439 Aug 2018 WO
WO 2018154459 Aug 2018 WO
WO 2018154462 Aug 2018 WO
WO 2018156372 Aug 2018 WO
WO 2018161009 Sep 2018 WO
WO 2018165504 Sep 2018 WO
WO 2018165629 Sep 2018 WO
WO 2018170015 Sep 2018 WO
WO 2018170340 Sep 2018 WO
WO 2018175502 Sep 2018 WO
WO 2018177351 Oct 2018 WO
WO 2018179578 Oct 2018 WO
WO 2018183403 Oct 2018 WO
WO 2018195545 Oct 2018 WO
WO 2018195555 Oct 2018 WO
WO 2018197020 Nov 2018 WO
WO 2018197495 Nov 2018 WO
WO 2018202800 Nov 2018 WO
WO 2018204493 Nov 2018 WO
WO 2018208755 Nov 2018 WO
WO 2018208998 Nov 2018 WO
WO 2018209158 Nov 2018 WO
WO 2018209320 Nov 2018 WO
WO 2018213708 Nov 2018 WO
WO 2018213726 Nov 2018 WO
WO 2018213771 Nov 2018 WO
WO 2018213791 Nov 2018 WO
WO 2018217852 Nov 2018 WO
WO 2018217981 Nov 2018 WO
WO 2018218166 Nov 2018 WO
WO 2018218188 Nov 2018 WO
WO 2018218206 Nov 2018 WO
Non-Patent Literature Citations (641)
Entry
U.S. Appl. No. 61/716,256, Jinek et al., filed Oct. 19, 2012.
U.S. Appl. No. 61/717,324, Cho et al., filed Oct. 23, 2012.
U.S. Appl. No. 61/734,256, Chen et al., filed Dec. 6, 2012.
U.S. Appl. No. 61/758,624, Chen et al., filed Jan. 30, 2013.
U.S. Appl. No. 61/761,046, Knight et al., filed Feb. 5, 2013.
U.S. Appl. No. 61/794,422, Knight et al., filed Mar. 15, 2013.
U.S. Appl. No. 61/803,599, Kim et al., filed Mar. 20, 2013.
U.S. Appl. No. 61/837,481, Cho et al., filed Jun. 20, 2013.
Partial Supplementary European Search Report for Application No. EP 12845790.0, dated Mar. 18, 2015.
Supplementary European Search Report for Application No. EP 12845790.0, dated Oct. 12, 2015.
International Search Report and Written Opinion for PCT/US2012/047778, dated May 30, 2013.
International Preliminary Report on Patentability for PCT/US2012/047778, dated Feb. 6, 2014.
International Search Report and Written Opinion for PCT/US2014/052231, dated Dec. 4, 2014.
International Search Report and Written Opinion for PCT/US2014/052231, dated Jan. 30, 2015 (Corrected Version).
International Preliminary Report on Patentability for PCT/US2014/052231, dated Mar. 3, 2016.
International Search Report and Written Opinion for PCT/US2014/050283, dated Nov. 6, 2014.
International Preliminary Report on Patentability for PCT/US2014/050283, dated Feb. 18, 2016.
International Search Report and Written Opinion for PCT/US2014/054247, dated Mar. 27, 2015.
International Preliminary Report on Patentability for PCT/US2014/054247, dated Mar. 17, 2016.
Invitation to Pay Additional Fees for PCT/US2014/054291, dated Dec. 18, 2014.
International Search Report and Written Opinion for PCT/US2014/054291, dated Mar. 27, 2015.
International Preliminary Report on Patentability for PCT/US2014/054291, dated Mar. 17, 2016.
International Search Report and Written Opinion for PCT/US2014/054252, dated Mar. 5, 2015.
International Preliminary Report on Patentability or PCT/US2014/054252, dated Mar. 17, 2016.
International Search Report and Written Opinion for PCT/US2014/070038, dated Apr. 14, 2015.
International Preliminary Report on Patentability for PCT/US2014/070038, dated Jun. 23, 2016.
International Search Report and Written Opinion for PCT/US2015/042770, dated Feb. 23, 2016.
International Search Report and Written Opinion for PCT/US2015/058479, dated Feb. 11, 2016.
International Search Report for PCT/US2013/032589, dated Jul. 26, 2013.
Alexandrov et al., Signatures of mutational processes in human cancer. Nature. Aug. 22, 2013;500(7463):415-21. doi: 10.1038/nature12477. Epub Aug. 14, 2013.
Ali et al., Novel genetic abnormalities in Bernard-Soulier syndrome in India. Ann Hematol. Mar. 2014;93(3):381-4. doi: 10.1007/s00277-013-1895-x. Epub Sep. 1, 2013.
Barrangou et al., CRISPR provides acquired resistance against viruses in prokaryotes. Science. Mar. 23, 2007;315(5819):1709-12.
Barrangou, RNA-mediated programmable DNA cleavage. Nat Biotechnol. Sep. 2012;30(9):836-8. doi: 10.1038/nbt.2357.
Bedell et al., In vivo genome editing using a high-efficiency TALEN system. Nature. Nov. 1, 2012;491(7422):114-8. Doi: 10.1038/nature11537. Epub Sep. 23, 2012.
Beumer et al., Efficient gene targeting in Drosophila with zinc-finger nucleases. Genetics. Apr. 2006;172(4):2391-403. Epub Feb. 1, 2006.
Bhagwat, DNA-cytosine deaminases: from antibody maturation to antiviral defense. DNA Repair (Amst). Jan. 5, 2004;3(1):85-9.
Boch, TALEs of genome targeting. Nat Biotechnol. Feb. 2011;29(2):135-6. Doi: 10.1038/nbt.1767.
Boeckle et al., Melittin analogs with high lytic activity at endosomal pH enhance transfection with purified targeted PEI polyplexes. J Control Release. May 15, 2006;112(2):240-8. Epub Mar. 20, 2006.
Branden and Tooze, Introduction to Protein Structure. 1999; 2nd edition. Garland Science Publisher: 3-12.
Brown et al., Serine recombinases as tools for genome engineering. Methods. Apr. 2011;53(4):372-9. doi: 10.1016/j.ymeth.2010.12.031. Epub Dec. 30, 2010.
Bulow et al., Multienzyme systems obtained by gene fusion. Trends Biotechnol. Jul. 1991;9(7):226-31.
Cade et al., Highly efficient generation of heritable zebrafish gene mutations using homo- and heterodimeric TALENs. Nucleic Acids Res. Sep. 2012;40(16):8001-10. Doi: 10.1093/nar/gks518. Epub Jun. 7, 2012.
Cameron, Recent advances in transgenic technology. Mol Biotechnol. Jun. 1997;7(3):253-65.
Cargill et al.,Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. Jul. 1999;22(3):231-8.
Caron et al., Intracellular delivery of a Tat-eGFP fusion protein into muscle cells. Mol Ther. Mar. 2001;3(3):310-8.
Carroll et al., Gene targeting in Drosophila and Caenorhabditis elegans with zinc-finger nucleases. Methods Mol Biol. 2008;435:63-77. doi: 10.1007/978-1-59745-232-8_5.
Carroll et al., Progress and prospects: zinc-finger nucleases as gene therapy agents. Gene Ther. Nov. 2008;15(22):1463-8. doi: 10.1038/gt.2008.145. Epub Sep. 11, 2008.
Carroll, A CRISPR approach to gene targeting. Mol Ther. Sep. 2012;20(9):1658-60. doi: 10.1038/mt.2012.171.
Cermak et al., Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting. Nucleic Acids Res. Jul. 2011;39(12):e82. Doi: 10.1093/nar/gkr218. Epub Apr. 14, 2011.
Charpentier et al., Biotechnology: Rewriting a genome. Nature. Mar. 7, 2013;495(7439):50-1. doi: 10.1038/495050a.
Chelico et al., Biochemical basis of immunological and retroviral responses to DNA-targeted cytosine deamination by activation-induced cytidine deaminase and APOBEC3G. J Biol Chem. Oct. 9, 2009;284(41):27761-5. doi: 10.1074/jbc.R109.052449. Epub Aug. 13, 2009.
Chichili et al., Linkers in the structural biology of protein-protein interactions. Protein Science. 2013;22:153-67.
Chipev et al., A leucine-proline mutation in the H1 subdomain of keratin 1 causes epidermolytic hyperkeratosis. Cell. Sep. 4, 1992;70(5):821-8.
Cho et al., Analysis of off-target effects of CRISPR/Cas-derived RNA-guided endonucleases and nickases. Genome Res. Jan. 2014;24(1):132-41. doi: 10.1101/gr.162339.113. Epub Nov. 19, 2013.
Cho et al., Targeted genome engineering in human cells with the Cas9 RNA-guided endonuclease. Nat Biotechnol. Mar. 2013;31(3):230-2. doi: 10.1038/nbt.2507. Epub Jan. 29, 2013.
Christian et al, Targeting G with TAL effectors: a comparison of activities of TALENs constructed with NN and NK repeat variable di-residues. PLoS One. 2012;7(9):e45383. doi: 10.1371/journal.pone.0045383. Epub Sep. 24, 2012.
Christian et al., Targeting DNA double-strand breaks with TAL effector nucleases. Genetics. Oct. 2010;186(2):757-61. Doi: 10.1534/genetics.110.120717. Epub Jul. 26, 2010.
Chung-Il et al., Artificial control of gene expression in mammalian cells by modulating RNA interference through aptamer-small molecule interaction. RNA. May 2006;12(5):710-6. Epub Apr. 10, 2006.
Chylinski et al., The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems. RNA Biol. May 2013;10(5):726-37. doi: 10.4161/rna.24321. Epub Apr. 5, 2013.
Cole-Strauss et al., Correction of the mutation responsible for sickle cell anemia by an RNA-DNA oligonucleotide. Science. Sep. 6, 1996;273(5280):1386-9.
Cong et al., Multiplex genome engineering using CRISPR/Cas systems. Science. Feb. 15, 2013;339(6121):819-23. doi: 10.1126/science.1231143. Epub Jan. 3, 2013.
Conticello, The AID/APOBEC family of nucleic acid mutators. Genome Biol. 2008;9(6):229. doi: 10.1186/gb-2008-9-6-229. Epub Jun. 17, 2008.
Cradick et al., CRISPR/Cas9 systems targeting Î2-globin and CCR5 genes have substantial off-target activity. Nucleic Acids Res. Nov. 1, 2013;41(20):9584-92. doi: 10.1093/nar/gkt714. Epub Aug. 11, 2013.
Cradick et al., ZFN-site searches genomes for zinc finger nuclease target sites and off-target sites. BMC Bioinformatics. May 13, 2011;12:152. doi: 10.1186/1471-2105-12-152.
Cradick et al., Zinc-finger nucleases as a novel therapeutic strategy for targeting hepatitis B virus DNAs. Mol Ther. May 2010;18(5):947-54. Doi: 10.1038/mt.2010.20. Epub Feb. 16, 2010.
Cui et al., Targeted integration in rat and mouse embryos with zinc-finger nucleases. Nat Biotechnol. Jan. 2011;29(1):64-7. Doi: 10.1038/nbt.1731. Epub Dec. 12, 2010.
Dahlem et al., Simple methods for generating and detecting locus-specific mutations induced with TALENs in the zebrafish genome. PLoS Genet. 2012;8(8):e1002861. doi: 10.1371/journal.pgen.1002861. Epub Aug. 16, 2012.
De Souza, Primer: genome editing with engineered nucleases. Nat Methods. Jan. 2012;9(1):27.
Deltcheva et al., CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III. Nature. Mar. 31, 2011;471(7340):602-7. doi: 10.1038/nature09886.
Dicarlo et al., Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic Acids Res. Apr. 2013;41(7):4336-43. doi: 10.1093/nar/gkt135. Epub Mar. 4, 2013.
Ding et al., A TALEN genome-editing system for generating human stem cell-based disease models. Cell Stem Cell. Feb. 7, 2013;12(2):238-51. Doi: 10.1016/j.stem.2012.11.011. Epub Dec. 13, 2012.
Doyon et al., Heritable targeted gene disruption in zebrafish using designed zinc-finger nucleases. Nat Biotechnol. Jun. 2008;26(6):702-8. Doi: 10.1038/nbt1409. Epub May 25, 2008.
Eltoukhy et al., Nucleic acid-mediated intracellular protein delivery by lipid-like nanoparticles. Biomaterials. Aug. 2014;35(24):6454-61. doi: 10.1016/j.biomaterials.2014.04.014. Epub May 13, 2014.
Esvelt et al., Genome-scale engineering for systems and synthetic biology. Mol Syst Biol. 2013;9:641. doi: 10.1038/msb.2012.66.
Esvelt et al., Orthogonal Cas9 proteins for RNA-guided gene regulation and editing. Nat Methods. Nov. 2013;10(11):1116-21. doi: 10.1038/nmeth.2681. Epub Sep. 29, 2013.
Fonfara et al., Phylogeny of Cas9 determines functional exchangeability of dual-RNA and Cas9 among orthologous type II CRISPR-Cas systems. Nucleic Acids Res. Feb. 2014;42(4):2577-90. doi: 10.1093/nar/gkt1074. Epub Nov. 22, 2013.
Fu et al., Improving CRISPR-Cas nuclease specificity using truncated guide RNAs. Nat Biotechnol. Mar. 2014;32(3):279-84. doi: 10.1038/nbt.2808. Epub Jan. 26, 2014.
Fu et al., High-frequency off-target mutagenesis induced by CRISPR-Cas nucleases in human cells. Nat Biotechnol. Sep. 2013;31(9):822-6. doi: 10.1038/nbt.2623. Epub Jun. 23, 2013.
Fuchs et al., Polyarginine as a multifunctional fusion tag. Protein Sci. Jun. 2005;14(6):1538-44.
Fujisawa et al., Disease-associated mutations in CIAS1 induce cathepsin B-dependent rapid cell death of human THP-1 monocytic cells. Blood. Apr. 1, 2007;109(7):2903-11.
Gaj et al., ZFN, TALEN, and CRISPR/Cas-based methods for genome engineering. Trends Biotechnol. Jul. 2013;31(7):397-405. doi: 10.1016/j.tibtech.2013.04.004. Epub May 9, 2013.
Gallo et al., A novel pathogenic PSEN1 mutation in a family with Alzheimer's disease: phenotypical and neuropathological features. J Alzheimers Dis. 2011;25(3):425-31. doi: 10.3233/JAD-2011-110185.
