Patent Grant
10465176
Targeted editing of nucleic acid sequences, for example, the introduction of a specific modification into genomic DNA, is a highly promising approach for the study of gene function and also has the potential to provide new therapies for human genetic diseases.1 An ideal nucleic acid editing technology possesses three characteristics: (1) high efficiency of installing the desired modification; (2) minimal off-target activity; and (3) the ability to be programmed to edit precisely any site in a given nucleic acid, e.g., any site within the human genome.2 Current genome engineering tools, including engineered zinc finger nucleases (ZFNs),3 transcription activator like effector nucleases (TALENs),4 and most recently, the RNA-guided DNA endonuclease Cas9,5 effect sequence-specific DNA cleavage in a genome. This programmable cleavage can result in mutation of the DNA at the cleavage site via non-homologous end joining (NHEJ) or replacement of the DNA surrounding the cleavage site via homology-directed repair (HDR).6,7
One drawback to the current technologies is that both NHEJ and HDR are stochastic processes that typically result in modest gene editing efficiencies as well as unwanted gene alterations that can compete with the desired alteration.8 Since many genetic diseases in principle can be treated by effecting a specific nucleotide change at a specific location in the genome (for example, a C to T change in a specific codon of a gene associated with a disease),9 the development of a programmable way to achieve such precision gene editing would represent both a powerful new research tool, as well as a potential new approach to gene editing-based human therapeutics.
The clustered regularly interspaced short palindromic repeat (CRISPR) system is a recently discovered prokaryotic adaptive immune system10 that has been modified to enable robust and general genome engineering in a variety of organisms and cell lines.11 CRISPR-Cas (CRISPR associated) systems are protein-RNA complexes that use an RNA molecule (sgRNA) as a guide to localize the complex to a target DNA sequence via base-pairing.12 In the natural systems, a Cas protein then acts as an endonuclease to cleave the targeted DNA sequence.13 The target DNA sequence must be both complementary to the sgRNA, and also contain a “protospacer-adjacent motif” (PAM) dinucleotide at the 3′-end of the complementary region in order for the system to function (
The potential of the dCas9 complex for genome engineering purposes is immense. Its unique ability to bring proteins to specific sites in a genome programmed by the sgRNA in theory can be developed into a variety of site-specific genome engineering tools beyond nucleases, including transcriptional activators, transcriptional repressors, histone-modifying proteins, integrases, and recombinases.11 Some of these potential applications have recently been implemented through dCas9 fusions with transcriptional activators to afford RNA-guided transcriptional activators,17,18 transcriptional repressors,16,19,20 and chromatin modification enzymes.21 Simple co-expression of these fusions with a variety of sgRNAs results in specific expression of the target genes. These seminal studies have paved the way for the design and construction of readily programmable sequence-specific effectors for the precise manipulation of genomes.
Significantly, 80-90% of protein mutations responsible for human disease arise from the substitution, deletion, or insertion of only a single nucleotide.6 No genome engineering tools, however, have yet been developed that enable the manipulation of a single nucleotide in a general and direct manner. Current strategies for single-base gene correction include engineered nucleases (which rely on the creation of double-strand breaks, DSBs, followed by stochastic, inefficient homology-directed repair, HDR), and DNA-RNA chimeric oligonucleotides.22 The latter strategy involves the design of a RNA/DNA sequence to base pair with a specific sequence in genomic DNA except at the nucleotide to be edited. The resulting mismatch is recognized by the cell's endogenous repair system and fixed, leading to a change in the sequence of either the chimera or the genome. Both of these strategies suffer from low gene editing efficiencies and unwanted gene alterations, as they are subject to both the stochasticity of HDR and the competition between HDR and non-homologous end-joining, NHEJ.23-25 HDR efficiencies vary according to the location of the target gene within the genome,26 the state of the cell cycle,27 and the type of cell/tissue.28 The development of a direct, programmable way to install a specific type of base modification at a precise location in genomic DNA with enzyme-like efficiency and no stochasticity would therefore represent a powerful new approach to gene editing-based research tools and human therapeutics.
Some aspects of this disclosure provide strategies, systems, reagents, methods, and kits that are useful for the targeted editing of nucleic acids, including editing a single site within a subject's genome, e.g., the human genome. In some embodiments, fusion proteins of Cas9 and nucleic acid editing enzymes or enzyme domains, e.g., deaminase domains, are provided. In some embodiments, methods for targeted nucleic acid editing are provided. In some embodiments, reagents and kits for the generation of targeted nucleic acid editing proteins, e.g., fusion proteins of Cas9 and nucleic acid editing enzymes or domains, are provided.
Some aspects of this disclosure provide fusion proteins comprising (i) a nuclease-inactive CAS9 domain; and (ii) a nucleic acid-editing domain. In some embodiments, the nucleic acid-editing domain is a DNA-editing domain. In some embodiments, the nucleic-acid-editing domain is a deaminase domain. In some embodiments, the deaminase is a cytidine deaminase. In some embodiments, the deaminase is an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase. In some embodiments, the deaminase is an APOBEC1 family deaminase. In some embodiments, the deaminase is an activation-induced cytidine deaminase (AID). In some embodiments, the deaminase is an ACF1/ASE deaminase. In some embodiments, the deaminase is an adenosine deaminase. In some embodiments, the deaminase is an ADAT family deaminase. In some embodiments, the nucleic-acid-editing domain is fused to the N-terminus of the CAS9 domain. In some embodiments, the nucleic-acid-editing domain is fused to the C-terminus of the CAS9 domain. In some embodiments, the CAS9 domain and the nucleic-acid-editing domain are fused via a linker. In some embodiments, the linker comprises a (GGGGS)n (SEQ ID NO: 91), a (G)n, an (EAAAK)n (SEQ ID NO: 5), a (GGS)n, an SGSETPGTSESATPES (SEQ ID NO: 93) motif (see, e.g., Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82; the entire contents are incorporated herein by reference), or an (XP)n motif, or a combination of any of these, wherein n is independently an integer between 1 and 30.
Some aspects of this disclosure provide methods for DNA editing. In some embodiments, the methods comprise contacting a DNA molecule with (a) a fusion protein comprising a nuclease-inactive Cas9 domain and a deaminase domain; and (b) an sgRNA targeting the fusion protein of (a) to a target nucleotide sequence of the DNA strand; wherein the DNA molecule is contacted with the fusion protein and the sgRNA in an amount effective and under conditions suitable for the deamination of a nucleotide base. In some embodiments, the target DNA sequence comprises a sequence associated with a disease or disorder, and wherein the deamination of the nucleotide base results in a sequence that is not associated with a disease or disorder. In some embodiments, the DNA sequence comprises a T>C or A>G point mutation associated with a disease or disorder, and wherein the deamination of the mutant C or G base results in a sequence that is not associated with a disease or disorder. In some embodiments, the deamination corrects a point mutation in the sequence associated with the disease or disorder. In some embodiments, the sequence associated with the disease or disorder encodes a protein, and wherein the deamination introduces a stop codon into the sequence associated with the disease or disorder, resulting in a truncation of the encoded protein. In some embodiments, the deamination corrects a point mutation in the PI3KCA gene, thus correcting an H1047R and/or a A3140G mutation. In some embodiments, the contacting is performed in vivo in a subject susceptible to having, having, or diagnosed with the disease or disorder. In some embodiments, the disease or disorder is a disease associated with a point mutation, or a single-base mutation, in the genome. In some embodiments, the disease is a genetic disease, a cancer, a metabolic disease, or a lysosomal storage disease.
Some aspects of this disclosure provide a reporter construct for detecting nucleic-acid-editing activity of a Cas9:DNA-editing domain fusion protein. In some embodiments, the construct comprises (a) a reporter gene comprising a target site for the Cas9 DNA-editing protein, wherein targeted DNA editing results in an increase in expression of the reporter gene; and (b) a promoter sequence that controls expression of the reporter gene. In some embodiments, the construct further comprises (c) a sequence encoding an sgRNA targeting the Cas9 DNA-editing protein to the target site of the reporter gene, wherein expression of the sgRNA is independent of the expression of the reporter gene. In some embodiments, the target site of the reporter gene comprises a premature stop codon, and wherein targeted DNA editing of the template strand by the Cas9 DNA-editing protein results in a conversion of the premature stop codon to a codon encoding an amino acid residue. In some embodiments, the reporter gene encodes a luciferase, a fluorescent protein, or an antibiotic resistance marker.
Some aspects of this disclosure provide kits comprising a nucleic acid construct that comprises a sequence encoding a nuclease-inactive Cas9 sequence, a sequence comprising a cloning site positioned to allow cloning of a sequence encoding a nucleic acid-editing enzyme or enzyme domain in-frame with the Cas9-encoding sequence, and, optionally, a sequence encoding a linker positioned between the Cas9 encoding sequence and the cloning site. In addition, in some embodiments, the kit comprises suitable reagents, buffers, and/or instructions for in-frame cloning of a sequence encoding a nucleic acid-editing enzyme or enzyme domain into the nucleic acid construct to generate a Cas9 nucleic acid editing fusion protein. In some embodiments, the sequence comprising the cloning site is N-terminal of the Cas9 sequence. In some embodiments, the sequence comprising the cloning site is C-terminal of the Cas9 sequence. In some embodiments, the encoded linker comprises a (GGGGS)n (SEQ ID NO: 91), a (G)n, an (EAAAK)n(SEQ ID NO: 5), a (GGS)n, an SGSETPGTSESATPES (SEQ ID NO: 93) motif (see, e.g., Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82; the entire contents are incorporated herein by reference), or an (XP)n motif, or a combination of any of these, wherein n is independently an integer between 1 and 30.