Gasiunas et al., Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria. Proc Natl Acad Sci U S A. Sep. 25, 2012;109(39):E2579-86. Epub Sep. 4, 2012. Supplementary materials included.
Gasiunas et al., RNA-dependent DNA endonuclease Cas9 of the CRISPR system: Holy Grail of genome editing? Trends Microbiol. Nov. 2013;21(11):562-7. doi: 10.1016/j.tim.2013.09.001. Epub Oct. 1, 2013.
Genbank Submission; NIH/NCBI, Accession No. J04623. Kita et al., Apr. 26, 1993. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. NC_002737.1. Ferretti et al., Jun. 27, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_015683.1. Trost et al., Jul. 6, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_016782.1. Trost et al., Jun. 11, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_016786.1. Trost et al., Aug. 28, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_017053.1. Fittipaldi et al., Jul. 6, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_017317.1. Trost et al., Jun. 11, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_017861.1. Heidelberg et al., Jun. 11, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_018010.1. Lucas et al., Jun. 11, 2013. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. NC_018721.1. Feng et al., Jun. 11, 2013. 1 pages.
Genbank Submission; NIH/NCBI, Accession No. NC_021284.1. Ku et al., Jul. 12, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_021314.1. Zhang et al., Jul. 15, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NC_021846.1. Lo et al., Jul. 22, 2013. 1 page.
Genbank Submission; NIH/NCBI, Accession No. NP_472073.1. Glaser et al., Jun. 27, 2013. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. P42212. Prasher et al., Mar. 19, 2014. 7 pages.
Genbank Submission; NIH/NCBI, Accession No. YP_002342100.1. Bernardini et al., Jun. 10, 2013. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. YP_002344900.1. Gundogdu et al., Mar. 19, 2014. 2 pages.
Genbank Submission; NIH/NCBI, Accession No. YP_820832.1. Makarova et al., Aug. 27, 2013. 2 pages.
Gerber et al., RNA editing by base deamination: more enzymes, more targets, new mysteries. Trends Biochem Sci. Jun. 2001;26(6):376-84.
Gilbert et al., CRISPR-mediated modular RNA-guided regulation of transcription in eukaryotes. Cell. 2013 154(2):442-51.
Gilleron et al., Image-based analysis of lipid nanoparticle-mediated siRNA delivery, intracellular trafficking and endosomal escape. Nat Biotechnol. Jul. 2013;31(7):638-46. doi: 10.1038/nbt.2612. Epub Jun. 23, 2013.
Guilinger et al., Broad specificity profiling of TALENs results in engineered nucleases with improved DNA-cleavage specificity. Nat Methods. Apr. 2014;11(4):429-35. doi: 10.1038/nmeth.2845. Epub Feb. 16, 2014.
Guilinger et al., Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat Biotechnol. Jun. 2014;32(6):577-82. doi: 10.1038/nbt.2909. Epub Apr. 25, 2014.
Guo et al., Protein tolerance to random amino acid change. Proc Natl Acad Sci U S A. Jun. 22, 2004;101(25):9205-10. Epub Jun. 14, 2004.
Hale et al., RNA-guided RNA cleavage by a CRISPR RNA-Cas protein complex. Cell. Nov. 25, 2009;139(5):945-56. doi: 10.1016/j.ce11.2009.07.040.
Hartung et al., Correction of metabolic, craniofacial, and neurologic abnormalities in MPS I mice treated at birth with adeno-associated virus vector transducing the human alpha-L-iduronidase gene. Mol Ther. Jun. 2004;9(6):866-75.
Hasadsri et al., Functional protein delivery into neurons using polymeric nanoparticles. J Biol Chem. Mar. 13, 2009;284(11):6972-81. doi: 10.1074/jbc.M805956200. Epub Jan. 7, 2009.
Hill et al., Functional analysis of conserved histidines in ADP-glucose pyrophosphorylase from Escherichia coli.Biochem Biophys Res Commun. Mar. 17, 1998;244(2):573-7.
Hockemeyer et al., Efficient targeting of expressed and silent genes in human ESCs and iPSCs using zinc-finger nucleases. Nat Biotechnol. Sep. 2009;27(9):851-7. doi: 10.1038/nbt.1562. Epub Aug. 13, 2009.
Hockemeyer et al., Genetic engineering of human pluripotent cells using TALE nucleases. Nat Biotechnol. Jul. 7, 2011;29(8):731-4. doi: 10.1038/nbt.1927.
Holden et al., Crystal structure of the anti-viral APOBEC3G catalytic domain and functional implications. Nature. Nov. 6, 2008;456(7218):121-4. doi: 10.1038/nature07357. Epub Oct. 12, 2008.
Horvath et al., CRISPR/Cas, the immune system of bacteria and archaea. Science. Jan. 8, 2010;327(5962):167-70. doi: 10.1126/science.1179555.
Houdebine, The methods to generate transgenic animals and to control transgene expression. J Biotechnol. Sep. 25, 2002;98(2-3):145-60.
Hsu et al., DNA targeting specificity of RNA-guided Cas9 nucleases. Nat Biotechnol. Sep. 2013;31(9):827-32. doi: 10.1038/nbt.2647. Epub Jul. 21, 2013.
Huang et al., Heritable gene targeting in zebrafish using customized TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):699-700. doi: 10.1038/nbt.1939.
Humbert et al., Targeted gene therapies: tools, applications, optimization. Crit Rev Biochem Mol Biol. May-Jun. 2012;47(3):264-81. doi: 10.3109/10409238.2012.658112.
Hurt et al., Highly specific zinc finger proteins obtained by directed domain shuffling and cell-based selection. Proc Natl Acad Sci U S A. Oct. 14, 2003;100(21):12271-6. Epub Oct. 3, 2003.
Hwang et al., Efficient genome editing in zebrafish using a CRISPR-Cas system. Nat Biotechnol. Mar. 2013;31(3):227-9. doi: 10.1038/nbt.2501. Epub Jan. 29, 2013.
Ikediobi et al., Mutation analysis of 24 known cancer genes in the NCI-60 cell line set. Mol Cancer Ther. Nov. 2006;5(11):2606-12. Epub Nov. 6, 2006.
Irrthum et al., Congenital hereditary lymphedema caused by a mutation that inactivates VEGFR3 tyrosine kinase. Am J Hum Genet. Aug. 2000;67(2):295-301. Epub Jun. 9, 2000.
Jamieson et al., Drug discovery with engineered zinc-finger proteins. Nat Rev Drug Discov. May 2003;2(5):361-8.
Jansen et al., Backbone and nucleobase contacts to glucosamine-6-phosphate in the glmS ribozyme. Nat Struct Mol Biol. Jun. 2006;13(6):517-23. Epub May 14, 2006.
Jenkins et al., Comparison of a preQ1 riboswitch aptamer in metabolite-bound and free states with implications for gene regulation. J Biol Chem. Jul. 15, 2011;286(28):24626-37. doi: 10.1074/jbc.M111.230375. Epub May 18, 2011.
Jiang et al., RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Nat Biotechnol. Mar. 2013;31(3):233-9. doi: 10.1038/nbt.2508. Epub Jan. 29, 2013.
Jinek et al., A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science. Aug. 17, 2012;337(6096):816-21. doi: 10.1126/science.1225829. Epub Jun. 28, 2012.
Jinek et al., RNA-programmed genome editing in human cells. Elife. Jan. 29, 2013;2:e00471. doi: 10.7554/eLife.00471.
Jinek et al., Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science. Mar. 14, 2014;343(6176):1247997. doi: 10.1126/science.1247997. Epub Feb. 6, 2014.
Jore et al., Structural basis for CRISPR RNA-guided DNA recognition by Cascade. Nat Struct Mol Biol. May 2011;18(5):529-36. doi: 10.1038/nsmb.2019. Epub Apr. 3, 2011.
Joung et al.,TALENs: a widely applicable technology for targeted genome editing. Nat Rev Mol Cell Biol. Jan. 2013;14(1):49-55. doi: 10.1038/nrm3486. Epub Nov. 21, 2012.
Kaiser et al., Gene therapy. Putting the fingers on gene repair. Science. Dec. 23, 2005;310(5756):1894-6.
Kandavelou et al., Targeted manipulation of mammalian genomes using designed zinc finger nucleases. Biochem Biophys Res Commun. Oct. 9, 2009;388(1):56-61. doi: 10.1016/j.bbrc.2009.07.112. Epub Jul. 25, 2009.
Kappel et al., Regulating gene expression in transgenic animals.Curr Opin Biotechnol. Oct. 1992;3(5):548-53.
Karpenshif et al., From yeast to mammals: recent advances in genetic control of homologous recombination. DNA Repair (Amst). Oct. 1, 2012;11(10):781-8. doi: 10.1016/j.dnarep.2012.07.001. Epub Aug. 11, 2012. Review.
Kim et al., A library of TAL effector nucleases spanning the human genome. Nat Biotechnol. Mar. 2013;31(3):251-8. Doi: 10.1038/nbt.2517. Epub Feb. 17, 2013.
Kim et al., Highly efficient RNA-guided genome editing in human cells via delivery of purified Cas9 ribonucleoproteins. Genome Res. Jun. 2014;24(6):1012-9. doi: 10.1101/gr.171322.113. Epub Apr. 2, 2014.
Kim et al., TALENs and ZFNs are associated with different mutationsignatures. Nat Methods. Mar. 2013;10(3):185. doi: 10.1038/nmeth.2364. Epub Feb. 10, 2013.
Kim et al., Targeted genome editing in human cells with zinc finger nucleases constructed via modular assembly. Genome Res. Jul. 2009;19(7):1279-88. doi: 10.1101/gr.089417.108. Epub May 21, 2009.
Klauser et al., An engineered small RNA-mediated genetic switch based on a ribozyme expression platform. Nucleic Acids Res. May 1, 2013;41(10):5542-52. doi: 10.1093/nar/gkt253. Epub Apr. 12, 2013.
Kumar et al., Structural and functional consequences of the mutation of a conserved arginine residue in alphaA and alphaB crystallins. J Biol Chem. Aug. 20, 1999;274(34):24137-41.
Kundu et al., Leucine to proline substitution by SNP at position 197 in Caspase-9 gene expression leads to neuroblastoma: a bioinformatics analysis. 3 Biotech. 2013; 3:225-34.
Larson et al., CRISPR interference (CRISPRi) for sequence-specific control of gene expression. Nat Protoc. Nov. 2013;8(11):2180-96. doi: 10.1038/nprot.2013.132. Epub Oct. 17, 2013.
Lavergne et al., Defects in type IIA von Willebrand disease: a cysteine 509 to arginine substitution in the mature von Willebrand factor disrupts a disulphide loop involved in the interaction with platelet glycoprotein Ib-IX. Br J Haematol. Sep. 1992;82(1):66-72.
Lazar et al., Transforming growth factor alpha: mutation of aspartic acid 47 and leucine 48 results in different biological activities. Mol Cell Biol. Mar. 1988;8(3):1247-52.
Lee et al., PIK3CA gene is frequently mutated in breast carcinomas and hepatocellular carcinomas. Oncogene. Feb. 17, 2005;24(8):1477-80.
Lei et al., Efficient targeted gene disruption in Xenopus embryos using engineered transcription activator-like effector nucleases (TALENs). Proc Natl Acad Sci U S A. Oct. 23, 2012;109(43):17484-9. Doi: 10.1073/pnas.1215421109. Epub Oct. 8, 2012.
Lenk et al., Pathogenic mechanism of the FIG4 mutation responsible for Charcot-Marie-Tooth disease CMT4J. PLoS Genet. Jun. 2011;7(6):e1002104. doi: 10.1371/journal.pgen.1002104. Epub Jun. 2, 2011.
Lewis et al., A serum-resistant cytofectin for cellular delivery of antisense oligodeoxynucleotides and plasmid DNA. Proc Natl Acad Sci U S A. Apr. 16, 1996;93(8):3176-81.
Lewis et al., Codon 129 polymorphism of the human prion protein influences the kinetics of amyloid formation. J Gen Virol. Aug. 2006;87(Pt 8):2443-9.
Li et al., Current approaches for engineering proteins with diverse biological properties. Adv Exp Med Biol. 2007;620:18-33.
Li et al., Modularly assembled designer TAL effector nucleases for targeted gene knockout and gene replacement in eukaryotes. Nucleic Acids Res. Aug. 2011;39(14):6315-25. doi: 10.1093/nar/gkr188. Epub Mar. 31, 2011.
Li et al., TAL nucleases (TALNs): hybrid proteins composed of TAL effectors and FokI DNA-cleavage domain. Nucleic Acids Res. Jan. 2011;39(1):359-72. doi: 10.1093/nar/gkq704. Epub Aug. 10, 2010.
Liu et al., Cell-penetrating peptide-mediated delivery of TALEN proteins via bioconjugation for genome engineering. PLoS One. Jan. 20, 2014;9(1):e85755. doi: 10.1371/journal.pone.0085755. eCollection 2014.
Liu et al., Design of polydactyl zinc-finger proteins for unique addressing within complex genomes. Proc Natl Acad Sci U S A. May 27, 1997;94(11):5525-30.
Liu et al., Fast Colorimetric Sensing of Adenosine and Cocaine Based on a General Sensor Design Involving Aptamers and Nanoparticles. Angew Chem. 2006;118(1):96-100.
Lombardo et al., Gene editing in human stem cells using zinc finger nucleases and integrase-defective lentiviral vector delivery. Nat Biotechnol. Nov. 2007;25(11):1298-306. Epub Oct. 28, 2007.
Lundberg et al., Delivery of short interfering RNA using endosomolytic cell-penetrating peptides. FASEB J. Sep. 2007;21(11):2664-71. Epub Apr. 26, 2007.
Maeder et al., CRISPR RNA-guided activation of endogenous human genes. Nat Methods. Oct. 2013;10(10):977-9. doi: 10.1038/nmeth.2598. Epub Jul. 25, 2013.
Maeder et al., Rapid “open-source” engineering of customized zinc-finger nucleases for highly efficient gene modification. Mol Cell. Jul. 25, 2008;31(2):294-301. doi:10.1016/j.molcel.2008.06.016.
Maeder et al., Robust, synergistic regulation of human gene expression using TALE activators. Nat Methods. Mar. 2013;10(3):243-5. doi: 10.1038/nmeth.2366. Epub Feb. 10, 2013.
Mahfouz et al., De novo-engineered transcription activator-like effector (TALE) hybrid nuclease with novel DNA binding specificity creates double-strand breaks. Proc Natl Acad Sci U S A. Feb. 8, 2011;108(6):2623-8. doi: 10.1073/pnas.1019533108. Epub Jan. 24, 2011.
Mali et al., Cas9 as a versatile tool for engineering biology. Nat Methods. Oct. 2013;10(10):957-63. doi: 10.1038/nmeth.2649.
Mali et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nat Biotechnol. Sep. 2013;31(9):833-8. doi: 10.1038/nbt.2675. Epub Aug. 1, 2013.
Mali et al., RNA-guided human genome engineering via Cas9. Science. Feb. 15, 2013;339(6121):823-6. doi: 10.1126/science.1232033. Epub Jan. 3, 2013.
Mani et al., Design, engineering, and characterization of zinc finger nucleases. Biochem Biophys Res Commun. Sep. 23, 2005;335(2):447-57.
Meng et al., Targeted gene inactivation in zebrafish using engineered zinc-finger nucleases. Nat Biotechnol. Jun. 2008;26(6):695-701. doi: 10.1038/nbt1398. Epub May 25, 2008.
Miller et al., A TALE nuclease architecture for efficient genome editing. Nat Biotechnol. Feb. 2011;29(2):143-8. doi:10.1038/nbt.1755. Epub Dec. 22, 2010.
Miller et al., An improved zinc-finger nuclease architecture for highly specific genome editing. Nat Biotechnol. Jul. 2007;25(7):778-85. Epub Jul. 1, 2007.
Minoretti et al., A W148R mutation in the human FOXD4 gene segregating with dilated cardiomyopathy, obsessive-compulsive disorder, and suicidality. Int J Mol Med. Mar. 2007;19(3):369-72.
Moore et al., Improved somatic mutagenesis in zebrafish using transcription activator-like effector nucleases (TALENs). PloS One. 2012;7(5):e37877. Doi: 10.1371/journal.pone.0037877. Epub May 24, 2012.
Morbitzer et al., Assembly of custom TALE-type DNA binding domains by modular cloning. Nucleic Acids Res. Jul. 2011;39(13):5790-9. doi: 10.1093/nar/gkr151. Epub Mar. 18, 2011.
Morris et al., A peptide carrier for the delivery of biologically active proteins into mammalian cells. Nat Biotechnol. Dec. 2001;19(12):1173-6.
Moscou et al., A simple cipher governs DNA recognition by TAL effectors. Science. Dec. 11, 2009;326(5959):1501. doi: 10.1126/science.1178817.
Mullins et al., Transgenesis in nonmurine species. Hypertension. Oct. 1993;22(4):630-3.
Mussolino et al., A novel TALE nuclease scaffold enables high genome editing activity in combination with low toxicity. Nucleic Acids Res. Nov. 2011;39(21):9283-93. Doi: 10.1093/nar/gkr597. Epub Aug. 3, 2011.
Mussolino et al., TALE nucleases: tailored genome engineering made easy. Curr Opin Biotechnol. Oct. 2012;23(5):644-50. doi: 10.1016/j.copbio.2012.01.013. Epub Feb. 17, 2012.
Narayanan et al., Clamping down on weak terminal base pairs: oligonucleotides with molecular caps as fidelity-enhancing elements at the 5′- and 3′-terminal residues. Nucleic Acids Res. May 20, 2004;32(9):2901-11. Print 2004.
Navaratnam et al., An overview of cytidine deaminases. Int J Hematol. Apr. 2006;83(3):195-200.
NCBI Reference Sequence: NM_002427.3. Wu et al., May 3, 2014. 5 pages.
Nishimasu et al., Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell. Feb. 27, 2014;156(5):935-49. doi: 10.1016/j.cell.2014.02.001. Epub Feb. 13, 2014.
[No Author Listed], EMBL Accession No. Q99ZW2. Nov. 2012. 2 pages.
[No Author Listed], Invitrogen Lipofectamine™ 2000 product sheets, 2002. 2 pages.
[No Author Listed], Invitrogen Lipofectamine™ 2000 product sheets, 2005. 3 pages.
[No Author Listed], Invitrogen Lipofectamine™ LTX product sheets, 2011. 4 pages.
[No Author Listed], Thermo Fisher Scientific—How Cationic Lipid Mediated Transfection Works, retrieved from the internet Aug. 27, 2015. 2 pages.
Nomura et al., Synthetic mammalian riboswitches based on guanine aptazyme. Chem Commun (Camb). Jul. 21, 2012;48(57):7215-7. doi: 10.1039/c2cc33140c. Epub Jun. 13, 2012.
Noris et al., A phenylalanine-55 to serine amino-acid substitution in the human glycoprotein IX leucine-rich repeat is associated with Bernard-Soulier syndrome. Br J Haematol. May 1997;97(2):312-20.
O'Connell et al., Programmable RNA recognition and cleavage by CRISPR/Cas9. Nature. Dec. 11, 2014;516(7530):263-6. doi: 10.1038/nature13769. Epub Sep. 28, 2014.
Osborn et al., TALEN-based gene correction for epidermolysis bullosa. Mol Ther. Jun. 2013;21(6):1151-9. doi: 10.1038/mt.2013.56. Epub Apr. 2, 2013.
Pan et al., Biological and biomedical applications of engineered nucleases. Mol Biotechnol. Sep. 2013;55(1):54-62. doi: 10.1007/s12033-012-9613-9.
Pattanayak et al., Determining the specificities of TALENs, Cas9, and other genome-editing enzymes. Methods Enzymol. 2014;546:47-78. doi: 10.1016/B978-0-12-801185-0.00003-9.
Pattanayak et al., High-throughput profiling of off-target DNA cleavage reveals RNA-programmed Cas9 nuclease specificity. Nat Biotechnol. Sep. 2013;31(9):839-43. doi: 10.1038/nbt.2673. Epub Aug. 11, 2013.
Pattanayak et al., Revealing off-target cleavage specificities of zinc-finger nucleases by in vitro selection. Nat Methods. Aug. 7, 2011;8(9):765-70. doi: 10.1038/nmeth.1670.
Pavletich et al., Zinc finger-DNA recognition: crystal structure of a Zif268-DNA complex at 2.1 A. Science. May 10, 1991;252(5007):809-17.
Pennisi et al., The CRISPR craze. Science. Aug. 23, 2013;341(6148):833-6. doi: 10.1126/science.341.6148.833.
Pennisi et al., The tale of the TALEs. Science. Dec. 14, 2012;338(6113):1408-11. doi: 10.1126/science.338.6113.1408.
Perez et al., Establishment of HIV-1 resistance in CD4+ T cells by genome editing using zinc-finger nucleases. Nat Biotechnol. Jul. 2008;26(7):808-16. Doi: 10.1038/nbt1410. Epub Jun. 29, 2008.
Perez-Pinera et al., Advances in targeted genome editing. Curr Opin Chem Biol. Aug. 2012;16(3-4):268-77. doi: 10.1016/j.cbpa.2012.06.007. Epub Jul. 20, 2012.
Perez-Pinera et al., RNA-guided gene activation by CRISPR-Cas9-based transcription factors. Nat Methods. Oct. 2013;10(10):973-6. doi: 10.1038/nmeth.2600. Epub Jul. 25, 2013.
Petek et al., Frequent endonuclease cleavage at off-target locations in vivo. Mol Ther. May 2010;18(5):983-6. Doi: 10.1038/mt.2010.35. Epub Mar. 9, 2010.
Phillips, The challenge of gene therapy and DNA delivery. J Pharm Pharmacol. Sep. 2001;53(9):1169-74.
Poller et al., A leucine-to-proline substitution causes a defective alpha 1-antichymotrypsin allele associated with familial obstructive lung disease. Genomics. Sep. 1993;17(3):740-3.
Porteus, Design and testing of zinc finger nucleases for use in mammalian cells. Methods Mol Biol. 2008;435:47-61. doi: 10.1007/978-1-59745-232-8_4.
Proudfoot et al., Zinc finger recombinases with adaptable DNA sequence specificity. PLoS One. Apr. 29, 2011;6(4):e19537. doi: 10.1371/journal.pone.0019537.
Qi et al., Engineering naturally occurring trans-acting non-coding RNAs to sense molecular signals. Nucleic Acids Res. Jul. 2012;40(12):5775-86. doi: 10.1093/nar/gks168. Epub Mar. 1, 2012.
Qi et al., Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression. Cell. Feb. 28, 2013;152(5):1173-83. doi: 10.1016/j.cell.2013.02.022.
Ramakrishna et al., Gene disruption by cell-penetrating peptide-mediated delivery of Cas9 protein and guide RNA. Genome Res. Jun. 2014;24(6):1020-7. doi: 10.1101/gr.171264.113. Epub Apr. 2, 2014.
Ramirez et al., Engineered zinc finger nickases induce homology-directed repair with reduced mutagenic effects. Nucleic Acids Res. Jul. 2012;40(12):5560-8. doi: 10.1093/nar/gks179. Epub Feb. 28, 2012.
Ramirez et al., Unexpected failure rates for modular assembly of engineered zinc fingers. Nat Methods. May 2008;5(5):374-5. Doi: 10.1038/nmeth0508-374.
Ran et al., Double nicking by RNA-guided CRISPR Cas9 for enhanced genome editing specificity. Cell. Sep. 12, 2013;154(6):1380-9. doi: 10.1016/j.cell.2013.08.021. Epub Aug. 29, 2013.
Reynaud et al., What role for AID: mutator, or assembler of the immunoglobulin mutasome? Nat Immunol. Jul. 2003;4(7):631-8.
Reyon et al., FLASH assembly of TALENs for high-throughput genome editing. Nat Biotechnol. May 2012;30(5):460-5. doi: 10.1038/nbt.2170.
Sage et al., Proliferation of functional hair cells in vivo in the absence of the retinoblastoma protein. Science. Feb. 18, 2005;307(5712):1114-8. Epub Jan. 13, 2005.
Samal et al., Cationic polymers and their therapeutic potential. Chem Soc Rev. Nov. 7, 2012;41(21):7147-94. doi: 10.1039/c2cs35094g. Epub Aug. 10, 2012.
Sander et al., CRISPR-Cas systems for editing, regulating and targeting genomes. Nat Biotechnol. Apr. 2014;32(4):347-55. doi: 10.1038/nbt.2842. Epub Mar. 2, 2014.
Sander et al., In silico abstraction of zinc finger nuclease cleavage profiles reveals an expanded landscape of off-target sites. Nucleic Acids Res. Oct. 2013;41(19):e181. doi: 10.1093/nar/gkt716. Epub Aug. 14, 2013.
Sander et al., Targeted gene disruption in somatic zebrafish cells using engineered TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):697-8. doi: 10.1038/nbt.1934.
Sang, Prospects for transgenesis in the chick. Mech Dev. Sep. 2004;121(9):1179-86.
Santiago et al., Targeted gene knockout in mammalian cells by using engineered zinc-finger nucleases. Proc Natl Acad Sci U S A. Apr. 15, 2008;105(15):5809-14. doi: 10.1073/pnas.0800940105. Epub Mar. 21, 2008.
Sapranauskas et al., The Streptococcus thermophilus CRISPR/Cas system provides immunity in Escherichia coli. Nucleic Acids Res. Nov. 2011;39(21):9275-82. doi: 10.1093/nar/gkr606. Epub Aug. 3, 2011.
Sashital et al., Mechanism of foreign DNA selection in a bacterial adaptive immune system. Mol Cell. Jun. 8, 2012;46(5):606-15. doi: 10.1016/j.molcel.2012.03.020. Epub Apr. 19, 2012.
Schriefer et al., Low pressure DNA shearing: a method for random DNA sequence analysis. Nucleic Acids Res. Dec. 25, 1990;18(24):7455-6.
Schwank et al., Functional repair of CFTR by CRISPR/Cas9 in intestinal stem cell organoids of cystic fibrosis patients. Cell Stem Cell. Dec. 5, 2013;13(6):653-8. doi:10.1016/j.stem.2013.11.002.
Schwarze et al., In vivo protein transduction: delivery of a biologically active protein into the mouse. Science. Sep. 3, 1999;285(5433):1569-72.
Segal et al., Toward controlling gene expression at will: selection and design of zinc finger domains recognizing each of the 5′-GNN-3′ DNA target sequences. Proc Natl Acad Sci U S A. Mar. 16, 1999;96(6):2758-63.
Sells et al., Delivery of protein into cells using polycationic liposomes. Biotechniques. Jul. 1995;19(1):72-6, 78.
Semenova et al., Interference by clustered regularly interspaced short palindromic repeat (CRISPR) RNA is governed by a seed sequence. Proc Natl Acad Sci U S A. Jun. 21, 2011;108(25):10098-103. doi: 10.1073/pnas.1104144108. Epub Jun. 6, 2011.
Shah et al., Kinetic control of one-pot trans-splicing reactions by using a wild-type and designed split intein. Angew Chem Int Ed Engl. Jul. 11, 2011;50(29):6511-5. doi: 10.1002/anie.201102909. Epub Jun. 8, 2011.
Shalem et al., Genome-scale CRISPR-Cas9 knockout screening in human cells. Science. Jan. 3, 2014;343(6166):84-7. doi: 10.1126/science.1247005. Epub Dec. 12, 2013.
Sheridan, First CRISPR-Cas patent opens race to stake out intellectual property. Nat Biotechnol. 2014;32(7):599-601.
Sheridan, Gene therapy finds its niche. Nat Biotechnol. Feb. 2011;29(2):121-8. doi: 10.1038/nbt.1769.
Siebert et al., An improved PCR method for walking in uncloned genomic DNA. Nucleic Acids Res. Mar. 25, 1995;23(6):1087-8.
Sternberg et al., DNA interrogation by the CRISPR RNA-guided endonuclease Cas9. Nature.Mar. 6, 2014;507(7490):62-7. doi: 10.1038/nature13011. Epub Jan. 29, 2014.
Szczepek et al., Structure-based redesign of the dimerization interface reduces the toxicity of zinc-finger nucleases. Nat Biotechnol. Jul. 2007;25(7):786-93. Epub Jul. 1, 2007.
Tebas et al., Gene editing of CCR5 in autologous CD4 T cells of persons infected with HIV. N Engl J Med. Mar. 6, 2014;370(10):901-10. doi: 10.1056/NEJMoa1300662.
Tessarollo et al., Targeted mutation in the neurotrophin-3 gene results in loss of muscle sensory neurons. Proc Natl Acad Sci U S A. Dec. 6, 1994;91(25):11844-8.