Some aspects of this disclosure provide kits comprising a fusion protein comprising a nuclease-inactive Cas9 domain and a nucleic acid-editing enzyme or enzyme domain, and, optionally, a linker positioned between the Cas9 domain and the nucleic acid-editing enzyme or enzyme domain. In addition, in some embodiments, the kit comprises suitable reagents, buffers, and/or instructions for using the fusion protein, e.g., for in vitro or in vivo DNA or RNA editing. In some embodiments, the kit comprises instructions regarding the design and use of suitable sgRNAs for targeted editing of a nucleic acid sequence.
The summary above is meant to illustrate, in a non-limiting manner, some of the embodiments, advantages, features, and uses of the technology disclosed herein. Other embodiments, advantages, features, and uses of the technology disclosed herein will be apparent from the Detailed Description, the Drawings, the Examples, and the Claims.
As used herein and in the claims, the singular forms “a,” “an,” and “the” include the singular and the plural reference unless the context clearly indicates otherwise. Thus, for example, a reference to “an agent” includes a single agent and a plurality of such agents.
The term “Cas9” or “Cas9 nuclease” refers to an RNA-guided nuclease comprising a Cas9 protein, or a fragment thereof (e.g., a protein comprising an active or inactive DNA cleavage domain of Cas9, and/or the gRNA binding domain of Cas9). A Cas9 nuclease is also referred to sometimes as a casn1 nuclease or a CRISPR (clustered regularly interspaced short palindromic repeat)-associated nuclease. CRISPR is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). In type II CRISPR systems correct processing of pre-crRNA requires a trans-encoded small RNA (tracrRNA), endogenous ribonuclease 3 (rnc) and a Cas9 protein. The tracrRNA serves as a guide for ribonuclease 3-aided processing of pre-crRNA. Subsequently, Cas9/crRNA/tracrRNA endonucleolytically cleaves linear or circular dsDNA target complementary to the spacer. The target strand not complementary to crRNA is first cut endonucleolytically, then trimmed 3′-5′ exonucleolytically. In nature, DNA-binding and cleavage typically requires protein and both RNAs. However, single guide RNAs (“sgRNA”, or simply “gNRA”) can be engineered so as to incorporate aspects of both the crRNA and tracrRNA into a single RNA species. See, e.g., Jinek M., Chylinski K., Fonfara I., Hauer M., Doudna J. A., Charpentier E. Science 337:816-821(2012), the entire contents of which is hereby incorporated by reference. Cas9 recognizes a short motif in the CRISPR repeat sequences (the PAM or protospacer adjacent motif) to help distinguish self versus non-self. Cas9 nuclease sequences and structures are well known to those of skill in the art (see, e.g., “Complete genome sequence of an M1 strain of Streptococcus pyogenes.” Ferretti et al., J. J., McShan W. M., Ajdic D. J., Savic D. J., Savic G., Lyon K., Primeaux C., Sezate S., Suvorov A. N., Kenton S., Lai H. S., Lin S. P., Qian Y., Jia H. G., Najar F. Z., Ren Q., Zhu H., Song L., White J., Yuan X., Clifton S. W., Roe B. A., McLaughlin R. E., Proc. Natl. Acad. Sci. U.S.A. 98:4658-4663(2001); “CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III.” Deltcheva E., Chylinski K., Sharma C. M., Gonzales K., Chao Y., Pirzada Z. A., Eckert M. R., Vogel J., Charpentier E., Nature 471:602-607(2011); and “A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity.” Jinek M., Chylinski K., Fonfara I., Hauer M., Doudna J. A., Charpentier E. Science 337:816-821(2012), the entire contents of each of which are incorporated herein by reference). Cas9 orthologs have been described in various species, including, but not limited to, S. pyogenes and S. thermophilus. Additional suitable Cas9 nucleases and sequences will be apparent to those of skill in the art based on this disclosure, and such Cas9 nucleases and sequences include Cas9 sequences from the organisms and loci disclosed in Chylinski, Rhun, and Charpentier, “The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems” (2013) RNA Biology 10:5, 726-737; the entire contents of which are incorporated herein by reference. In some embodiments, a Cas9 nuclease has an inactive (e.g., an inactivated) DNA cleavage domain.
A nuclease-inactivated Cas9 protein may interchangeably be referred to as a “dCas9” protein (for nuclease-“dead” Cas9). Methods for generating a Cas9 protein (or a fragment thereof) having an inactive DNA cleavage domain are known (See, e.g., Jinek et al., Science. 337:816-821(2012); Qi et al., “Repurposing CRISPR as an RNA-Guided Platform for Sequence-Specific Control of Gene Expression” (2013) Cell. 28; 152(5):1173-83, the entire contents of each of which are incorporated herein by reference). For example, the DNA cleavage domain of Cas9 is known to include two subdomains, the HNH nuclease subdomain and the RuvC1 subdomain. The HNH subdomain cleaves the strand complementary to the gRNA, whereas the RuvC1 subdomain cleaves the non-complementary strand. Mutations within these subdomains can silence the nuclease activity of Cas9. For example, the mutations D10A and H841A completely inactivate the nuclease activity of S. pyogenes Cas9 (Jinek et al., Science. 337:816-821(2012); Qi et al., Cell. 28; 152(5):1173-83 (2013). In some embodiments, proteins comprising fragments of Cas9 are provided. For example, in some embodiments, a protein comprises one of two Cas9 domains: (1) the gRNA binding domain of Cas9; or (2) the DNA cleavage domain of Cas9. In some embodiments, proteins comprising Cas9 or fragments thereof are referred to as “Cas9 variants.” A Cas9 variant shares homology to Cas9, or a fragment thereof. For example a Cas9 variant is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to wild type Cas9. In some embodiments, the Cas9 variant comprises a fragment of Cas9 (e.g., a gRNA binding domain or a DNA-cleavage domain), such that the fragment is at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 96% identical, at least about 97% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to the corresponding fragment of wild type Cas9. In some embodiments, wild type Cas9 corresponds to Cas9 from Streptococcus pyogenes (NCBI Reference Sequence: NC_017053.1, SEQ ID NO:1 (nucleotide); SEQ ID NO:2 (amino acid)).
LLFGSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR
MGHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPV
ENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFIKDDS
IDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLT
KAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIR
EVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKY
PKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEIT
LANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQ
TGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEK
In some embodiments, wild type Cas9 corresponds to, or comprises SEQ ID NO:3 (nucleotide) and/or SEQ ID NO: 4 (amino acid):
LLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR
MGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHP
VENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDD
SIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNL
TKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLI
REVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKK
YPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEI
TLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEV
QTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVE
In some embodiments, dCas9 corresponds to, or comprises in part or in whole, a Cas9 amino acid sequence having one or more mutations that inactivate the Cas9 nuclease activity. For example, in some embodiments, a dCas9 domain comprises D10A and/or H820A mutation.
LLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR
MGRHKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHP
VENTQLQNEKLYLYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDD
SIDNKVLTRSDKNRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNL
TKAERGGLSELDKAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLI
REVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKK
YPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEI
TLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEV
QTGGFSKESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVE
In other embodiments, dCas9 variants having mutations other than D10A and H820A are provided, which e.g., result in nuclease inactivated Cas9 (dCas9). Such mutations, by way of example, include other amino acid substitutions at D10 and H820, or other substitutions within the nuclease domains of Cas9 (e.g., substitutions in the HNH nuclease subdomain and/or the RuvC1 subdomain). In some embodiments, variants or homologues of dCas9 (e.g., variants of SEQ ID NO: 34) are provided which are at least about 70% identical, at least about 80% identical, at least about 90% identical, at least about 95% identical, at least about 98% identical, at least about 99% identical, at least about 99.5% identical, or at least about 99.9% to SEQ ID NO: 34. In some embodiments, variants of dCas9 (e.g., variants of SEQ ID NO: 34) are provided having amino acid sequences which are shorter, or longer than SEQ ID NO: 34, by about 5 amino acids, by about 10 amino acids, by about 15 amino acids, by about 20 amino acids, by about 25 amino acids, by about 30 amino acids, by about 40 amino acids, by about 50 amino acids, by about 75 amino acids, by about 100 amino acids or more.
In some embodiments, Cas9 fusion proteins as provided herein comprise the full-length amino acid of a Cas9 protein, e.g., one of the sequences provided above. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length Cas9 sequence, but only a fragment thereof. For example, in some embodiments, a Cas9 fusion protein provided herein comprises a Cas9 fragment, wherein the fragment binds crRNA and tracrRNA or sgRNA, but does not comprise a functional nuclease domain, e.g., in that it comprises only a truncated version of a nuclease domain or no nuclease domain at all. Exemplary amino acid sequences of suitable Cas9 domains and Cas9 fragments are provided herein, and additional suitable sequences of Cas9 domains and fragments will be apparent to those of skill in the art.