Tesson et al., Knockout rats generated by embryo microinjection of TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):695-6. doi: 10.1038/nbt.1940.
Thompson et al., Engineering and identifying supercharged proteins for macromolecule delivery into mammalian cells. Methods Enzymol. 2012;503:293-319. doi: 10.1016/B978-0-12-396962-0.00012-4.
Thorpe et al., Functional correction of episomal mutations with short DNA fragments and RNA-DNA oligonucleotides. J Gene Med. Mar.-Apr. 2002;4(2):195-204.
Tsai et al., Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editing. Nat Biotechnol. Jun. 2014;32(6):569-76. doi: 10.1038/nbt.2908. Epub Apr. 25, 2014.
Turan et al., Site-specific recombinases: from tag-and-target- to tag-and-exchange-based genomic modifications. FASEB J. Dec. 2011;25(12):4088-107. doi: 10.1096/fj.11-186940. Epub Sep. 2, 2011. Review.
Uniprot Submission; UniProt, Accession No. P01011. Last modified Jun. 11, 2014, version 2. 15 pages.
UniProt Submission; UniProt, Accession No. P01011. Last modified Sep. 18, 2013, version 2. 15 pages.
UniProt Submission; UniProt, Accession No. P04264. Last modified Jun. 11, 2014, version 6. 15 pages.
UniProt Submission; UniProt, Accession No. P04275. Last modified Jul. 9, 2014, version 107. 29 pages.
Urnov et al., Genome editing with engineered zinc finger nucleases. Nat Rev Genet. Sep. 2010;11(9):636-46. doi: 10.1038/nrg2842.
Urnov et al., Highly efficient endogenous human gene correction using designed zinc-finger nucleases. Nature. Jun. 2, 2005;435(7042):646-51. Epub Apr. 3, 2005.
Vanamee et al., FokI requires two specific DNA sites for cleavage. J Mol Biol. May 25, 2001;309(1):69-78.
Wacey et al., Disentangling the perturbational effects of amino acid substitutions in the DNA-binding domain of p53. Hum Genet. Jan. 1999;104(1):15-22.
Wadia et al., Modulation of cellular function by TAT mediated transduction of full length proteins. Curr Protein Pept Sci. Apr. 2003;4(2):97-104.
Wadia et al., Transducible TAT-HA fusogenic peptide enhances escape of TAT-fusion proteins after lipid raft macropinocytosis. Nat Med. Mar. 2004;10(3):310-5. Epub Feb. 8, 2004.
Wah et al., Structure of FokI has implications for DNA cleavage. Proc Natl Acad Sci U S A. Sep. 1, 1998 ;95(18):10564-9.
Wang et al., Genetic screens in human cells using the CRISPR-Cas9 system. Science. Jan. 3, 2014;343(6166):80-4. doi: 10.1126/science.1246981. Epub Dec. 12, 2013.
Wang et al., One-step generation of mice carrying mutations in multiple genes by CRISPR/Cas-mediated genome engineering. Cell. May 9, 2013;153(4):910-8. doi: 10.1016/j.ce11.2013.04.025. Epub May 2, 2013.
Wang et al., Riboswitches that sense S-adenosylhomocysteine and activate genes involved in coenzyme recycling. Mol Cell. Mar. 28, 2008;29(6):691-702. doi: 10.1016/j.molcel.2008.01.012.
Wang et al., Targeted gene addition to a predetermined site in the human genome using a ZFN-based nicking enzyme. Genome Res. Jul. 2012;22(7):1316-26. doi: 10.1101/gr.122879.111. Epub Mar. 20, 2012.
Wang et al., Efficient delivery of genome-editing proteins using bioreducible lipid nanoparticles. Proc Natl Acad Sci U S A. Feb. 29, 2016. pii: 201520244. [Epub ahead of print].
Weber et al., Assembly of designer TAL effectors by Golden Gate cloning. PLoS One. 2011;6(5):e19722. doi:10.1371/journal.pone.0019722. Epub May 19, 2011.
Weinberger et al., Disease-causing mutations C277R and C277Y modify gating of human ClC-1 chloride channels in myotonia congenita. J Physiol. Aug. 1, 2012;590(Pt 15):3449-64. doi: 0.1113/jphysiol.2012.232785. Epub May 28, 2012.
Wiedenheft et al., RNA-guided genetic silencing systems in bacteria and archaea. Nature. Feb. 15, 2012;482(7385):331-8. doi: 10.1038/nature10886. Review.
Wolfe et al., Analysis of zinc fingers optimized via phage display: evaluating the utility of a recognition code. J Mol Biol. Feb. 5, 1999;285(5):1917-34.
Wood et al., Targeted genome editing across species using ZFNs and TALENs. Science. Jul. 15, 2011;333(6040):307. doi: 10.1126/science.1207773. Epub Jun. 23, 2011.
Wu et al., Correction of a genetic disease in mouse via use of CRISPR-Cas9. Cell Stem Cell. Dec. 5, 2013;13(6):659-62. doi: 10.1016/j.stem.2013.10.016.
Yanover et al., Extensive protein and DNA backbone sampling improves structure-based specificity prediction for C2H2 zinc fingers. Nucleic Acids Res. Jun. 2011;39(11):4564-76. doi: 10.1093/nar/gkr048. Epub Feb. 22, 2011.
Yazaki et al., Hereditary systemic amyloidosis associated with a new apolipoprotein AII stop codon mutation Stop78Arg. Kidney Int. Jul. 2003;64(1):11-6.
Yin et al., Genome editing with Cas9 in adult mice corrects a disease mutation and phenotype. Nat Biotechnol. Jun. 2014;32(6):551-3. doi: 10.1038/nbt.2884. Epub Mar. 30, 2014.
Zhang et al., Conditional gene manipulation: Cre-ating a new biological era. J Zhejiang Univ Sci B. Jul. 2012;13(7):511-24. doi: 10.1631/jzus.B1200042. Review.
Zhang et al., CRISPR/Cas9 for genome editing: progress, implications and challenges. Hum Mol Genet. Sep. 15, 2014;23(R1):R40-6. doi: 10.1093/hmg/ddu125. Epub Mar. 20, 2014.
Zhang et al., Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription. Nat Biotechnol. Feb. 2011;29(2):149-53. doi: 10.1038/nbt.1775. Epub Jan. 19, 2011.
Zou et al., Gene targeting of a disease-related gene in human induced pluripotent stem and embryonic stem cells. Cell Stem Cell. Jul. 2, 2009;5(1):97-110. doi: 10.1016/j.stem.2009.05.023. Epub Jun. 18, 2009.
Abudayyeh et al., C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector. Science Aug. 2016;353(6299):aaf5573. DOI: 10.1126/science.aaf5573.
Addgene Plasmid # 44246. pdCas9-humanized, 2017, Stanley Qi.
Addgene Plasmid # 73021. PCMV-BE3, 2017, David Liu.
Addgene Plasmid # 79620. pcDNA3.1_pCMV-nCas-PmCDA1-ugi pH1-gRNA(HPRT), 2017, Akihiko Kondo.
Anders et al., Structural basis of PAM-dependent target DNA recognition by the Cas9 endonuclease. Nature. Sep. 25, 2014;513(7519):569-73. doi: 10.1038/nature13579. Epub Jul. 27, 2014.
Barnes et al., Repair and genetic consequences of endogenous DNA base damage in mammalian cells. Annu Rev Genet. 2004;38:445-76.
Beale et al., Comparison of the differential context-dependence of DNA deamination by APOBEC enzymes: correlation with mutation spectra in vivo. J Mol Biol. Mar. 26, 2004;337(3):585-96.
Begley, Scientists unveil the ‘most clever CRISPR gadget’ so far. STAT, Apr. 20, 2016. https://www.statnews.com/2016/04/20/clever-crispr-advance-unveiled/.
Billon et al., CRISPR-Mediated Base Editing Enables Efficient Disruption of Eukaryotic Genes through Induction of STOP Codons. Mol Cell. Sep. 21, 2017;67(6):1068-1079.e4. doi: 10.1016/j.molcel.2017.08.008. Epub Sep. 7, 2017.
Birling et al., Site-specific recombinases for manipulation of the mouse genome. Methods Mol Biol. 2009;561:245-63. doi: 10.1007/978-1-60327-019-9_16.
Bitinaite et al., FokI dimerization is required for DNA cleavage. Proc Natl Acad Sci U S A. Sep. 1, 1998;95(18):10570-5.
Bolotin et al., Clustered regularly interspaced short palindrome repeats (CRISPRs) have spacers of extrachromosomal origin. Microbiology. Aug. 2005;151(Pt 8):2551-61.
Borman, Improved route to single-base genome editing. Chemical & Engineering News, Apr. 25, 2016;94(17)p5. http://cen.acs.org/articles/94/i17/Improved-route-single-base-genome.html.
Briner et al., Guide RNA functional modules direct Cas9 activity and orthogonality. Mol Cell. Oct. 23, 2014;56(2):333-339. doi: 10.1016/j.molcel.2014.09.019 . . . .
Britt et al., Re-engineering plant gene targeting. Trends Plant Sci. Feb. 2003;8(2):90-5.
Brouns et al., Small CRISPR RNAs guide antiviral defense in prokaryotes. Science. Aug. 15, 2008;321(5891):960-4. doi: 10.1126/science.1159689.
Brusse et al., Spinocerebellar ataxia associated with a mutation in the fibroblast growth factor 14 gene (SCA27): A new phenotype. Mov Disord. Mar. 2006;21(3):396-401.
Buchholz et al., Alteration of Cre recombinase site specificity by substrate-linked protein evolution. Nat Biotechnol. Nov. 2001;19(11):1047-52.
Buchwald et al., Long-term, continuous intravenous heparin administration by an implantable infusion pump in ambulatory patients with recurrent venous thrombosis. Surgery. Oct. 1980;88(4):507-16.
Burstein et al., New CRISPR-Cas systems from uncultivated microbes. Nature Feb. 2017;542(7640):237-240.
Caldecott et al., Single-strand break repair and genetic disease. Nat Rev Genet. Aug. 2008;9(8):619-31. doi: 10.1038/nrg2380.
Chadwick et al., In Vivo Base Editing of PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) as a Therapeutic Alternative to Genome Editing. Arterioscler Thromb Vasc Biol. Sep. 2017;37(9):1741-1747. doi: 10.1161/ATVBAHA.117.309881. Epub Jul. 27, 2017.
Chaikind et al., A programmable Cas9-serine recombinase fusion protein that operates on DNA sequences in mammalian cells. Nucleic Acids Res. Nov. 16, 2016;44(20):9758-9770. Epub Aug. 11, 2016.
Chavez et al., Highly efficient Cas9-mediated transcriptional programming. Nat Methods. Apr. 2015;12(4):326-8. doi: 10.1038/nmeth.3312. Epub Mar. 2, 2015.
Chavez et al., Precise Cas9 targeting enables genomic mutation prevention. Jun. 14, 2016. doi:https://doi.org/10.1101/058974. [Preprint].
Chavez et al., Precise Cas9 targeting enables genomic mutation prevention. Proc Natl Acad Sci U S A. Apr. 3, 2018;115(14):3669-3673. doi: 10.1073/pnas.1718148115. Epub Mar. 19, 2018.
Chavez et al., Therapeutic applications of the PhiC31 integrase system. Curr Gene Ther. Oct. 2011;11(5):375-81. Review.
Chelico et al., Stochastic properties of processive cytidine DNA deaminases AID and APOBEC3G. Philos Trans R Soc Lond B Biol Sci. Mar. 12, 2009;364(1517):583-93. doi: 10.1098/rstb.2008.0195.
Chen et al., Structure of the DNA deaminase domain of the HIV-1 restriction factor APOBEC3G. Nature. Mar. 6, 2008;452(7183):116-9. doi: 10.1038/nature06638. Epub Feb. 20, 2008.
Chew et al., A multifunctional AAV-CRISPR-Cas9 and its host response. Nat Methods. Oct. 2016;13(10):868-74. doi: 10.1038/nmeth.3993. Epub Sep. 5, 2016.
Chu et al., Increasing the efficiency of homology-directed repair for CRISPR-Cas9-induced precise gene editing in mammalian cells. Nat Biotech. Feb. 13, 2015;33:543-8.
Covino et al., The CCL2/CCR2 Axis in the Pathogenesis of HIV-1 Infection: A New Cellular Target for Therapy? Current Drug Targets Dec. 2016;17(1):76-110. DOI : 10.2174/138945011701151217110917.
Cox et al., Conditional gene expression in the mouse inner ear using Cre-loxP. J Assoc Res Otolaryngol. Jun. 2012;13(3):295-322. doi: 10.1007/s10162-012-0324-5. Epub Apr. 24, 2012.
Cox et al., Therapeutic genome editing: prospects and challenges. Nat Med. Feb. 2015;21(2):121-31. doi: 10.1038/nm.3793.
Cunningham et al., Ensembl 2015. Nucleic Acids Res. Jan. 2015;43(Database issue):D662-9. doi: 10.1093/nar/gku1010. Epub Oct. 28, 2014.
Davis et al., DNA double strand break repair via non-homologous end-joining. Transl Cancer Res. Jun. 2013;2(3):130-143.
Davis et al., Small molecule-triggered Cas9 protein with improved genome-editing specificity. Nat Chem Biol. May 2015;11(5):316-8. doi: 10.1038/nchembio.1793. Epub Apr. 6, 2015.
Dicarlo et al., Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic Acids Research Apr. 2013;41(7):4336-43.
Ding et al., Permanent alteration of PCSK9 with in vivo CRISPR-Cas9 genome editing. Circ Res. Aug. 15, 2014;115(5):488-92. doi: 10.1161/CIRCRESAHA.115.304351. Epub Jun. 10, 2014.
Doench et al., Optimized sgRNA design to maximize activity and minimize off-target effects of CRISPR-Cas9. Nat Biotechnol. Feb. 2016;34(2):184-191. doi: 10.1038/nbt.3437.
Dormiani et al., Long-term and efficient expression of human β-globin gene in a hematopoietic cell line using a new site-specific integrating non-viral system. Gene Ther. Aug. 2015;22(8):663-74. doi: 10.1038/gt.2015.30. Epub Apr. 1, 2015.
Doudna et al., Genome editing. The new frontier of genome engineering with CRISPR-Cas9. Science. Nov. 28, 2014;346(6213):1258096. doi: 10.1126/science.1258096.