In some embodiments, Cas9 refers to Cas9 from: Corynebacterium ulcerans (NCBI Refs: NC_015683.1, NC_017317.1); Corynebacterium diphtheria (NCBI Refs: NC_016782.1, NC_016786.1); Spiroplasma syrphidicola (NCBI Ref: NC_021284.1); Prevotella intermedia (NCBI Ref: NC_017861.1); Spiroplasma taiwanense (NCBI Ref: NC_021846.1); Streptococcus iniae (NCBI Ref: NC_021314.1); Belliella baltica (NCBI Ref: NC_018010.1); Psychroflexus torquisI (NCBI Ref: NC_018721.1); Streptococcus thermophilus (NCBI Ref: YP_820832.1); Listeria innocua (NCBI Ref: NP_472073.1); Campylobacter jejuni (NCBI Ref: YP_002344900.1); or Neisseria. meningitidis (NCBI Ref: YP_002342100.1).
The term “deaminase” refers to an enzyme that catalyzes a deamination reaction. In some embodiments, the deaminase is a cytidine deaminase, catalyzing the hydrolytic deamination of cytidine or deoxycytidine to uracil or deoxyuracil, respectively.
The term “effective amount,” as used herein, refers to an amount of a biologically active agent that is sufficient to elicit a desired biological response. For example, in some embodiments, an effective amount of a nuclease may refer to the amount of the nuclease that is sufficient to induce cleavage of a target site specifically bound and cleaved by the nuclease. In some embodiments, an effective amount of a fusion protein provided herein, e.g., of a fusion protein comprising a nuclease-inactive Cas9 domain and a nucleic acid-editing domain (e.g., a deaminase domain) may refer to the amount of the fusion protein that is sufficient to induce editing of a target site specifically bound and edited by the fusion protein. As will be appreciated by the skilled artisan, the effective amount of an agent, e.g., a fusion protein, a nuclease, a deaminase, a recombinase, a hybrid protein, a protein dimer, a complex of a protein (or protein dimer) and a polynucleotide, or a polynucleotide, may vary depending on various factors as, for example, on the desired biological response, e.g., on the specific allele, genome, or target site to be edited, on the cell or tissue being targeted, and on the agent being used.
The term “linker,” as used herein, refers to a chemical group or a molecule linking two molecules or moieties, e.g., two domains of a fusion protein, such as, for example, a nuclease-inactive Cas9 domain and a nucleic acid-editing domain (e.g., a deaminase domain). In some embodiments, a linker joins a gRNA binding domain of an RNA-programmable nuclease, including a Cas9 nuclease domain, and the catalytic domain of anucleic-acid editing protein. In some embodiments, a linker joins a dCas9 and a nucleic-acid editing protein. Typically, the linker is positioned between, or flanked by, two groups, molecules, or other moieties and connected to each one via a covalent bond, thus connecting the two. In some embodiments, the linker is an amino acid or a plurality of amino acids (e.g., a peptide or protein). In some embodiments, the linker is an organic molecule, group, polymer, or chemical moiety. In some embodiments, the linker is 5-100 amino acids in length, for example, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 30-35, 35-40, 40-45, 45-50, 50-60, 60-70, 70-80, 80-90, 90-100, 100-150, or 150-200 amino acids in length. Longer or shorter linkers are also contemplated.
The term “mutation,” as used herein, refers to a substitution of a residue within a sequence, e.g., a nucleic acid or amino acid sequence, with another residue, or a deletion or insertion of one or more residues within a sequence. Mutations are typically described herein by identifying the original residue followed by the position of the residue within the sequence and by the identity of the newly substituted residue. Various methods for making the amino acid substitutions (mutations) provided herein are well known in the art, and are provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)).
The terms “nucleic acid” and “nucleic acid molecule,” as used herein, refer to a compound comprising a nucleobase and an acidic moiety, e.g., a nucleoside, a nucleotide, or a polymer of nucleotides. Typically, polymeric nucleic acids, e.g., nucleic acid molecules comprising three or more nucleotides are linear molecules, in which adjacent nucleotides are linked to each other via a phosphodiester linkage. In some embodiments, “nucleic acid” refers to individual nucleic acid residues (e.g. nucleotides and/or nucleosides). In some embodiments, “nucleic acid” refers to an oligonucleotide chain comprising three or more individual nucleotide residues. As used herein, the terms “oligonucleotide” and “polynucleotide” can be used interchangeably to refer to a polymer of nucleotides (e.g., a string of at least three nucleotides). In some embodiments, “nucleic acid” encompasses RNA as well as single and/or double-stranded DNA. Nucleic acids may be naturally occurring, for example, in the context of a genome, a transcript, an mRNA, tRNA, rRNA, siRNA, snRNA, a plasmid, cosmid, chromosome, chromatid, or other naturally occurring nucleic acid molecule. On the other hand, a nucleic acid molecule may be a non-naturally occurring molecule, e.g., a recombinant DNA or RNA, an artificial chromosome, an engineered genome, or fragment thereof, or a synthetic DNA, RNA, DNA/RNA hybrid, or including non-naturally occurring nucleotides or nucleosides. Furthermore, the terms “nucleic acid,” “DNA,” “RNA,” and/or similar terms include nucleic acid analogs, e.g., analogs having other than a phosphodiester backbone. Nucleic acids can be purified from natural sources, produced using recombinant expression systems and optionally purified, chemically synthesized, etc. Where appropriate, e.g., in the case of chemically synthesized molecules, nucleic acids can comprise nucleoside analogs such as analogs having chemically modified bases or sugars, and backbone modifications. A nucleic acid sequence is presented in the 5′ to 3′ direction unless otherwise indicated. In some embodiments, a nucleic acid is or comprises natural nucleosides (e.g. adenosine, thymidine, guanosine, cytidine, uridine, deoxyadenosine, deoxythymidine, deoxyguanosine, and deoxycytidine); nucleoside analogs (e.g., 2-aminoadenosine, 2-thiothymidine, inosine, pyrrolo-pyrimidine, 3-methyl adenosine, 5-methylcytidine, 2-aminoadenosine, C5-bromouridine, C5-fluorouridine, C5-iodouridine, C5-propynyl-uridine, C5-propynyl-cytidine, C5-methylcytidine, 2-aminoadenosine, 7-deazaadenosine, 7-deazaguanosine, 8-oxoadenosine, 8-oxoguanosine, O(6)-methylguanine, and 2-thiocytidine); chemically modified bases; biologically modified bases (e.g., methylated bases); intercalated bases; modified sugars (e.g., 2′-fluororibose, ribose, 2′-deoxyribose, arabinose, and hexose); and/or modified phosphate groups (e.g., phosphorothioates and 5′-N-phosphoramidite linkages).
The term “proliferative disease,” as used herein, refers to any disease in which cell or tissue homeostasis is disturbed in that a cell or cell population exhibits an abnormally elevated proliferation rate. Proliferative diseases include hyperproliferative diseases, such as pre-neoplastic hyperplastic conditions and neoplastic diseases. Neoplastic diseases are characterized by an abnormal proliferation of cells and include both benign and malignant neoplasias. Malignant neoplasia is also referred to as cancer.
The terms “protein,” “peptide,” and “polypeptide” are used interchangeably herein, and refer to a polymer of amino acid residues linked together by peptide (amide) bonds. The terms refer to a protein, peptide, or polypeptide of any size, structure, or function. Typically, a protein, peptide, or polypeptide will be at least three amino acids long. A protein, peptide, or polypeptide may refer to an individual protein or a collection of proteins. One or more of the amino acids in a protein, peptide, or polypeptide may be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modification, etc. A protein, peptide, or polypeptide may also be a single molecule or may be a multi-molecular complex. A protein, peptide, or polypeptide may be just a fragment of a naturally occurring protein or peptide. A protein, peptide, or polypeptide may be naturally occurring, recombinant, or synthetic, or any combination thereof. The term “fusion protein” as used herein refers to a hybrid polypeptide which comprises protein domains from at least two different proteins. One protein may be located at the amino-terminal (N-terminal) portion of the fusion protein or at the carboxy-terminal (C-terminal) protein thus forming an “amino-terminal fusion protein” or a “carboxy-terminal fusion protein,” respectively. A protein may comprise different domains, for example, a nucleic acid binding domain (e.g., the gRNA binding domain of Cas9 that directs the binding of the protein to a target site) and a nucleic acid cleavage domain or a catalytic domain of a nucleic-acid editing protein. In some embodiments, a protein comprises a proteinaceous part, e.g., an amino acid sequence constituting a nucleic acid binding domain, and an organic compound, e.g., a compound that can act as a nucleic acid cleavage agent. In some embodiments, a protein is in a complex with, or is in association with, a nucleic acid, e.g., RNA. Any of the proteins provided herein may be produced by any method known in the art. For example, the proteins provided herein may be produced via recombinant protein expression and purification, which is especially suited for fusion proteins comprising a peptide linker. Methods for recombinant protein expression and purification are well known, and include those described by Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)), the entire contents of which are incorporated herein by reference.
The term “RNA-programmable nuclease,” and “RNA-guided nuclease” are used interchangeably herein and refer to a nuclease that forms a complex with (e.g., binds or associates with) one or more RNA that is not a target for cleavage. In some embodiments, an RNA-programmable nuclease, when in a complex with an RNA, may be referred to as a nuclease:RNA complex. Typically, the bound RNA(s) is referred to as a guide RNA (gRNA). gRNAs can exist as a complex of two or more RNAs, or as a single RNA molecule. gRNAs that exist as a single RNA molecule may be referred to as single-guide RNAs (sgRNAs), though “gRNA” is used interchangeably to refer to guide RNAs that exist as either single molecules or as a complex of two or more molecules. Typically, gRNAs that exist as single RNA species comprise two domains: (1) a domain that shares homology to a target nucleic acid (e.g., and directs binding of a Cas9 complex to the target); and (2) a domain that binds a Cas9 protein. In some embodiments, domain (2) corresponds to a sequence known as a tracrRNA, and comprises a stem-loop structure. For example, in some embodiments, domain (2) is homologous to a tracrRNA as depicted in FIG. 1E of Jinek et al., Science 337:816-821(2012), the entire contents of which is incorporated herein by reference. Other examples of gRNAs (e.g., those including domain 2) can be found in U.S. Provisional Patent Application, U.S. Ser. No. 61/874,682, filed Sep. 6, 2013, entitled “Switchable Cas9 Nucleases And Uses Thereof,” and U.S. Provisional Patent Application, U.S. Ser. No. 61/874,746, filed Sep. 6, 2013, entitled “Delivery System For Functional Nucleases,” the entire contents of each are hereby incorporated by reference in their entirety. In some embodiments, a gRNA comprises two or more of domains (1) and (2), and may be referred to as an “extended gRNA.” For example, an extended gRNA will, e.g., bind two or more Cas9 proteins and bind a target nucleic acid at two or more distinct regions, as described herein. The gRNA comprises a nucleotide sequence that complements a target site, which mediates binding of the nuclease/RNA complex to said target site, providing the sequence specificity of the nuclease:RNA complex. In some embodiments, the RNA-programmable nuclease is the (CRISPR-associated system) Cas9 endonuclease, for example Cas9 (Csn1) from Streptococcus pyogenes (see, e.g., “Complete genome sequence of an M1 strain of Streptococcus pyogenes.” Ferretti J. J., McShan W. M., Ajdic D. J., Savic D. J., Savic G., Lyon K., Primeaux C., Sezate S., Suvorov A. N., Kenton S., Lai H. S., Lin S. P., Qian Y., Jia H. G., Najar F. Z., Ren Q., Zhu H., Song L., White J., Yuan X., Clifton S. W., Roe B. A., McLaughlin R. E., Proc. Natl. Acad. Sci. U.S.A. 98:4658-4663(2001); “CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III.” Deltcheva E., Chylinski K., Sharma C. M., Gonzales K., Chao Y., Pirzada Z. A., Eckert M. R., Vogel J., Charpentier E., Nature 471:602-607(2011); and “A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity.” Jinek M., Chylinski K., Fonfara I., Hauer M., Doudna J. A., Charpentier E. Science 337:816-821(2012), the entire contents of each of which are incorporated herein by reference.
Because RNA-programmable nucleases (e.g., Cas9) use RNA:DNA hybridization to target DNA cleavage sites, these proteins are able to be targeted, in principle, to any sequence specified by the guide RNA. Methods of using RNA-programmable nucleases, such as Cas9, for site-specific cleavage (e.g., to modify a genome) are known in the art (see e.g., Cong, L. et al. Multiplex genome engineering using CRISPR/Cas systems. Science 339, 819-823 (2013); Mali, P. et al. RNA-guided human genome engineering via Cas9. Science 339, 823-826 (2013); Hwang, W. Y. et al. Efficient genome editing in zebrafish using a CRISPR-Cas system. Nature biotechnology 31, 227-229 (2013); Jinek, M. et al. RNA-programmed genome editing in human cells. eLife 2, e00471 (2013); Dicarlo, J. E. et al. Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic acids research (2013); Jiang, W. et al. RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Nature biotechnology 31, 233-239 (2013); the entire contents of each of which are incorporated herein by reference).
The term “subject,” as used herein, refers to an individual organism, for example, an individual mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a non-human mammal. In some embodiments, the subject is a non-human primate. In some embodiments, the subject is a rodent. In some embodiments, the subject is a sheep, a goat, a cattle, a cat, or a dog. In some embodiments, the subject is a vertebrate, an amphibian, a reptile, a fish, an insect, a fly, or a nematode. In some embodiments, the subject is a research animal. In some embodiments, the subject is genetically engineered, e.g., a genetically engineered non-human subject. The subject may be of either sex and at any stage of development.
The term “target site” refers to a sequence within a nucleic acid molecule that is deaminated by a deaminase or a fusion protein comprising a deaminase, (e.g., a dCas9-deaminase fusion protein provided herein).
The terms “treatment,” “treat,” and “treating,” refer to a clinical intervention aimed to reverse, alleviate, delay the onset of, or inhibit the progress of a disease or disorder, or one or more symptoms thereof, as described herein. As used herein, the terms “treatment,” “treat,” and “treating” refer to a clinical intervention aimed to reverse, alleviate, delay the onset of, or inhibit the progress of a disease or disorder, or one or more symptoms thereof, as described herein. In some embodiments, treatment may be administered after one or more symptoms have developed and/or after a disease has been diagnosed. In other embodiments, treatment may be administered in the absence of symptoms, e.g., to prevent or delay onset of a symptom or inhibit onset or progression of a disease. For example, treatment may be administered to a susceptible individual prior to the onset of symptoms (e.g., in light of a history of symptoms and/or in light of genetic or other susceptibility factors). Treatment may also be continued after symptoms have resolved, for example, to prevent or delay their recurrence.
Some aspects of this disclosure provide fusion proteins that comprise a Cas9 domain that binds to a guide RNA (also referred to as gRNA or sgRNA), which, in turn, binds a target nucleic acid sequence via strand hybridization; and a DNA-editing domain, for example, a deaminase domain that can deaminate a nucleobase, such as, for example, cytidine. The deamination of a nucleobase by a deaminase can lead to a point mutation at the respective residue, which is referred to herein as nucleic acid editing. Fusion proteins comprising a Cas9 variant or domain and a DNA editing domain can thus be used for the targeted editing of nucleic acid sequences. Such fusion proteins are useful for targeted editing of DNA in vitro, e.g., for the generation of mutant cells or animals; for the introduction of targeted mutations, e.g., for the correction of genetic defects in cells ex vivo, e.g., in cells obtained from a subject that are subsequently re-introduced into the same or another subject; and for the introduction of targeted mutations, e.g., the correction of genetic defects or the introduction of deactivating mutations in disease-associated genes in a subject. Typically, the Cas9 domain of the fusion proteins described herein does not have any nuclease activity but instead is a Cas9 fragment or a dCas9 protein or domain. Methods for the use of Cas9 fusion proteins as described herein are also provided.
Non-limiting, exemplary nuclease-inactive Cas9 domains are provided herein. One exemplary suitable nuclease-inactive Cas9 domain is the D10A/H840A Cas9 domain mutant:
Additional suitable nuclease-inactive Cas9 domains will be apparent to those of skill in the art based on this disclosure. Such additional exemplary suitable nuclease-inactive Cas9 domains include, but are not limited to, D10A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology. 2013; 31(9): 833-838, the entire contents of which are incorporated herein by reference).
Fusion Proteins Between Cas9 and Nucleic Acid Editing Enzymes or Domains
Some aspects of this disclosure provide fusion proteins comprising (i) a nuclease-inactive Cas9 enzyme or domain; and (ii) a nucleic acid-editing enzyme or domain. In some embodiments, the nucleic acid-editing enzyme or domain is a DNA-editing enzyme or domain. In some embodiments, the nucleic acid-editing enzyme possesses deaminase activity. In some embodiments, the nucleic acid-editing enzyme or domain comprises or is a deaminase domain. In some embodiments, the deaminase is a cytidine deaminase. In some embodiments, the deaminase is an apolipoprotein B mRNA-editing complex (APOBEC) family deaminase. In some embodiments, the deaminase is an APOBEC1 family deaminase. In some embodiments, the deaminase is an activation-induced cytidine deaminase (AID). In some embodiments, the deaminase is an ACF1/ASE deaminase. In some embodiments, the deaminase is an adenosine deaminase. In some embodiments, the deaminase is an ADAT family deaminase. Some nucleic-acid editing enzymes and domains as well as Cas9 fusion proteins including such enzymes or domains are described in detail herein. Additional suitable nucleic acid-editing enzymes or domains will be apparent to the skilled artisan based on this disclosure.
The instant disclosure provides Cas9:nucleic acid-editing enzyme/domain fusion proteins of various configurations. In some embodiments, the nucleic acid-editing enzyme or domain is fused to the N-terminus of the Cas9 domain. In some embodiments, the nucleic acid-editing enzyme or domain is fused to the C-terminus of the Cas9 domain. In some embodiments, the Cas9 domain and the nucleic acid-editing-editing enzyme or domain are fused via a linker. In some embodiments, the linker comprises a (GGGGS)n (SEQ ID NO: 91), a (G)n, an (EAAAK)n (SEQ ID NO: 5), a (GGS)n, an SGSETPGTSESATPES (SEQ ID NO: 93) motif (see, e.g., Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82; the entire contents are incorporated herein by reference), or an (XP)n motif, or a combination of any of these, wherein n is independently an integer between 1 and 30. In some embodiments, n is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30, or, if more than one linker or more than one linker motif is present, any combination thereof. Additional suitable linker motifs and linker configurations will be apparent to those of skill in the art. In some embodiments, suitable linker motifs and configurations include those described in Chen et al., Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. 2013; 65(10):1357-69, the entire contents of which are incorporated herein by reference. Additional suitable linker sequences will be apparent to those of skill in the art based on the instant disclosure.