Dunaime, Breakthrough method means CRISPR just got a lot more relevant to human health. The Verge. Apr. 20, 2016. http://www.theverge.com/2016/4/20/11450262/crispr-base-editing-single-nucleotides-dna-gene-liu-harvard.
During et al., Controlled release of dopamine from a polymeric brain implant: in vivo characterization. Ann Neurol. Apr. 1989;25(4):351-6.
East-Seletsky et al., Two distinct RNase activities of CRISPR-C2c2 enable guide-RNA processing and RNA detection. Nature Oct. 2016;538(7624):270-3.
Endo et al., Toward establishing an efficient and versatile gene targeting system in higher plants. Biocatalysis and Agricultural Biotechnology 2014;3,(1):2-6.
Extended European Search Report for EP 15830407.1, dated Mar. 2, 2018.
Fang et al., Synthetic Studies Towards Halichondrins: Synthesis of the Left Halves of Norhalichondrins and Homohalichondrins. Tetrahedron Letters 1992;33(12):1557-1560.
Ferretti et al., Complete genome sequence of an M1 strain of Streptococcus pyogenes. Proc Natl Acad Sci U S A. Apr. 10, 2001;98(8):4658-63.
Ferry et al., Rational design of inducible CRISPR guide RNAs for de novo assembly of transcriptional programs. Nat Commun. Mar. 3, 2017;8:14633. doi: 10.1038/ncomms14633.
Fine et al., Trans-spliced Cas9 allows cleavage of HBB and CCR5 genes in human cells using compact expression cassettes. Scientific Reports 2015;5(1):Article No. 10777. doi:10.1038/srep10777. With Supplementary Information.
Fischer et al., Cryptic epitopes induce high-titer humoral immune response in patients with cancer. J Immunol. Sep. 1, 2010;185(5):3095-102. doi: 10.4049/jimmunol.0902166. Epub Jul. 26, 2010.
Freshney, Culture of Animal Cells. A Manual of Basic Technique. Alan R. Liss, Inc. New York. 1983;4.
Fukui et al., DNA Mismatch Repair in Eukaryotes and Bacteria. J Nucleic Acids. Jul. 27, 2010;2010. pii: 260512. doi: 10.4061/2010/260512.
Fung et al., Repair at single targeted DNA double-strand breaks in pluripotent and differentiated human cells. PLoS One. 2011;6(5):e20514. doi: 10.1371/journal.pone.0020514. Epub May 25, 2011.
Gaj et al., A comprehensive approach to zinc-finger recombinase customization enables genomic targeting in human cells. Nucleic Acids Res. Feb. 6, 2013;41(6):3937-46.
Gaj et al., Enhancing the specificity of recombinase-mediated genome engineering through dimer interface redesign. J Am Chem Soc. Apr. 2, 2014;136(13):5047-56. doi: 10.1021/ja4130059. Epub Mar. 20, 2014.
Gaj et al., Expanding the scope of site-specific recombinases for genetic and metabolic engineering. Biotechnol Bioeng. Jan. 2014;111(1):1-15. doi: 10.1002/bit.25096. Epub Sep. 13, 2013.
Gao et al., DNA-guided genome editing using the Natronobacterium gregoryi Argonaute. Nat Biotechnol. Jul. 2016;34(7):768-73. doi: 10.1038/nbt.3547. Epub May 2, 2016.
Gardlik et al., Vectors and delivery systems in gene therapy. Med Sci Monit. Apr. 2005;11(4):RA110-21. Epub Mar. 24, 2005.
Garneau et al., The CRISPR/Cas bacterial immune system cleaves bacteriophage and plasmid DNA. Nature. Nov. 4, 2010;468(7320):67-71. doi: 10.1038/nature09523.
Gersbach et al., Directed evolution of recombinase specificity by split gene reassembly. Nucleic Acids Res. Jul. 2010;38(12):4198-206. doi: 10.1093/nar/gkq125. Epub Mar. 1, 2010.
Gersbach et al., Targeted plasmid integration into the human genome by an engineered zinc-finger recombinase. Nucleic Acids Res. Sep. 1, 2011;39(17):7868-78. doi: 10.1093/nar/gkr421. Epub Jun. 7, 2011.
Gonzalez et al., An iCRISPR platform for rapid, multiplexable, and inducible genome editing in human pluripotent stem cells. Cell Stem Cell. Aug. 7, 2014;15(2):215-26. doi: 10.1016/j.stem.2014.05.018. Epub Jun. 12, 2014.
Haeussler et al., Evaluation of off-target and on-target scoring algorithms and integration into the guide RNA selection tool CRISPOR. Genome Biol. Jul. 5, 2016;17(1):148. doi: 10.1186/s13059-016-1012-2.
Han, New CRISPR/Cas9-based Tech Edits Single Nucleotides Without Breaking DNA. Genome Web, Apr. 20, 2016. https://www.genomeweb.com/gene-silencinggene-editing/new-crisprcas9-based-tech-edits-single-nucleotides-without-breaking-dna.
Harris et al., RNA editing enzyme APOBEC1 and some of its homologs can act as DNA mutators. Mol Cell. Nov. 2002;10(5):1247-53.
Heller et al., Replisome assembly and the direct restart of stalled replication forks. Nat Rev Mol Cell Biol. Dec. 2006;7(12):932-43. Epub Nov. 8, 2006.
Hess et al., Directed evolution using dCas9-targeted somatic hypermutation in mammalian cells. Nat Methods. Dec. 2016;13(12):1036-1042. doi: 10.1038/nmeth.4038. Epub Oct. 31, 2016.
Hickford et al., Antitumour polyether macrolides: four new halichondrins from the New Zealand deep-water marine sponge Lissodendoryx sp. Bioorg Med Chem. Mar. 15, 2009;17(6):2199-203. doi: 10.1016/j.bmc.2008.10.093. Epub Nov. 19, 2008.
Hilton et al., Enabling functional genomics with genome engineering. Genome Res. Oct. 2015;25(10):1442-55. doi: 10.1101/gr.190124.115.
Hondares et al., Peroxisome Proliferator-activated Receptor α (PPARα) Induces PPARγ Coactivator 1α (PGC-1α) Gene Expression and Contributes to Thermogenic Activation of Brown Fat. J Biol. Chem Oct. 2011; 286(50):43112-22. doi: 10.1074/jbc.M111.252775.
Hou et al., Efficient genome engineering in human pluripotent stem cells using Cas9 from Neisseria meningitidis. Proc Natl Acad Sci U S A. Sep. 24, 2013;110(39):15644-9. doi: 10.1073/pnas.1313587110. Epub Aug. 12, 2013.
Howard et al., Intracerebral drug delivery in rats with lesion-induced memory deficits. J Neurosurg. Jul. 1989;71(1):105-12.
Hower et al., Shape-based peak identification for ChIP-Seq. BMC Bioinformatics. Jan. 12, 2011;12:15. doi: 10.1186/1471-2105-12-15.
Hu et al., Chemical Biology Approaches to Genome Editing: Understanding, Controlling, and Delivering Programmable Nucleases. Cell Chem Biol. Jan. 21, 2016;23(1):57-73. doi: 10.1016/j.chembiol.2015.12.009.
Hwang et al., Efficient In Vivo Genome Editing Using RNA-Guided Nucleases. Nat Biotechnol. Mar. 2013; 31(3): 227-229. doi: 10.1038/nbt.2501. Epub Jan. 29, 2013.
International Preliminary Report on Patentability for PCT/US2016/058344, dated May 3, 2018.
International Preliminary Report on Patentability for PCT/US2015/042770, dated Dec. 19, 2016.
International Preliminary Report on Patentability for PCT/US2015/058479, dated May 11, 2017.
International Search Report and Written Opinion for PCT/US2016/044546, dated Dec. 28, 2016.
International Search Report and Written Opinion for PCT/US2016/058344, dated Apr. 20, 2017.
International Search Report and Written Opinion for PCT/US2017/045381, dated Oct. 26, 2017.
International Search Report and Written Opinion for PCT/US2017/046144, dated Oct. 10, 2017.
International Search Report and Written Opinion for PCT/US2017/056671, dated Feb. 20, 2018.
International Search Report and Written Opinion for PCT/US2017/068105, dated Apr. 4, 2018.
International Search Report and Written Opinion for PCT/US2017/068114, dated Mar. 20, 2018.
International Search Report and Written Opinion for PCT/US2017/48390, dated Jan. 9, 2018.
International Search Report for PCT/US2018/021664, dated Jun. 21, 2018.
International Search Report for PCT/US2018/021878, dated Aug. 20, 2018.
International Search Report for PCT/US2018/021880, dated Jun. 20, 2018.
International Search Report for PCT/US2018/024208, dated Aug. 23, 2018.
International Search Report for PCT/US2018/025887, dated Jun. 21, 2018.
International Search Report for PCT/US2018/032460, dated Jul. 11, 2018.
Invitation to Pay Additional Fees for PCT/US2016/058344, dated Mar. 1, 2017.
Invitation to Pay Additional Fees for PCT/US2017/056671, dated Dec. 21, 2017.
Invitation to Pay Additional Fees for PCT/US2017/48390, dated Nov. 7, 2017.
Invitation to Pay Additional Fees for PCT/US2018/021878, dated Jun. 8, 2018.
Ishino et al., Nucleotide sequence of the iap gene, responsible for alkaline phosphatase isozyme conversion in Escherichia coli, and identification of the gene product. J Bacteriol. Dec. 1987;169(12):5429-33.
Jansen et al., Identification of genes that are associated with DNA repeats in prokaryotes. Mol Microbiol. Mar. 2002;43(6):1565-75.
Jiang et al., Structures of a CRISPR-Cas9 R-loop complex primed for DNA cleavage. Science. Feb. 19, 2016;351(6275):867-71. doi: 10.1126/science.aad8282. Epub Jan. 14, 2016.
Karpinsky et al., Directed evolution of a recombinase that excises the provirus of most HIV-1 primary isolates with high specificity. Nat Biotechnol. Apr. 2016;34(4):401-9. doi: 10.1038/nbt.3467. Epub Feb. 22, 2016.
Kaya et al., A bacterial Argonaute with noncanonical guide RNA specificity. Proc. Natl. Acad. Sci. USA Apr. 2016;113(15):4057-62.
Kellendonk et al., Regulation of Cre recombinase activity by the synthetic steroid RU 486. Nucleic Acids Res. Apr. 15, 1996;24(8):1404-11.
Kim et al., Genome-wide target specificities of CRISPR RNA-guided programmable deaminases. Nat Biotechnol. May 2017;35(5):475-480. doi: 10.1038/nbt.3852. Epub Apr. 10, 2017.
Kim et al., Highly efficient RNA-guided base editing in mouse embryos. Nat Biotechnol. May 2017;35(5):435-437. doi: 10.1038/nbt.3816. Epub Feb. 27, 2017.
Kim et al., Increasing the genome-targeting scope and precision of base editing with engineered Cas9-cytidine deaminase fusions. Nat Biotechnol. Apr. 2017;35(4):371-376. doi: 10.1038/nbt.3803. Epub Feb. 13, 2017.
Kim et al., The role of apolipoprotein E in Alzheimer's disease. Neuron. Aug. 13, 2009;63(3):287-303. doi: 10.1016/j.neuron.2009.06.026.
Kim et al., Transcriptional repression by zinc finger peptides. Exploring the potential for applications in gene therapy. J Biol Chem. Nov. 21, 1997;272(47):29795-800.
Kitamura et al., Uracil DNA glycosylase counteracts APOBEC3G-induced hypermutation of hepatitis B viral genomes: excision repair of covalently closed circular DNA. PLoS Pathog. 2013;9(5):e1003361. doi: 10.1371/journal.ppat.1003361. Epub May 16, 2013.
Kleinstiver et al., Broadening the targeting range of Staphylococcus aureus CRISPR-Cas9 by modifying PAM recognition. Nat Biotechnol. Dec. 2015;33(12):1293-1298. doi: 10.1038/nbt.3404. Epub Nov. 2, 2015.
Kleinstiver et al., Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature. Jul. 23, 2015;523(7561):481-5. doi: 10.1038/nature14592. Epub Jun. 22, 2015.
Kleinstiver et al., High-fidelity CRISPR-Cas9 nucleases with no detectable genome-wide off-target effects. Nature. Jan. 28, 2016;529(7587):490-5. doi: 10.1038/nature16526. Epub Jan. 6, 2016.
Kleinstiver et al., Monomeric site-specific nucleases for genome editing. Proc Natl Acad Sci U S A. May 22, 2012;109(21):8061-6. doi: 10.1073/pnas.1117984109. Epub May 7, 2012.
Klippel et al., Isolation and characterization of unusual gin mutants. EMBO J. Dec. 1, 1988;7(12):3983-9.
Klippel et al., The DNA invertase Gin of phage Mu: formation of a covalent complex with DNA via a phosphoserine at amino acid position 9. EMBO J. Apr. 1988;7(4):1229-37.
Kohli et al., Local sequence targeting in the AID/APOBEC family differentially impacts retroviral restriction and antibody diversification. J Biol Chem. Dec. 24, 2010;285(52):40956-64. doi: 10.1074/jbc.M110.177402. Epub Oct. 6, 2010.
Komor et al., CRISPR-Based Technologies for the Manipulation of Eukaryotic Genomes. Cell. Jan. 12, 2017;168(1-2):20-36. doi: 10.1016/j.cell.2016.10.044.
Komor et al., Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity. Sci Adv. Aug. 30, 2017;3(8):eaao4774. doi: 10.1126/sciadv.aao4774. eCollection Aug. 2017.
Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature. Apr. 20, 2016;533(7603):420-4. doi: 10.1038/nature17946.
Kouzminova et al., Patterns of chromosomal fragmentation due to uracil-DNA incorporation reveal a novel mechanism of replication-dependent double-stranded breaks. Mol Microbiol. Apr. 2008;68(1):202-15. doi: 10.1111/j.1365-2958.2008.06149.x.
Kunz et al., DNA Repair in mammalian cells: Mismatched repair: variations on a theme. Cell Mol Life Sci. Mar. 2009;66(6):1021-38. doi: 10.1007/s00018-009-8739-9.
Kury et al., De Novo Disruption of the Proteasome Regulatory Subunit PSMD12 Causes a Syndromic Neurodevelopmental Disorder. Am J Hum Genet. Feb. 2, 2017;100(2):352-363. doi: 10.1016/j.ajhg.2017.01.003. Epub Jan. 26, 2017.