In some embodiments, the general architecture of exemplary Cas9 fusion proteins provided herein comprises the structure:
[NH2]-[nucleic acid-editing enzyme or domain]-[Cas9]-[COOH] or
[NH2]-[Cas9]-[nucleic acid-editing enzyme or domain]-[COOH],
wherein NH2 is the N-terminus of the fusion protein, and COOH is the C-terminus of the fusion protein.
Additional features may be present, for example, one or more linker sequences between the NLS and the rest of the fusion protein and/or between the nucleic acid-editing enzyme or domain and the Cas9. Other exemplary features that may be present are localization sequences, such as nuclear localization sequences, cytoplasmic localization sequences, export sequences, such as nuclear export sequences, or other localization sequences, as well as sequence tags that are useful for solubilization, purification, or detection of the fusion proteins. Suitable localization signal sequences and sequences of protein tags are provided herein, and include, but are not limited to, biotin carboxylase carrier protein (BCCP) tags, myc-tags, calmodulin-tags, FLAG-tags, hemagglutinin (HA)-tags, polyhistidine tags, also referred to as histidine tags or His-tags, maltose binding protein (MBP)-tags, nus-tags, glutathione-S-transferase (GST)-tags, green fluorescent protein (GFP)-tags, thioredoxin-tags, S-tags, Softags (e.g., Softag 1, Softag 3), strep-tags, biotin ligase tags, FlAsH tags, V5 tags, and SBP-tags. Additional suitable sequences will be apparent to those of skill in the art.
In some embodiments, the nucleic acid-editing enzyme or domain is a deaminase. For example, in some embodiments, the general architecture of exemplary Cas9 fusion proteins with a deaminase enzyme or domain comprises the structure:
[NH2]-[NLS]-[Cas9]-[deaminase]-[COOH],
[NH2]-[NLS]-[deaminase]-[Cas9]-[COOH],
[NH2]-[Cas9]-[deaminase]-[COOH], or
[NH2]-[deaminase]-[Cas9]-[COOH]
wherein NLS is a nuclear localization signal, NH2 is the N-terminus of the fusion protein, and COOH is the C-terminus of the fusion protein. In some embodiments, a linker is inserted between the Cas9 and the deaminase. In some embodiments, the NLS is located C-terminal of the deaminase and/or the Cas9 domain. In some embodiments, the NLS is located between the deaminase and the Cas9 domain. Additional features, such as sequence tags, may also be present
One exemplary suitable type of nucleic acid-editing enzymes and domains are cytosine deaminases, for example, of the APOBEC family. The apolipoprotein B mRNA-editing complex (APOBEC) family of cytosine deaminase enzymes encompasses eleven proteins that serve to initiate mutagenesis in a controlled and beneficial manner.29 One family member, activation-induced cytidine deaminase (AID), is responsible for the maturation of antibodies by converting cytosines in ssDNA to uracils in a transcription-dependent, strand-biased fashion.30 The apolipoprotein B editing complex 3 (APOBEC3) enzyme provides protection to human cells against a certain HIV-1 strain via the deamination of cytosines in reverse-transcribed viral ssDNA.31 These proteins all require a Zn2+-coordinating motif (His-X-Glu-X23-26-Pro-Cys-X24-Cys) and bound water molecule for catalytic activity. The Glu residue acts to activate the water molecule to a zinc hydroxide for nucleophilic attack in the deamination reaction. Each family member preferentially deaminates at its own particular “hotspot”, ranging from WRC (W is A or T, R is A or G) for hAID, to TTC for hAPOBEC3F.32 A recent crystal structure of the catalytic domain of APOBEC3G (
Another exemplary suitable type of nucleic acid-editing enzymes and domains are adenosine deaminases. For example, an ADAT family adenosine deaminase can be fused to a Cas9 domain, e.g., a nuclease-inactive Cas9 domain, thus yielding a Cas9-ADAT fusion protein.
Some aspects of this disclosure provide a systematic series of fusions between Cas9 and deaminase enzymes, e.g., cytosine deaminase enzymes such as APOBEC enzymes, or adenosine deaminase enzymes such as ADAT enzymes, that has been generated in order to direct the enzymatic activities of these deaminases to a specific site in genomic DNA. The advantages of using Cas9 as the recognition agent are twofold: (1) the sequence specificity of Cas9 can be easily altered by simply changing the sgRNA sequence; and (2) Cas9 binds to its target sequence by denaturing the dsDNA, resulting in a stretch of DNA that is single-stranded and therefore a viable substrate for the deaminase. Successful fusion proteins have been generated with human and mouse deaminase domains, e.g., AID domains. A variety of other fusion proteins between the catalytic domains of human and mouse AID and Cas9 are also contemplated. It will be understood that other catalytic domains, or catalytic domains from other deaminases, can also be used to generate fusion proteins with Cas9, and that the disclosure is not limited in this regard.
In some embodiments, fusion proteins of Cas9 and AID are provided. In an effort to engineer Cas9 fusion proteins to increase mutation rates in ssDNA, both mouse and human AID were tethered to gene V of filamentous phage (a nonspecific ssDNA binding protein). The resulting fusion proteins exhibited enhanced mutagenic activities compared to the wild type enzymes in a cell-based assay. This work demonstrates that the enzymatic activity of these proteins is maintained in and can be successfully targeted to genetic sequences with fusion proteins.36
While several crystal structures of Cas9 (and even Cas9 in complex with its sgRNA and target DNA) have been reported, (see, e.g., Jinek M, Jiang F, Taylor D W, Sternberg S H, Kaya E, Ma E, Anders C, Hauer M, Zhou K, Lin S, Kaplan M, lavarone A T, Charpentier E, Nogales E, Doudna J A. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science. 2014; 343(6176):1247997. PMID: 24505130; and Nishimasu H, Ran F A, Hsu P D, Konermann S, Shehata S I, Dohmae N, Ishitani R, Zhang F, Nureki O. Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell. 2014; 156(5):935-49. PMID: 24529477, the entire contents of each of which are incorporated herein by reference), the portion of DNA that is single stranded in the Cas9-DNA complex is unknown (the size of the Cas9-DNA bubble). However, it has been shown in a dCas9 system with a sgRNA specifically designed for the complex to interfere with transcription that transcriptional interference only occurs when the sgRNA binds to the non-template strand. This result suggests that certain portions of the DNA in the DNA-Cas9 complex are unguarded by Cas9, and could potentially be targeted by a deaminase in the fusion protein (see Qi L S, Larson M H, Gilbert L A, Doudna J A, Weissman J S, Arkin A P, Lim W A. Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression. Cell. 2013; 152(5):1173-83. PMID: 23452860, the entire contents of which are incorporated herein by reference). Further supporting this notion, footprinting experiments with exonuclease III and nuclease P1 (which only acts on ssDNA as a substrate) have revealed that at least 26 bases on the non-template strand are susceptible to digestion by these enzymes (see Jinek M, Jiang F, Taylor D W, Sternberg S H, Kaya E, Ma E, Anders C, Hauer M, Zhou K, Lin S, Kaplan M, lavarone A T, Charpentier E, Nogales E, Doudna J A. Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science. 2014; 343(6176):1247997. PMID: 24505130). It has also been reported that in certain cases, Cas9 induces single base-substitution mutations in this susceptible stretch of DNA at frequencies as high as 15% (see Tsai S Q, Wyvekens N, Khayter C, Foden J A, Thapar V, Reyon D, Goodwin M J, Aryee M J, Joung J K. Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editing. Nat Biotechnol. 2014; 32(6):569-76. PMID: 24770325, the entire contents of which are incorporated herein by reference). While the mechanism of introduction of these mutations is unknown, in all cases, the base that is mutated is a cytosine, which could possibly indicate the involvement of a cytosine deaminase enzyme. Taken together, these data are clearly consistent with a portion of the target DNA being single stranded and susceptible to other enzymes. It has been shown in a dCas9 system with a sgRNA specifically designed for the complex to interfere with transcription that transcriptional interference only occurs when the sgRNA binds to the non-template strand. This result suggests that certain portions of the DNA in the DNA-Cas9 complex are unguarded by Cas9, and could potentially be targeted by AID in the fusion protein.16 Accordingly, both N-terminal and C-terminal fusions of Cas9 with a deaminase domain are useful according to aspects of this disclosure.
In some embodiments, the deaminase domain and the Cas9 domain are fused to each other via a linker. Various linker lengths and flexibilities between the deaminase domain (e.g., AID) and the Cas9 domain can be employed (e.g., ranging from very flexible linkers of the form (GGGGS)n (SEQ ID NO: 91), (GGS)n, and (G)n to more rigid linkers of the form (EAAAK)n (SEQ ID NO: 5), SGSETPGTSESATPES (SEQ ID NO: 93) (see, e.g., Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82; the entire contents are incorporated herein by reference) and (XP)n)37 in order to achieve the optimal length for deaminase activity for the specific application.