Kuscu et al., CRISPR-STOP: gene silencing through base-editing-induced nonsense mutations. Nat Methods. Jul. 2017;14(7):710-712. doi: 10.1038/nmeth.4327. Epub Jun. 5, 2017.
Kuscu et al., Genome-wide analysis reveals characteristics of off-target sites bound by the Cas9 endonuclease. Nat Biotechnol. Jul. 2014;32(7):677-83. doi: 10.1038/nbt.2916. Epub May 18, 2014.
Landrum et al., ClinVar: public archive of interpretations of clinically relevant variants. Nucleic Acids Res. Jan. 4, 2016;44(D1):D862-8. doi: 10.1093/nar/gkv1222. Epub Nov. 17, 2015.
Langer et al., Chemical and Physical Structure of Polymers as Carriers for Controlled Release of Bioactive Agents: A Review. Journal of Macromolecular Science, 2006;23(1):61-126. DOI: 10.1080/07366578308079439.
Langer et al., New methods of drug delivery. Science. Sep. 28, 1990;249(4976):1527-33.
Lau et al., Molecular basis for discriminating between normal and damaged bases by the human alkyladenine glycosylase, AAG. Proc Natl Acad Sci U S A. Dec. 5, 2000;97(25):13573-8.
Ledford, Gene-editing hack yields pinpoint precision. Nature, Apr. 20, 2016. http://www.nature.com/news/gene-editing-hack-yields-pinpoint-precision-1.19773.
Lee et al., A chimeric thyroid hormone receptor constitutively bound to DNA requires retinoid X receptor for hormone-dependent transcriptional activation in yeast. Mol Endocrinol. Sep. 1994;8(9):1245-52.
Lee et al., Failure to detect DNA-guided genome editing using Natronobacterium gregoryi Argonaute. Nat Biotechnol. Nov. 28, 2016;35(1):17-18. doi: 10.1038/nbt.3753.
Lee et al., Recognition of liposomes by cells: in vitro binding and endocytosis mediated by specific lipid headgroups and surface charge density. Biochim Biophys Acta. Jan. 31, 1992;1103(2):185-97.
Lee et al., Ribozyme Mediated gRNA Generation for In Vitro and In Vivo CRISPR/Cas9 Mutagenesis. PLoS One. Nov. 10, 2016;11(11):e0166020. doi: 10.1371/journal.pone.0166020. eCollection 2016.
Levy et al., Inhibition of calcification of bioprosthetic heart valves by local controlled-release diphosphonate. Science. Apr. 12, 1985;228(4696):190-2.
Lewis et al., Building the Class 2 CRISPR-Cas Arsenal. Mol Cell 2017;65(3);377-379.
Li et al., Base editing with a Cpf1-cytidine deaminase fusion. Nat Biotechnol. Apr. 2018;36(4):324-327. doi: 10.1038/nbt.4102. Epub Mar. 19, 2018.
Li et al., Generation of Targeted Point Mutations in Rice by a Modified CRISPR/Cas9 System. Mol Plant. Mar. 6, 2017;10(3):526-529. doi: 10.1016/j.molp.2016.12.001. Epub Dec. 8, 2016.
Li et al., Highly efficient and precise base editing in discarded human tripronuclear embryos. Protein Cell. Aug. 19, 2017. doi: 10.1007/s13238-017-0458-7. [Epub ahead of print].
Li et al., Multiplex and homologous recombination-mediated genome editing in Arabidopsis and Nicotiana benthamiana using guide RNA and Cas9. Nat Biotechnol. Aug. 2013;31(8):688-91. doi: 10.1038/nbt.2654.
Liang et al., Rapid and highly efficient mammalian cell engineering via Cas9 protein transfection. Send to; J Biotechnol. Aug. 20, 2015;208:44-53. doi: 10.1016/j.jbiotec.2015.04.024.
Lieber et al., Mechanism and regulation of human non-homologous DNA end-joining. Nat Rev Mol Cell Biol. Sep. 2003;4(9):712-20.
Lin et al., Enhanced homology-directed human genome engineering by controlled timing of CRISPR/Cas9 delivery. Elife. Dec. 15, 2014;3:e04766. doi: 10.7554/eLife.04766.
Liu et al., C2c1-sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism. Molecular Cell Jan. 2017;65(2):310-22.
Liu et al., Apolipoprotein E and Alzheimer disease: risk, mechanisms and therapy. Nat Rev Neurol. Feb. 2013;9(2):106-18. doi: 10.1038/nrneurol.2012.263. Epub Jan. 8, 2013.
Liu et al., Balancing AID and DNA repair during somatic hypermutation. Trends Immunol. Apr. 2009;30(4):173-81. doi: 10.1016/j.it.2009.01.007.
Liu et al., Distance determination by GIY-YIG intron endonucleases: discrimination between repression and cleavage functions. Nucleic Acids Res. Mar. 31, 2006;34(6):1755-64. Print 2006.
Losey et al., Crystal structure of Staphylococcus sureus tRNA adenosine deaminase tadA in complex with RNA. Nature Struct. Mol. Biol. Feb. 2006;13(2):153-9.
Lu et al., Precise Editing of a Target Base in the Rice Genome Using a Modified CRISPR/Cas9 System. Mol Plant. Mar. 6, 2017;10(3):523-525. doi: 10.1016/j.molp.2016.11.013. Epub Dec. 6, 2016.
Lundquist et al., Site-directed mutagenesis and characterization of uracil-DNA glycosylase inhibitor protein. Role of specific carboxylic amino acids in complex formation with Escherichia coli uracil-DNA glycosylase. J Biol Chem. Aug. 22, 1997;272(34):21408-19.
Lyons et al., Efficient Recognition of an Unpaired Lesion by a DNA Repair Glycosylase. J. Am. Chem. Soc., 2009;131(49):17742-3. DOI: 10.1021/ja908378y.
Ma et al., Targeted AID-mediated mutagenesis (TAM) enables efficient genomic diversification in mammalian cells. Nature Methods. Oct. 2016;13:1029-35. doi:10.1038/nmeth.4027.
Makarova et al., Prokaryotic homologs of Argonaute proteins are predicted to function as key components of a novel system of defense against mobile genetic elements. Biology Direct 2009;4:29.
Makarova et al., An updated evolutionary classification of CRISPR-Cas systems. Nat Rev Microbiol. Nov. 2015;13(11):722-36. doi: 10.1038/nrmicro3569. Epub Sep. 28, 2015.
Makarova et al., Evolution and classification of the CRISPR-Cas systems. Nat Rev Microbiol. Jun. 2011;9(6):467-77. doi: 10.1038/nrmicro2577. Epub May 9, 2011.
Marioni et al., DNA methylation age of blood predicts all-cause mortality in later life. Genome Biol. Jan. 30, 2015;16:25. doi: 10.1186/s13059-015-0584-6.
Marraffini et al., CRISPR interference limits horizontal gene transfer in Staphylococci by targeting DNA. Science. Dec. 19, 2008;322(5909):1843-5. doi: 10.1126/science.1165771.
Maruyama et al., Increasing the efficiency of precise genome editing with CRISPR-Cas9 by inhibition of nonhomologous end joining. Nat Biotechnol. May 2015;33(5):538-42. doi: 10.1038/nbt.3190. Epub Mar. 23, 2015.
Mei et al., Recent Progress in CRISPR/Cas9 Technology. J Genet Genomics. Feb. 20, 2016;43(2):63-75. doi: 10.1016/j.jgg.2016.01.001. Epub Jan. 18, 2016.
Mercer et al., Chimeric TALE recombinases with programmable DNA sequence specificity. Nucleic Acids Res. Nov. 2012;40(21):11163-72. doi: 10.1093/nar/gks875. Epub Sep. 26, 2012.
Minoche et al., Evaluation of genomic high-throughput sequencing data generated on Illumina HiSeq and genome analyzer systems. Genome Biol. Nov. 8, 2011;12(11):R112. doi: 10.1186/gb-2011-12-11-r112.
Mojica et al., Intervening sequences of regularly spaced prokaryotic repeats derive from foreign genetic elements. J Mol Evol. Feb. 2005;60(2):174-82.
Mol et al., Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA. Cell. Sep. 8, 1995;82(5):701-8.
Nishida et al., Targeted nucleotide editing using hybrid prokaryotic and vertebrate adaptive immune systems. Science. Sep. 16, 2016;353(6305):1248. pii: aaf8729. doi: 10.1126/science.aaf8729. Epub Aug. 4, 2016.
Offord, Advances in Genome Editing. The Scientist, Apr. 20, 2016. http://www.the-scientist.com/?articles.view/articleNo/45903/title/Advances-in-Genome-Editing/.
Parker et al., Admixture mapping identifies a quantitative trait locus associated with FEV1/FVC in the COPDGene Study. Genet Epidemiol. Nov. 2014;38(7):652-9. doi: 10.1002/gepi.21847. Epub Aug. 11, 2014.
Pearl, Structure and function in the uracil-DNA glycosylase superfamily. Mutat Res. Aug. 30, 2000;460(3-4):165-81.
Petolino et al., Editing Plant Genomes: a new era of crop improvement. Plant Biotechnol J. Feb. 2016;14(2):435-6. doi: 10.1111/pbi.12542.
Plasterk et al., DNA inversions in the chromosome of Escherichia coli and in bacteriophage Mu: relationship to other site-specific recombination systems. Proc Natl Acad Sci U S A. Sep. 1983;80(17):5355-8.
Plosky et al., CRISPR-Mediated Base Editing without DNA Double-Strand Breaks. Mol Cell. May 19, 2016;62(4):477-8. doi: 10.1016/j.molcel.2016.05.006.
Pluciennik et al., PCNA function in the activation and strand direction of MutLα endonuclease in mismatch repair. Proc Natl Acad Sci U S A. Sep. 14, 2010;107(37):16066-71. doi: 10.1073/pnas.1010662107. Epub Aug. 16, 2010.
Pourcel et al., CRISPR elements in Yersinia pestis acquire new repeats by preferential uptake of bacteriophage DNA, and provide additional tools for evolutionary studies. Microbiology. Mar. 2005;151(Pt 3):653-63.
Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology 2013;31(9):833-8.
Prorocic et al., Zinc-finger recombinase activities in vitro. Nucleic Acids Res. Nov. 2011;39(21):9316-28. doi: 10.1093/nar/gkr652. Epub Aug. 17, 2011.
Prykhozhij et al., CRISPR multitargeter: a web tool to find common and unique CRISPR single guide RNA targets in a set of similar sequences. PLoS One. Mar. 5, 2015;10(3):e0119372. doi: 10.1371/journal.pone.0119372. eCollection 2015.
Putnam et al., Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase. J Mol Biol. Mar. 26, 1999;287(2):331-46.
Ran et al., Genome engineering using the CRISPR-Cas9 system. Nat Protoc. Nov. 2013;8(11):2281-308. doi: 10.1038/nprot.2013.143. Epub Oct. 24, 2013.
Ran et al., In vivo genome editing using Staphylococcus aureus Cas9. Nature. Apr. 9, 2015;520(7546):186-91. doi: 10.1038/nature14299. Epub Apr. 1, 2015.
Rath et al., Fidelity of end joining in mammalian episomes and the impact of Metnase on joint processing. BMC Mol Biol. Mar. 22, 2014;15:6. doi: 10.1186/1471-2199-15-6.
Ravishankar et al., X-ray analysis of a complex of Escherichia coli uracil DNA glycosylase (EcUDG) with a proteinaceous inhibitor. The structure elucidation of a prokaryotic UDG. Nuclei Acids Res. 26 (21): 4880-4887 (1998).
Ray et al., Homologous recombination: ends as the means. Trends Plant Sci. Oct. 2002;7(10):435-40.
Rebuzzini et al., New mammalian cellular systems to study mutations introduced at the break site by non-homologous end-joining. DNA Repair (Amst). May 2, 2005;4(5):546-55.
Rees et al., Improving the DNA specificity and applicability of base editing through protein engineering and protein delivery. Nat Commun. Jun. 6, 2017;8:15790. doi: 10.1038/ncomms15790.
Richardson et al., Enhancing homology-directed genome editing by catalytically active and inactive CRISPR-Cas9 using asymmetric donor DNA. Nat Biotechnol. Mar. 2016;34(3):339-44. doi: 10.1038/nbt.3481. Epub Jan. 20, 2016.
Richter et al., Function and regulation of clustered regularly interspaced short palindromic repeats (CRISPR) / CRISPR associated (Cas) systems. Viruses. Oct. 19, 2012;4(10):2291-311. doi: 10.3390/v4102291.
Rong et al., Homologous recombination in human embryonic stem cells using CRISPR/Cas9 nickase and a long DNA donor template. Protein Cell. Apr. 2014;5(4):258-60. doi: 10.1007/s13238-014-0032-5.
Rowland et al., Regulatory mutations in Sin recombinase support a structure-based model of the synaptosome. Mol Microbiol. Oct. 2009;74(2):282-98. doi: 10.1111/j.1365-2958.2009.06756.x. Epub Jun. 8, 2009.
Sadelain et al., Safe harbours for the integration of new DNA in the human genome. Nat Rev Cancer. Dec. 1, 2011;12(1):51-8. doi: 10.1038/nrc3179.
Sanjana et al., A transcription activator-like effector toolbox for genome engineering. Nat Protoc. Jan. 5, 2012;7(1):171-92. doi: 10.1038/nprot.2011.431.
Saraconi et al., The RNA editing enzyme APOBEC1 induces somatic mutations and a compatible mutational signature is present in esophageal adenocarcinomas. Genome Biol. Jul. 31, 2014;15(7):417. doi: 10.1186/s13059-014-0417-z.
Saudek et al., A preliminary trial of the programmable implantable medication system for insulin delivery. N Engl J Med. Aug. 31, 1989;321(9):574-9.
Sclimenti et al., Directed evolution of a recombinase for improved genomic integration at a native human sequence. Nucleic Acids Res. Dec. 15, 2001;29(24):5044-51.
Sefton et al., Implantable pumps. Crit Rev Biomed Eng. 1987;14(3):201-40.
Seripa et al., The missing ApoE allele. Ann Hum Genet. Jul. 2007;71(Pt 4):496-500. Epub Jan. 22, 2007.
Shah et al., Inteins: nature's gift to protein chemists. Chem Sci. 2014;5(1):446-461.