Some exemplary suitable nucleic-acid editing enzymes and domains, e.g., deaminases and deaminase domains, that can be fused to Cas9 domains according to aspects of this disclosure are provided below. It will be understood that, in some embodiments, the active domain of the respective sequence can be used, e.g., the domain without a localizing signal (nuclear localizing signal, without nuclear export signal, cytoplasmic localizing signal).
MDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLR
MDSLLMKQKKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSCSLDFGHLR
MDSLLMKQRKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLR
MDSLLKKQRQFLYQFKNVRWAKGRHETYLCYVVKRRDSPTSFSLDFGHLR
SWSPCFECAEQIVRFLATHHNLSLDIFSSRLYNVQDPETQQNLCRLVQEG
ELSQVTITCYLTWSPCPNCAWQLAAFKRDRPDLILHIYTSRLYFHWKRPF
SWSPCFECAEQVLRFLATHHNLSLDIFSSRLYNIRDPENQQNLCRLVQEG
ELSQVIITCYLTWSPCPNCAWQLAAFKRDRPDLILHIYTSRLYFHWKRPF
MVEPMDPRTFVSNFNNRPILSGLNTVWLCCEVKTKDPSGPPLDAKIFQGK
VYSKAKYHPEM
RFLRWFHKWRQLHHDQEYKVTWYVSWSPCTRCANSVATF
AELCFLDLIPFWKLDGQQYRVTCFTSWSPCFSCAQEMAKFISNNEHVSLC
MKPHFRNPVERMYQDTFSDNFYNRPILSHRNTVWLCYEVKTKGPSRPPLD
AKIFRGQVYSKLKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
MNPQIRNMVEQMEPDIFVYYFNNRPILSGRNTVWLCYEVKTKDPSGPPLD
ANIFQGKLYPEAKDHPEMKFLHWFRKWRQLHRDQEYEVTWYVSWSPCTRC
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLD
AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
ERCFLSWFCDDILSPNTNYEVTWYTSWSPCPECAGEVAEFLARHSNVNLT
CFSWGCAGEVRAFLQENTHVRLRIFAARIYDYDPLYKEALQMLRDAGAQV
TWFVSWNPCLPCVVKVTKFLAEHPNVTLTISAARLYYYRDRDWRWVLLRL
LHQLHLAAVLKEDSIFVPGTQRGLWRLRPDLSFVFFSSHTPCGDASIIPM
LEFEEQPCCPVIRSWANNSPVQETENLEDSKDKRNCEDPASPVAKKMRLG
TPARSLSNCVAHHGTQESGPVKPDVSSSDLTKEEPDAANGIASGSFRVVD
VYRTGAKCVPGETGDLREPGAAYHQVGLLRVKPGRGDRTCSMSCSDKMAR
WNVLGCQGALLMHFLEKPIYLSAVVIGKCPYSQEAMRRALTGRCEETLVL
PRGFGVQELEIQQSGLLFEQSRCAVHRKRGDSPGRLVPCGAAISWSAVPQ
QPLDVTANGFPQGTTKKEIGSPRARSRISKVELFRSFQKLLSSIADDEQP
DSIRVTKKLDTYQEYKDAASAYQEAWGALRRIQPFASWIRNPPDYHQFK
LHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPM
LEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLE
PGTAAREVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGLATVTRIAPGS
AKVIDVYRTGAKCVPGEAGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCS
DKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQRALIGRCQ
NVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISW
SAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIA
RDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQ
FK
In some embodiments, fusion proteins as provided herein comprise the full-length amino acid of a nucleic acid-editing enzyme, e.g., one of the sequences provided above. In other embodiments, however, fusion proteins as provided herein do not comprise a full-length sequence of a nucleic acid-editing enzyme, but only a fragment thereof. For example, in some embodiments, a fusion protein provided herein comprises a Cas9 domain and a fragment of a nucleic acid-editing enzyme, e.g., wherein the fragment comprises a nucleic acid-editing domain. Exemplary amino acid sequences of nucleic acid-editing domains are shown in the sequences above as italicized letters, and additional suitable sequences of such domains will be apparent to those of skill in the art.
Additional suitable nucleic-acid editing enzyme sequences, e.g., deaminase enzyme and domain sequences, that can be used according to aspects of this invention, e.g., that can be fused to a nuclease-inactive Cas9 domain, will be apparent to those of skill in the art based on this disclosure. In some embodiments, such additional enzyme sequences include deaminase enzyme or deaminase domain sequences that are at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% similar to the sequences provided herein. Additional suitable Cas9 domains, variants, and sequences will also be apparent to those of skill in the art. Examples of such additional suitable Cas9 domains include, but are not limited to, D10A, D10A/D839A/H840A, and D10A/D839A/H840A/N863A mutant domains (See, e.g., Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology. 2013; 31(9): 833-838 the entire contents of which are incorporated herein by reference).
Additional suitable strategies for generating fusion proteins comprising a Cas9 domain and a deaminase domain will be apparent to those of skill in the art based on this disclosure in combination with the general knowledge in the art. Suitable strategies for generating fusion proteins according to aspects of this disclosure using linkers or without the use of linkers will also be apparent to those of skill in the art in view of the instant disclosure and the knowledge in the art. For example, Gilbert et al., CRISPR-mediated modular RNA-guided regulation of transcription in eukaryotes. Cell. 2013; 154(2):442-51, showed that C-terminal fusions of Cas9 with VP64 using 2 NLS's as a linker (SPKKKRKVEAS, SEQ ID NO: 29), can be employed for transcriptional activation. Mali et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nat Biotechnol. 2013; 31(9):833-8, reported that C-terminal fusions with VP64 without linker can be employed for transcriptional activation. And Maeder et al., CRISPR RNA-guided activation of endogenous human genes. Nat Methods. 2013; 10: 977-979, reported that C-terminal fusions with VP64 using a Gly4Ser (SEQ ID NO: 91) linker can be used as transcriptional activators. Recently, dCas9-FokI nuclease fusions have successfully been generated and exhibit improved enzymatic specificity as compared to the parental Cas9 enzyme (In Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82, and in Tsai S Q, Wyvekens N, Khayter C, Foden J A, Thapar V, Reyon D, Goodwin M J, Aryee M J, Joung J K. Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editing. Nat Biotechnol. 2014; 32(6):569-76. PMID: 24770325 a SGSETPGTSESATPES (SEQ ID NO: 93) or a GGGGS (SEQ ID NO: 91) linker was used in FokI-dCas9 fusion proteins, respectively).
Use of Cas9 DNA Editing Fusion Proteins for Correcting Disease-Associated Mutations
Some embodiments provide methods for using the Cas9 DNA editing fusion proteins provided herein. In some embodiments, the fusion protein is used to introduce a point mutation into a nucleic acid by deaminating a target nucleobase, e.g., a C residue. In some embodiments, the deamination of the target nucleobase results in the correction of a genetic defect, e.g., in the correction of a point mutation that leads to a loss of function in a gene product. In some embodiments, the genetic defect is associated with a disease or disorder, e.g., a lysosomal storage disorder or a metabolic disease, such as, for example, type I diabetes. In some embodiments, the methods provided herein are used to introduce a deactivating point mutation into a gene or allele that encodes a gene product that is associated with a disease or disorder. For example, in some embodiments, methods are provided herein that employ a Cas9 DNA editing fusion protein to introduce a deactivating point mutation into an oncogene (e.g., in the treatment of a proliferative disease). A deactivating mutation may, in some embodiments, generate a premature stop codon in a coding sequence, which results in the expression of a truncated gene product, e.g., a truncated protein lacking the function of the full-length protein.
In some embodiments, the purpose of the methods provide herein is to restore the function of a dysfunctional gene via genome editing. The Cas9 deaminase fusion proteins provided herein can be validated for gene editing-based human therapeutics in vitro, e.g., by correcting a disease-associated mutation in human cell culture. It will be understood by the skilled artisan that the fusion proteins provided herein, e.g., the fusion proteins comprising a Cas9 domain and a nucleic acid deaminase domain can be used to correct any single point T→C or A→G mutation. In the first case, deamination of the mutant C back to U corrects the mutation, and in the latter case, deamination of the C that is base-paired with the mutant G, followed by a round of replication, corrects the mutation.
An exemplary disease-relevant mutation that can be corrected by the provided fusion proteins in vitro or in vivo is the H1047R (A3140G) polymorphism in the PI3KCA protein. The phosphoinositide-3-kinase, catalytic alpha subunit (PI3KCA) protein acts to phosphorylate the 3-OH group of the inositol ring of phosphatidylinositol. The PI3KCA gene has been found to be mutated in many different carcinomas, and thus it is considered to be a potent oncogene.50 In fact, the A3140G mutation is present in several NCI-60 cancer cell lines, such as, for example, the HCT116, SKOV3, and T47D cell lines, which are readily available from the American Type Culture Collection (ATCC).51
In some embodiments, a cell carrying a mutation to be corrected, e.g., a cell carrying a point mutation, e.g., an A3140G point mutation in exon 20 of the PI3KCA gene, resulting in a H1047R substitution in the PI3KCA protein, is contacted with an expression construct encoding a Cas9 deaminase fusion protein and an appropriately designed sgRNA targeting the fusion protein to the respective mutation site in the encoding PI3KCA gene. Control experiments can be performed where the sgRNAs are designed to target the fusion enzymes to non-C residues that are within the PI3KCA gene. Genomic DNA of the treated cells can be extracted, and the relevant sequence of the PI3KCA genes PCR amplified and sequenced to assess the activities of the fusion proteins in human cell culture.
It will be understood that the example of correcting point mutations in PI3KCA is provided for illustration purposes and is not meant to limit the instant disclosure. The skilled artisan will understand that the instantly disclosed DNA-editing fusion proteins can be used to correct other point mutations and mutations associated with other cancers and with diseases other than cancer including other proliferative diseases.
The successful correction of point mutations in disease-associated genes and alleles opens up new strategies for gene correction with applications in therapeutics and basic research. Site-specific single-base modification systems like the disclosed fusions of Cas9 and deaminase enzymes or domains also have applications in “reverse” gene therapy, where certain gene functions are purposely suppressed or abolished. In these cases, site-specifically mutating Trp (TGG), Gln (CAA and CAG), or Arg (CGA) residues to premature stop codons (TAA, TAG, TGA) can be used to abolish protein function in vitro, ex vivo, or in vivo.
The instant disclosure provides methods for the treatment of a subject diagnosed with a disease associated with or caused by a point mutation that can be corrected by a Cas9 DNA editing fusion protein provided herein. For example, in some embodiments, a method is provided that comprises administering to a subject having such a disease, e.g., a cancer associated with a PI3KCA point mutation as described above, an effective amount of a Cas9 deaminase fusion protein that corrects the point mutation or introduces a deactivating mutation into the disease-associated gene. In some embodiments, the disease is a proliferative disease. In some embodiments, the disease is a genetic disease. In some embodiments, the disease is a neoplastic disease. In some embodiments, the disease is a metabolic disease. In some embodiments, the disease is a lysosomal storage disease. Other diseases that can be treated by correcting a point mutation or introducing a deactivating mutation into a disease-associated gene will be known to those of skill in the art, and the disclosure is not limited in this respect.
The instant disclosure provides methods for the treatment of additional diseases or disorders, e.g., diseases or disorders that are associated or caused by a point mutation that can be corrected by deaminase-mediated gene editing. Some such diseases are described herein, and additional suitable diseases that can be treated with the strategies and fusion proteins provided herein will be apparent to those of skill in the art based on the instant disclosure. Exemplary suitable diseases and disorders are listed below. It will be understood that the numbering of the specific positions or residues in the respective sequences depends on the particular protein and numbering scheme used. Numbering might be different, e.g., in precursors of a mature protein and the mature protein itself, and differences in sequences from species to species may affect numbering. One of skill in the art will be able to identify the respective residue in any homologous protein and in the respective encoding nucleic acid by methods well known in the art, e.g., by sequence alignment and determination of homologous residues. Exemplary suitable diseases and disorders include, without limitation, cystic fibrosis (see, e.g., Schwank et al., Functional repair of CFTR by CRISPR/Cas9 in intestinal stem cell organoids of cystic fibrosis patients. Cell stem cell. 2013; 13: 653-658; and Wu et. al., Correction of a genetic disease in mouse via use of CRISPR-Cas9. Cell stem cell. 2013; 13: 659-662, neither of which uses a deaminase fusion protein to correct the genetic defect); phenylketonuria—e.g., phenylalanine to serine mutation at position 835 (mouse) or 240 (human) or a homologous residue in phenylalanine hydroxylase gene (T>C mutation)—see, e.g., McDonald et al., Genomics. 1997; 39:402-405; Bernard-Soulier syndrome (BSS)—e.g., phenylalanine to serine mutation at position 55 or a homologous residue, or cysteine to arginine at residue 24 or a homologous residue in the platelet membrane glycoprotein IX (T>C mutation)—see, e.g., Noris et al., British Journal of Haematology. 1997; 97: 312-320, and Ali et al., Hematol. 2014; 93: 381-384; epidermolytic hyperkeratosis (EHK)—e.g., leucine to proline mutation at position 160 or 161 (if counting the initiator methionine) or a homologous residue in keratin 1 (T>C mutation)—see, e.g., Chipev et al., Cell. 1992; 70: 821-828, see also accession number P04264 in the UNIPROT database at www[dot]uniprot[dot]org; chronic obstructive pulmonary disease (COPD)—e.g., leucine to proline mutation at position 54 or 55 (if counting the initiator methionine) or a homologous residue in the processed form of α1-antitrypsin or residue 78 in the unprocessed form or a homologous residue (T>C mutation)—see, e.g., Poller et al., Genomics. 1993; 17: 740-743, see also accession number P01011 in the UNIPROT database; Charcot-Marie-Toot disease type 4J—e.g., isoleucine to threonine mutation at position 41 or a homologous residue in
It will be apparent to those of skill in the art that in order to target a Cas9:nucleic acid-editing enzyme/domain fusion protein as disclosed herein to a target site, e.g., a site comprising a point mutation to be edited, it is typically necessary to co-express the Cas9:nucleic acid-editing enzyme/domain fusion protein together with a guide RNA, e.g., an sgRNA. As explained in more detail elsewhere herein, a guide RNA typically comprises a tracrRNA framework allowing for Cas9 binding, and a guide sequence, which confers sequence specificity to the Cas9:nucleic acid-editing enzyme/domain fusion protein. In some embodiments, the guide RNA comprises a structure 5′-[guide sequence]-guuuuagagcuagaaauagcaaguuaaaauaaaggcuaguccguuaucaacuugaaaaaguggcaccgagucggugcuuuuu-3′ (SEQ ID NO: 38), wherein the guide sequence comprises a sequence that is complementary to the target sequence. The guide sequence is typically 20 nucleotides long. The sequences of suitable guide RNAs for targeting Cas9:nucleic acid-editing enzyme/domain fusion proteins to specific genomic target sites will be apparent to those of skill in the art based on the instant disclosure. Such suitable guide RNA sequences typically comprise guide sequences that are complementary to a nucleic sequence within 50 nucleotides upstream or downstream of the target nucleotide to be edited. Some exemplary guide RNA sequences suitable for targeting Cas9:nucleic acid-editing enzyme/domain fusion proteins to specific target sequences are provided below.
H1047R (A3140G) polymorphism in the phosphoinositide-3-kinase catalytic alpha subunit (PI3KCA or PIK3CA) (the position of the mutated nucleotide and the respective codon are underlined):
Exemplary suitable guide sequences for targeting a Cas9:nucleic acid-editing enzyme/domain fusion proteins to the mutant A3140G residue include, without limitation: 5′-aucggaauctauuuugacuc-3′ (SEQ ID NO: 41); 5′-ucggaaucuauuuugacucg-3′ (SEQ ID NO: 42); 5′-cuuagauaaaacugagcaag-3′ (SEQ ID NO: 43); 5′-aucuauuuugacucguucuc-3′ (SEQ ID NO: 44); 5′-uaaaacugagcaagaggcuu-3′ (SEQ ID NO: 45); 5′-ugguggcuggacaacaaaaa-3′ (SEQ ID NO: 46); 5′-gcuggacaacaaaaauggau-3′ (SEQ ID NO: 47); 5′-guguuaauuugucguacgua-3′ (SEQ ID NO: 48). Additional suitable guide sequences for targeting a Cas9:nucleic acid-editing enzyme/domain fusion protein to a mutant PI3KCA sequence, to any of the additional sequences provided below, or to additional mutant sequences associated with a disease will be apparent to those of skill in the art based on the instant disclosure.
Phenylketonuria phenylalanine to serine mutation at residue 240 in phenylalanine hydroxylase gene (T>C mutation) (the position of the mutated nucleotide and the respective codon are underlined):
S
R L R P V A G L L S S R D F L G
Bernard-Soulier syndrome (BSS)—cysteine to arginine at residue 24 in the platelet membrane glycoprotein IX (T>C mutation):
Epidermolytic hyperkeratosis (EHK)—leucine to proline mutation at residue 161 in keratin 1 (T>C mutation):
Chronic obstructive pulmonary disease (COPD)—leucine to proline mutation at residue 54 in α1-antitrypsin (T>C mutation):
c
ggctgagttcgccttcagcctataccgccagctggcacaccagtccaac
P
A E F A F S L Y R Q L A H Q S N
Chronic obstructive pulmonary disease (COPD)—leucine to proline mutation at residue 78 in α1-antichymotrypsin (T>C mutation):
Neuroblastoma (NB)—leucine to proline mutation at residue 197 in Caspase-9 (T>C mutation):
Charcot-Marie-Tooth disease type 4J—isoleucine to threonine mutation at residue 41 in
von Willebrand disease (vWD)—cysteine to arginine mutation at residue 1272 in von Willebrand factor (T>C mutation):
Myotonia congenital—cysteine to arginine mutation at position 277 in the muscle chloride channel gene CLCN1 (T>C mutation):
Hereditary renal amyloidosis—stop codon to arginine mutation at residue 111 in apolipoprotein AII (T>C mutation):
Dilated cardiomyopathy (DCM)—tryptophan to Arginine mutation at position 148 in the FOXD4 gene (T>C mutation):
Hereditary lymphedema—histidine to arginine mutation at residue 1035 in VEGFR3 tyrosine kinase (A>G mutation):
Familial Alzheimer's disease—isoleucine to valine mutation at residue 143 in presenilin1 (A>G mutation):
Prion disease—methionine to valine mutation at residue 129 in prion protein (A>G mutation):
Chronic infantile neurologic cutaneous articular syndrome (CINCA)—Tyrosine to Cysteine mutation at residue 570 in cryopyrin (A>G mutation):
Desmin-related myopathy (DRM)—arginine to glycine mutation at residue 120 in αB crystallin (A>G mutation):
Beta-thalassemia-one example is leucine to proline mutation at residue 115 in Hemoglobin B.