Shah et al., Target-specific variants of Flp recombinase mediate genome engineering reactions in mammalian cells. FEBS J. Sep. 2015;282(17):3323-33. doi: 10.1111/febs.13345. Epub Jul. 1, 2015.
Sharbeen et al., Ectopic restriction of DNA repair reveals that UNG2 excises AID-induced uracils predominantly or exclusively during G1 phase. J Exp Med. May 7, 2012;209(5):965-74. doi: 10.1084/jem.20112379. Epub Apr. 23, 2012.
Shcherbakova et al., Near-infrared fluorescent proteins for multicolor in vivo imaging. Nat Methods. Aug. 2013;10(8):751-4. doi: 10.1038/nmeth.2521. Epub Jun. 16, 2013.
Shee et al., Engineered proteins detect spontaneous DNA breakage in human and bacterial cells. Elife. Oct. 29, 2013;2:e01222. doi: 10.7554/eLife.01222.
Shimantani et al., Targeted base editing in rice and tomato using a CRISPR-Cas9 cytidine deaminase fusion. Nat Biotechnol. May 2017;35(5):441-443. doi: 10.1038/nbt.3833. Epub Mar. 27, 2017.
Shimojima et al., Spinocerebellar ataxias type 27 derived from a disruption of the fibroblast growth factor 14 gene with mimicking phenotype of paroxysmal non-kinesigenic dyskinesia. Brain Dev. Mar. 2012;34(3):230-3. doi: 10.1016/j.braindev.2011.04.014. Epub May 19, 2011.
Shmakov et al., Discovery and Functional Characterization of Diverse Class 2 CRISPR Cas Systems. Molecular Cell Nov. 2015;60(3):385-97.
Simonelli et al., Base excision repair intermediates are mutagenic in mammalian cells. Nucleic Acids Res. Aug. 2, 2005;33(14):4404-11. Print 2005.
Sirk et al., Expanding the zinc-finger recombinase repertoire: directed evolution and mutational analysis of serine recombinase specificity determinants. Nucleic Acids Res. Apr. 2014;42(7):4755-66. doi: 10.1093/nar/gkt1389. Epub Jan. 21, 2014.
Sjoblom et al., The consensus coding sequences of human breast and colorectal cancers. Science. Oct. 13, 2006;314(5797):268-74. Epub Sep. 7, 2006.
Slaymaker et al., Rationally engineered Cas9 nucleases with improved specificity. Science. Jan. 1, 2016;351(6268):84-8. doi: 10.1126/science.aad5227. Epub Dec. 1, 2015.
Smith et al., Expression of a dominant negative retinoic acid receptor γ in Xenopus embryos leads to partial resistance to retinoic acid. Roux Arch Dev Biol. Mar. 1994;203(5):254-265. doi: 10.1007/BF00360521.
Stenglein et al., APOBEC3 proteins mediate the clearance of foreign DNA from human cells. Nat Struct Mol Biol. Feb. 2010;17(2):222-9. doi: 10.1038/nsmb.1744. Epub Jan. 10, 2010.
Stephens et al., The landscape of cancer genes and mutational processes in breast cancer. Nature Jun. 2012;486:400-404. doi:10.1038/nature11017.
Stevens et al., Design of a Split Intein with Exceptional Protein-Splicing Activity. J Am Chem Soc. Feb. 24, 2016;138(7):2162-5. doi: 10.1021/jacs.5b13528. Epub Feb. 8, 2016.
Swarts et al., Argonaute of the archaeon Pyrococcus furiosus is a DNA-guided nuclease that targets cognate DNA. Nucleic Acids Res. May 26, 2015;43(10):5120-9. doi: 10.1093/nar/gkv415. Epub Apr. 29, 2015.
Swarts et al., DNA-guided DNA interference by a prokaryotic Argonaute. Nature. Mar. 13, 2014;507(7491):258-61. doi: 10.1038/nature12971. Epub Feb. 16, 2014.
Swarts et al., The evolutionary journey of Argonaute proteins. Nat Struct Mol Biol. Sep. 2014;21(9):743-53. doi: 10.1038/nsmb.2879.
Tagalakis et al., Lack of RNA-DNA oligonucleotide (chimeraplast) mutagenic activity in mouse embryos. Mol Reprod Dev. Jun. 2005;71(2):140-4.
Tang et al., Aptazyme-embedded guide RNAs enable ligand-responsive genome editing and transcriptional activation. Nat Commun. Jun. 28, 2017;8:15939. doi: 10.1038/ncomms15939.
Thyagarajan et al., Mammalian genomes contain active recombinase recognition sites. Gene. Feb. 22, 2000;244(1-2):47-54.
Thyagarajan et al., Site-specific genomic integration in mammalian cells mediated by phage phiC31 integrase. Mol Cell Biol. Jun. 2001;21(12):3926-34.
Tirumalai et al., Recognition of core-type DNA sites by lambda integrase. J Mol Biol. Jun. 12, 1998;279(3):513-27.
Tourdot et al., A general strategy to enhance immunogenicity of low-affinity HLA-A2. 1-associated peptides: implication in the identification of cryptic tumor epitopes. Eur J Immunol. Dec. 2000;30(12):3411-21.
Tsai et al., GUIDE-seq enables genome-wide profiling of off-target cleavage by CRISPR-Cas nucleases. Nat Biotechnol. Feb. 2015;33(2):187-97. doi: 10.1038/nbt.3117. Epub Dec. 16, 2014.
Turan et al., Recombinase-mediated cassette exchange (RMCE)—a rapidly-expanding toolbox for targeted genomic modifications. Gene. Feb. 15, 2013;515(1):1-27. doi: 10.1016/j.gene.2012.11.016. Epub Nov. 29, 2012.
Turan et al., Recombinase-mediated cassette exchange (RMCE): traditional concepts and current challenges. J Mol Biol. Mar. 25, 2011;407(2):193-221. doi: 10.1016/j.jmb.2011.01.004. Epub Jan. 15, 2011.
Vagner et al., Efficiency of homologous DNA recombination varies along the Bacillus subtilis chromosome. J Bacteriol. Sep. 1988;170(9):3978-82.
Van Swieten et al., A mutation in the fibroblast growth factor 14 gene is associated with autosomal dominant cerebellar ataxia [corrected]. Am J Hum Genet. Jan. 2003;72(1):191-9. Epub Dec. 13, 2002.
Wang et al., CRISPR-Cas9 Targeting of PCSK9 in Human Hepatocytes In Vivo—Brief Report. Arterioscler Thromb Vasc Biol. May 2016;36(5):783-6. doi: 10.1161/ATVBAHA.116.307227. Epub Mar. 3, 2016.
Wang et al., Nucleation, propagation and cleavage of target RNAs in Ago silencing complexes. Nature. Oct. 8, 2009;461(7265):754-61. doi: 10.1038/nature08434.
Wang et al., Recombinase technology: applications and possibilities. Plant Cell Rep. Mar. 2011;30(3):267-85. doi: 10.1007/s00299-010-0938-1. Epub Oct. 24, 2010.
Wang et al., Uracil-DNA glycosylase inhibitor gene of bacteriophage PBS2 encodes a binding protein specific for uracil-DNA glycosylase. J Biol Chem. Jan. 15, 1989;264(2):1163-71.
Warren et al., A chimeric Cre recombinase with regulated directionality. Proc Natl Acad Sci U S A. Nov. 25, 2008;105(47):18278-83. doi: 10.1073/pnas.0809949105. Epub Nov. 14, 2008.
Warren et al., Mutations in the amino-terminal domain of lambda-integrase have differential effects on integrative and excisive recombination. Mol Microbiol. Feb. 2005;55(4):1104-12.
Wijnker et al., Managing meiotic recombination in plant breeding. Trends Plant Sci. Dec. 2008;13(12):640-6. doi: 10.1016/j.tplants.2008.09.004. Epub Oct. 22, 2008.
Wolf et al., tadA, an essential tRNA-specific adenosine deaminase from Escherichia coli. EMBO J. Jul. 15, 2002;21(14):3841-51.
Wu et al., Genome-wide binding of the CRISPR endonuclease Cas9 in mammalian cells. Nat Biotechnol. Jul. 2014;32(7):670-6. doi: 10.1038/nbt.2889. Epub Apr. 20, 2014.
Xu et al., Sequence determinants of improved CRISPR sgRNA design. Genome Res. Aug. 2015;25(8):1147-57. doi: 10.1101/gr.191452.115. Epub Jun. 10, 2015.
Yahata et al., Unified, Efficient, and Scalable Synthesis of Halichondrins: Zirconium/Nickel-Mediated One-Pot Ketone Synthesis as the Final Coupling Reaction. Angew Chem Int Ed Engl. Aug. 28, 2017;56(36):10796-10800. doi: 10.1002/anie.201705523. Epub Jul. 28, 2017.
Yamamoto et al., Virological and immunological bases for HIV-1 vaccine design. Uirusu 2007;57(2):133-139. https://doi.org/10.2222/jsv.57.133.
Yamano et al., Crystal Structure of Cpf1 in Complex with Guide RNA and Target DNA. Cell May 2016;165(4)949-62.
Yang et al., Engineering and optimising deaminase fusions for genome editing. Nat Commun. Nov. 2, 2016;7:13330. doi: 10.1038/ncomms13330.
Yang et al., Genome editing with targeted deaminases. BioRxiv. Preprint. First posted online Jul. 28, 2016.
Yang et al., New CRISPR-Cas systems discovered. Cell Res. Mar. 2017;27(3):313-314. doi: 10.1038/cr.2017.21. Epub Feb. 21, 2017.
Yang et al., PAM-dependent Target DNA Recognition and Cleavage by C2C1 CRISPR-Cas endonuclease. Cell Dec. 2016;167(7):1814-28.
Yuan et al., Tetrameric structure of a serine integrase catalytic domain. Structure. Aug. 6, 2008;16(8):1275-86. doi: 10.1016/j.str.2008.04.018.
Yuen et al., Control of transcription factor activity and osteoblast differentiation in mammalian cells using an evolved small-molecule-dependent intein. J Am Chem Soc. Jul. 12, 2006;128(27):8939-46.
Zetsche et al., A split-Cas9 architecture for inducible genome editing and transcription modulation. Nat Biotechnol. Feb. 2015;33(2):139-42. doi: 10.1038/nbt.3149.
Zetsche et al., Cpf1 is a single RNA-guided endonuclease of a class 2 CRISPR-Cas system. Cell. Oct. 22, 2015;163(3):759-71. doi: 10.1016/j.cell.2015.09.038. Epub Sep. 25, 2015.
Zhang et al., Comparison of non-canonical PAMs for CRISPR/Cas9-mediated DNA cleavage in human cells. Sci Rep. Jun. 2014;4:5405.
Zhang et al., Programmable base editing of zebrafish genome using a modified CRISPR-Cas9 system. Nat Commun. Jul. 25, 2017;8(1):118. doi: 10.1038/s41467-017-00175-6.
Zhang et al., Stabilized plasmid-lipid particles for regional gene therapy: formulation and transfection properties. Gene Ther. Aug. 1999;6(8):1438-47.
Zheng et al., DNA editing in DNA/RNA hybrids by adenosine deaminases that act on RNA. Nucleic Acids Res. Apr. 7, 2017;45(6):3369-3377. doi: 10.1093/nar/gkx050.
Zong et al., Precise base editing in rice, wheat and maize with a Cas9-cytidine deaminase fusion. Nat Biotechnol. May 2017;35(5):438-440. doi: 10.1038/nbt.3811. Epub Feb. 27, 2017.
Zuris et al., Cationic lipid-mediated delivery of proteins enables efficient protein-based genome editing in vitro and in vivo. Nat Biotechnol. 2015;33:73-80.
Chavez et al., Precise Cas9 targeting enables genomic mutation prevention. Jun. 14, 2016. [Preprint].
Nishida et al., Targeted nucleotide editing using hybrid prokaryotic and vertebrate adaptive immune systems. Science. Sep. 16, 2016;353(6305). pii: aaf8729. doi: 10.1126/science.aaf8729. Epub Aug. 4, 2016.
Qi et al., Engineering naturally occuring trans-acting non-coding RNAs to sense molecular signals. Nucleic Acids Res. Jul. 2012;40(12):5775-86. doi: 10.1093/nar/gks168. Epub Mar. 1, 2012.
Truong et al., Development of an intein-mediated split-Cas9 system for gene therapy. Nucleic Acids Res. Jul. 27, 2015;43(13):6450-8. doi: 10.1093/nar/gkv601. Epub Jun. 16, 2015.
Aihara et al., A conformational switch controls the DNA cleavage activity of lambda integrase. Mol Cell. 2003 Ju1;12(1):187-98.
Ames et al., A eubacterial riboswich class that senses the coenzyme tetrahydrofolate. Chem Bio Jul. 30, 2010; 17(7);681-5. doi: 10.1016/j.chembio.2010.05.020.
Batey et al., Structure of a natural guanine-responsive riboswitch complexed with the metabolite hypoxanthine. Nature. Nov. 18, 2004;432(7015):411-5.
Bershtein et al., Advances in laboratory evolution of enzymes. Curr Opin Chem Biol. Apr. 2008;12(2):151-8. doi: 10.1016/j.cbpa.2008.01.027. Epub Mar. 7, 2008. Review.
Bogdanove et al., TAL effectors: customizable proteins for DNA targeting. Science. Sep. 30, 2011 ;333(6051):1843-6. doi: 10.1126/science.1204094.
Burstein et al.: New CRISPR-Cas systems from uncultivated microbes. Nature. vol. 542. no. 7640. Dec. 22, 2016 (Dec. 22, 2016). Pages 237-241. XP055480893.GB ISSN: 00280836. DOI: 10.1038jnature21059.
Buskirk et al., Directed evolution of ligand dependence: small-molecule-activated protein splicing. Proc Natl Acad Sci U.S.A. Jul. 20, 2004;101(29):10505-10. Epub Jul. 9, 2004 .
Chen et al., Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. Oct. 2013;65(10):1357-69. doi:10.1016/j.addr.2012.09.039. Epub Sep. 29, 2012.
Cobb et al., Directed evolution an enabling synthetic biology tool. Curr Opin chem Biol. Aug. 2012;16(3-4):285-91. doi:10.1016/j.cbpa.2012.05.186.Epub Jun. 4, 2012. Review.
Cobb et al., Directed evolution as a powerful synthetic biology tool. Methods. Mar. 15, 2013;60(1):81-90. doi: 10.1016/j.ymeth.2012.03.009. Epub Mar. 23, 2012.
Dixon et al., Reengineering orthogonally selective riboswitches. Proc Natl Acad Sci U.S.A. Feb. 16, 2010;107(7):2830-5. doi: 10.1073/pnas.0911209107. Epub Jan. 26, 2010.
Edwards et al., Crystal structures of the thi-box riboswitch bound to thiamine pyrophosphate analogs reveal adaptive RNA-small molecule recognition. Structure. Sep. 2006;14(9):1459-68.
Esvelt et al., A system for the continuous directed evolution of biomolecules. Nature. Apr. 28, 2011 ;472(7344):499-503. doi: 10.1038/nature09929. Epub Apr. 10, 2011.
Fischer et al., Cryptic epitopes induce high-titer humoral immune response in patients with cancer. J Immunol. Sep. 1, 2010 ;185(5):3095-102. doi: 10.4049/jimmuno1.0902166. Epub 2010.
Hida et al., Directed evolution for drug and nucleic acid delivery. Adv Drug Deliv Rev. Dec. 22, 2007;59(15):1562-78. Epub Aug. 28, 2007. Review.
Husimi, Selection and evolution of bacteriophages in cellstat. Adv Biophys. 1989;25:1-43. Review.
Kakiyama et al., A peptide release system using a photo-cleavable linker in a cell array format for cell-toxicity analysis. Polymer J. Feb. 27, 2013;45:535-9.
Kang et al., Structural Insights into riboswitch control of the biosynthesis of queuosine, a modified nucleotide found in the anticodon of tRNA. Mol Cell. Mar. 27, 2009;33(6):784-90. doi: 10.1016/j.molcel.2009.02.019. Epub Mar. 12, 2009.
Klein et al., Cocrystal structure of a class I preQi riboswitch reveals a pseudoknot recognizing an essential hypermodified nucleobase. Nat Struct Mol Biol. Mar. 2009;16(3):343-4. doi: 10.1038/nsmb.1563.Epub Feb. 22, 2009.
Kwon et al., Chemical basis of glycine riobswitch cooperativitiy. RNA. Jan. 2008; 14(1):25-34.Epub Nov. 27, 2007.
Lee et al., An allosteric self-splicing ribozyme triggered by a bacterial second messenger. Science. Aug. 13, 2010;329(5993):845-8. doi: 10.1126/science.1190713.
Liu et al., Fast Colorimetric Sensing of Adenosine and Cocaine Based on a General Sensor Design Involving Aptamers and Nanoparticles. Angew Chem. Dec. 16, 2006;45(1):90-4. DOI: 10.1002/anie.200502589.
Meyer et al., Confirmation of a second natuarl preQ1 aptamer class in Streptococcacae bacterial. RNA. 2008 Apri; 14(4):685-95. doi: 10.1261/rna.937308. Epub Feb. 27, 2008.
Montage et al., Structure of the S-adenosylemethionine riboswitch regulatory mRNA element. Nature. Jun. 29, 2006;441(7079):1172-5.
Mootz et al. Conditional proten splicing; a new tool to control protein structure and fuction in vitro and invivo. J. Am Chem Soc. Sep. 3, 2003:125(35):10560-9.
Mootz et al., Protein splicing triggered by a small molecule. J Am Chem Soc. Aug. 7, 2002;124(31):9044-5.
Nahvi et al., Coenzyme B12 riboswitchen are widespread genetic control elements in proaryotes. Nucleic Acids Res. Jan. 2, 2004;32(1):143-50.
Neel et al., Riboswitches: Classification, function and in silico approach, International Journal of Pharma Sciences and Research. 2010;1(9):409-420.
Nelson et al., Filamentous phage DNA cloning vectors: a noninfective mutant with a nonpolar deletion in gene III. Virology. 1981; 108(2): 338-50.
Ni et al., Nucleic acid aptamers: clinical applications and promising new horizons. Curr Med Chem. 2011;18(27):4206-14. Review.
Peck et al., Directed evolution of a small-molecule-triggered intein with improved splicing properties in mammalian cells. Chem Biol. May 27, 2011;18(5):619-30. doi: 10.1016/j.chembiol.2011.02.014.
Rakonjac et al., Roles of PIII in filamentous phage assembly. J Mol Biol. 1998; 282(1)25-41.
Riechmann et al.,. The C-terminal domain of TolA is the coreceptor for filamentous phage infection of E. coli. Cell. 1997; 90(2):351-60. PMID:9244308.
Saleh-Gohari et al., Conservative homologous recombination preferentially repairs DNA double-strand breaks in the S phase of the cell cycle in human cells. Nucleic Acids Res. Jul. 13, 2004;32(12):3683-8. Print 2004.
Serganov et al., Structural basis for discriminative regulation of gene expression by adenine and guanine-sensing mRNAs. Chem biol. Dec. 2004;11(12):1729-41.
Serganov et al., Coenzyme recognition and gene regulation by a flavin mononucleotide riboswitch. Nature. 2009 Mar. 12;458(7235):233-7. doi: 10.1038/nature07642. Epub Jan. 25, 2009.
Serganov et al., Structural basis for gene regulation by a thiamine pyrophosphate-sensing riboswitch. Nature. Jun. 29, 2006;441(7097):1167-71. Epub May 21, 2006.
Skretas et al., Regulation of protein activity with small-molecule-controlled inteins. Protein Sci. Feb. 2005;14(2):523-32. Epub Jan. 4, 2005.
Smith, Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface. Science. Jun. 14, 1985;228(4705):1315-7.
Sudarsan et al., An mRNA structure in bacteria that controls gene expression by binding lysine. Genes Dev. Nov. 1, 2003;17(21):2688-97.
Sudarsan et al., Riboswitches in eubacteria sense the second messenger cyclic di-GMP. Science. Jul. 18, 2008 18;321(5887):411-3. doi: 10.1126/science.1159519.
Suess et al., A theophylline responsive riboswitch based on helix slipping controls gene expression in vivo. Nucleic Acids Res. Mar. 5, 2004;32(4):1610-4.
Trausch et al., the structure of a tetrahydrofolate-sensing riboswitch reveals two ligand binding sites in a single aptamer. Structure. Oct. 12, 2011;19(10):1413-23. doi: 10.1016/j.str.2011.06.019. Epub Sep. 8, 2011.
Weinberg et al., The aptamer core of SAM-IV riboswitchees mimics the ligand-binding site of SAM-I riboswitches. RNA. May 2008: 14(5):822-8. doi: 10.1261/rna.988608. Epub Mar. 27, 2008.
Winkler et al., an mRNA structure that controls gene expression by binding FMN. Proc Natl Acad Sci U.S.A. Dec. 10, 2002;99(25):15908-13. Epub Nov. 27, 2002.
Winkler et al., Control of gene expression by a natural metabolite-responsive ribozyme. Nature. Mar. 18, 2004;428(6980):281-6.
Winkler et al., Thiamine derivatives bind messenger RNAs directly to regulate bacterial gene expression. Nature. Oct. 31, 2002;419(6910):952-6. Epub Oct. 16, 2002.
Yuan et al., Laboratory-directed protein evolution. Microbiol Mol Biol Rev. 2005; 69(3):373-92. PMID: 16148303.
Zimmermann et al., Molecular interactions and metal binding in the theophylline-binding core of an RNA aptamer. RNA. May 2000;6(5):659-67.
Extended European Search Report for EP18199195.1, dated Feb. 12, 2019.
International Preliminary Report on Patentability for PCT/US2014/048390, dated Mar. 7, 2019.
International Preliminary Report on Patentability for PCT/US2017/046144, dated Feb. 21, 2019.
International Preliminary Report on Patentability for PCT/US2017/045381, dated Feb. 14, 2019.
International Preliminary Report on Patentability for PCT/US2017/056671, dated Apr. 25, 2019.
Requirement for Restriction/Election, dated Nov. 24, 2014, in connection with U.S. Appl. No. 14/325,815.
Office Action, dated Feb. 11, 2015, in connection with U.S. Appl. No. 14/325,815.
Office Action, dated Jun. 4, 2015, in connection with U.S. Appl. No. 14/325,815.
Advisory Action dated Sep. 16, 2015 in connection with U.S. Appl. No. 14/325,815.
Office Action, dated Jan. 5, 2016, in connection with U.S. Appl. No. 14/325,815.
Office Action, dated Jun. 7, 2016, in connection with U.S. Appl. No. 14/325,815.
Advisory Action dated Nov. 28, 2016 in connection with U.S. Appl. No. 14/325,815.
Office Action, dated Jan. 12, 2017, in connection with U.S. Appl. No. 14/325,815.
Applicant Initiated Interview Summary, dated May 2, 2017, in connection with U.S. Appl. No. 14/325,815.
Office Action, dated Sep. 27, 2017, in connection with U.S. Appl. No. 14/325,815.
Office Action, dated Jan. 17, 2018, in connection with U.S. Appl. No. 14/325,815.
Office Action, dated Sep. 6, 2018, in connection with U.S. Appl. No. 14/325,815.
Office Action and Applicant Initiated Interview Summary, dated May 6, 2019, in connection with U.S. Appl. No. 14/325,815.
Requirement for Restriction/Election, dated Nov. 13, 2014, in connection with U.S. Appl. No. 14/326,109.
Office Action, dated Apr. 24, 2015, in connection with U.S. Appl. No. 14/326,109.
Office Action, dated Nov. 13, 2015, in connection with U.S. Appl. No. 14/326,109.
Office Action, dated Jul. 11, 2016, in connection with U.S. Appl. No. 14/326,109.
Advisory Action, dated Nov. 26, 2016, in connection with U.S. Appl. No. 14/326,109.
Office Action, dated Feb. 16, 2017, in connection with U.S. Appl. No. 14/326,109.
Applicant Initiated Interview Summary, dated May 22, 2017, in connection with U.S. Appl. No. 14/326,109.
Examiner Initiated Interview Summary, dated Aug. 17, 2017 in connection with U.S. Appl. No. 14/326,109.
Notice of Allowance, dated Aug. 17, 2017 in connection with U.S. Appl. No. 14/326,109.
Requirement for Restriction/Election, dated Nov. 25, 2014, in connection with U.S. Appl. No. 14/326,140.
Office Action, dated Feb. 10, 2015, in connection with U.S. Appl. No. 14/326,140.
Office Action, dated Jun. 1, 2015, in connection with U.S. Appl. No. 14/326,140.
Advisory Action, dated Sep. 15, 2015, in connection with U.S. Appl. No. 14/326,140.
Requirement for Restriction/Election, dated Jan. 20, 2016, in connection with U.S. Appl. No. 14/326,140.
Office Action, dated May 5, 2016, in connection with U.S. Appl. No. 14/326,140.
Office Action, dated Sep. 7, 2016, in connection with U.S. Appl. No. 14/326,140.
Applicant Initiated Interview Summary, dated Dec. 5, 2016, in connection with U.S. Appl. No. 14/326,140.
Office Action, dated Nov. 21, 2014, in connection with U.S. Appl. No. 14/326,269.
Notice of Allowance, dated Apr. 3, 2015, in connection with U.S. Appl. No. 14/326,269
Requirement for Restriction/Election, dated Nov. 26, 2014, in connection with U.S. Appl. No. 14/326,290.
Office Action, dated May 1, 2015, in connection with U.S. Appl. No. 14/326,290.
Office Action, dated Oct. 16, 2015, in connection with U.S. Appl. No. 14/326,290.
Advisory Action, dated Feb. 5, 2016, in connection with U.S. Appl. No. 14/326,290.
Office Action, dated Mar. 10, 2016, in connection with U.S. Appl. No. 14/326,290.
Office Action, dated Sep. 22, 2016, in connection with U.S. Appl. No. 14/326,290.
Applicant Initiated Interview Summary, dated Dec. 6, 2016, in connection with U.S. Appl. No. 14/326,290.
Office Action, dated Jun. 1, 2017, in connection with U.S. Appl. No. 14/326,290.
Office Action, dated Jan. 16, 2018, in connection with U.S. Appl. No. 14/326,290.
Advisory Action, dated Jul. 6, 2018, in connection with U.S. Appl. No. 14/326,290.
Requirement for Restriction/Election, dated Nov. 24, 2014, in connection with U.S. Appl. No. 14/326,318.
Office Action, dated Feb. 26, 2015, in connection with U.S. Appl. No. 14/326,318.
Office Action, dated Jun. 15, 2015, in connection with U.S. Appl. No. 14/326,318.
Advisory Action, dated Sep. 23, 2015, in connection with U.S. Appl. No. 14/326,318.
Requirement for Restriction/Election, dated Jan. 22, 2016, in connection with U.S. Appl. No. 14/326,318.
Office Action, dated Feb. 7, 2017, in connection with U.S. Appl. No. 14/326,318.
Advisory Action, dated Jun. 16, 2017, in connection with U.S. Appl. No. 14/326,318.
Office Action, dated Jun. 27, 2016, in connection with U.S. Appl. No. 14/326,318.
Office Action, dated Oct. 11, 2017, in connection with U.S. Appl. No. 14/326,318.
Office Action, dated Oct. 26, 2018, in connection with U.S. Appl. No. 14/326,318.
Requirement for Restriction/Election, dated Nov. 25, 2014, in connection with U.S. Appl. No. 14/326,303.
Office Action, dated Apr. 9, 2015, in connection with U.S. Appl. No. 14/326,303.
Office Action, dated Sep. 11, 2015, in connection with U.S. Appl. No. 14/326,303.
Advisory Action, dated Dec. 21, 2015, in connection with U.S. Appl. No. 14/326,303.
Office Action, dated Mar. 18, 2016, in connection with U.S. Appl. No. 14/326,303.
Office Action, dated Oct. 5, 2016, in connection with U.S. Appl. No. 14/326,303.
Interview Summary, dated Jan. 27, 2017, in connection with U.S. Appl. No. 14/326,303.
Related Publications (1)
Number Date Country
20160304846 A1 Oct 2016 US
Provisional Applications (2)
Number Date Country
61980333 Apr 2014 US
61915386 Dec 2013 US
Continuations (7)
Number Date Country
Parent 14325815 Jul 2014 US
Child 15103608 US
Parent 14326109 Jul 2014 US
Child 14325815 US
Parent 14326140 Jul 2014 US
Child 14326109 US
Parent 14326269 Jul 2014 US
Child 14326140 US
Parent 14326290 Jul 2014 US
Child 14326269 US
Parent 14326318 Jul 2014 US
Child 14326290 US
Parent 14326303 Jul 2014 US
Child 14326318 US