It is to be understood that the sequences provided above are exemplary and not meant to be limiting the scope of the instant disclosure. Additional suitable sequences of point mutations that are associated with disease and amenable to correction by Cas9:nucleic acid-editing enzyme/domain fusion proteins as well as suitable guide RNA sequences will be apparent to those of skill in the art based on this disclosure.
Reporter Systems
Some aspects of this disclosure provide a reporter system that can be used for detecting deaminase activity of the fusion proteins described herein. In some embodiments, the reporter system is a luciferase-based assay in which deaminase activity leads to expression of luciferase. To minimize the impact of potential substrate promiscuity of the deaminase domain (e.g., the AID domain), the number of residues that could unintentionally be targeted for deamination (e.g., off-target C residues that could potentially reside on ssDNA within the reporter system) is minimized. In some embodiments, an intended target residue is be located in an ACG mutated start codon of the luciferase gene that is unable to initiate translation. Desired deaminase activity results in a ACG>AUG modification, thus enabling translation of luciferase and detection and quantification of the deaminase activity.
In some embodiments, in order to minimize single-stranded C residues, a leader sequence is inserted between the mutated start codon and the beginning of the luciferase gene which consists of a stretch of Lys (AAA), Asn (AAT), Leu (TTA), Ile (ATT, ATA), Tyr (TAT), or Phe (TTT) residues. The resulting mutants can be tested to ensure that the leader sequence does not adversely affect luciferase expression or activity. Background luciferase activity with the mutated start codon can be determined as well.
The reporter system can be used to test many different sgRNAs, e.g., in order to determine which residue(s) with respect to the target DNA sequence the respective deaminase (e.g., AID enzyme) will target (
Once fusion proteins that are capable of programmable site-specific C to U modifications have been identified, their activities can be further characterized. The data from the luciferase assays can, for example, be integrated into heat maps that describe which nucleotides, with respect to the sgRNA target DNA, are being targeted for deamination by a specific fusion protein. In some embodiments, the position that results in the highest activity in the luciferase assay for each fusion is considered the “target” position, while all others are considered off-target positions.
In some embodiments, Cas9 fusions with various APOBEC3 enzymes, or deaminase domains thereof, are provided. In some embodiments, Cas9 fusion proteins with other nucleic acid editing enzymes or catalytic domains are provided, including, for example, ssRNA editing enzymes, such as the cytidine deaminases APOBEC1 and ACF1/ASF, as well as the ADAT family of adenosine deaminases,38 that can be used for ssDNA editing activity when fused to Cas9. The activity of such fusion proteins can be tested using the same reporter systems and assays described above.
In some embodiments, a reporter system is provided herein that includes a reporter gene comprising a deactivated start codon, e.g., a mutation on the template strand from 3′-TAC-5′ to 3′-CAC-5′. Upon successful deamination of the target C, the corresponding mRNA will be transcribed as 5′-AUG-3′ instead of 5′-GUG-3′, enabling the translation of the reporter gene. Suitable reporter genes will be apparent to those of skill in the art.
The description of exemplary embodiments of the reporter systems above is provided for illustration purposes only and not meant to be limiting. Additional reporter systems, e.g., variations of the exemplary systems described in detail above, are also embraced by this disclosure.
Exemplary Cas9:deaminase fusion proteins are provided below:
MDSLLMNRRKFLYQFKNVRWAKGRRETYLCDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFK
MDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLRNKNGCHVELLFL
SGGGGSGGGGSDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALL
MDSLLMNRRKFLYQFKNVRWAKGRRETYLCDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFK
SPKKKRKVEASMELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAE
SPKKKRKVEASMTSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW
PKKKRKVEASSPKKKRKVEASDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHS
MDSLLMNRRKFLYQFKNVRWAKGRRETYLC
SMGTGTKCIGQSKMRKNGDILNDSHAEVIARR
SFQRYLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCGDASIIPMLEFEDQ
PCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLEPGTAAREVTNGAAHHQSF
GKQKSGPISPGIHSCDLTVEGLATVTRIAPGSAKVIDVYRTGAKCVPGEAGDSGKPGAAFHQ
VGLLRVKPGRGDRTRSMSCSDKMARWNVLGCQGALLMHLLEEPIYLSAVVIGKCPYSQEAMQ
RALIGRCQNVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRLVPCGAAISWSAVP
EQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIARDKWPHSLRVQKLDTY
QEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQF
GGGGSGGGGSGGGGSDKKYSIGLAIGT
MDSLLMNRRKFLYQFKNVRWAKGRRETYLCDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFK
ILNDSHAEVIARRSFQRYLLHQLQLAATLKEDSIFVPGTQKGVWKLRRDLIFVFFSSHTPCG
DASIIPMLEFEDQPCCPVFRNWAHNSSVEASSNLEAPGNERKCEDPDSPVTKKMRLEPGTAA
REVTNGAAHHQSFGKQKSGPISPGIHSCDLTVEGLATVTRIAPGSAKVIDVYRTGAKCVPGE
AGDSGKPGAAFHQVGLLRVKPGRGDRTRSMSCSDKMARWNVLGCQGALLMHLLEEPIYLSAV
VIGKCPYSQEAMQRALIGRCQNVSALPKGFGVQELKILQSDLLFEQSRSAVQAKRADSPGRL
VPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELFRSFQKLLSRIARDK
WPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQVFGSWIRNPPDYHQF
An A3140G point mutation in exon 20 of the PI3KCA gene, resulting in an H1047R amino acid substitution in the PI3K protein is corrected by contacting a nucleic acid encoding the mutant protein with a Cas9:AID (SEQ ID NO: 30) or a Cas9:APOBEC1 (SEQ ID NO: 92) fusion protein and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the encoding PI3KCA gene. The A3140G point mutation is confirmed via genomic PCR of the respective exon 20 sequence, e.g., generation of a PCR amplicon of nucleotides 3000-3250, and subsequent sequencing of the PCT amplicon.
Cells expressing a mutant PI3K protein comprising an A3140G point mutation in exon 20 are contacted with an expression construct encoding the Cas9:AID (SEQ ID NO: 30) or a Cas9:APOBEC1 (SEQ ID NO: 92) fusion protein and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the antisense strand of the encoding PI3KCA gene. The sgRNA is of the sequence
The cytosine deaminase activity of the Cas9:AID or the Cas9:APOBEC1 fusion protein results in deamination of the cytosine that is base-paired with the mutant G3140 to uridine. After one round of replication, the wild type A3140 is restored. Genomic DNA of the treated cells is extracted and a PCR amplicon of nucleotides 3000-3250 is amplified with suitable PCR primers. The correction of the A3140G point mutation after treatment of the cells with the fusion protein is confirmed by sequencing the PCR amplicon.
An A→G point mutation in codon 143 of the presenilin1 (PSEN1) gene, resulting in an I143V amino acid substitution in the PSEN1 protein is corrected by contacting a nucleic acid encoding the mutant PSEN1 protein with a Cas9:AID (SEQ ID NO: 30) or a Cas9:APOBEC1 (SEQ ID NO: 92) fusion protein and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the encoding PSEN1 gene. See, e.g., Gallo et. al., J. Alzheimer's disease. 2011; 25: 425-431 for a description of an exemplary PSEN1 I143V mutation associated with familial Alzheimer's Disease. The A→G point mutation is confirmed via genomic PCR of the respective PSEN1 sequence, e.g., generation of a PCR amplicon of about 100-250 nucleotides around exon 143, and subsequent sequencing of the PCT amplicon.
Cells expressing the mutant PSEN1 protein are contacted with an expression construct encoding the Cas9:AID (SEQ ID NO: 30) or a Cas9:APOBEC1 (SEQ ID NO: 92) fusion protein and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the antisense strand of the encoding PSEN1 gene. The cytosine deaminase activity of the Cas9:AID or the Cas9:APOBEC1 fusion protein results in deamination of the cytosine that is base-paired with the mutant G in codon 143 to uridine. After one round of replication, the wild type A is restored. Genomic DNA of the treated cells is extracted and a PCR amplicon of 100-250 nucleotides is amplified with suitable PCR primers. The correction of the A→G point mutation after treatment of the cells with the fusion protein is confirmed by sequencing the PCR amplicon.
A T→C point mutation in codon 55 of the α1-antitrypsin gene, resulting in an L55P amino acid substitution in the α1-antitrypsin protein is corrected by contacting a nucleic acid encoding the mutant α1-antitrypsin protein with a Cas9:ADAT1 fusion protein (SEQ ID NO: 35 or 36) and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the encoding α1-antitrypsin gene. See, e.g., Poller et al., Genomics. 1993; 17: 740-743 for a more detailed description of an exemplary codon 55 T→C mutation associated with chronic obstructive pulmonary disease (COPD). The T→C point mutation is confirmed via genomic PCR of the respective α1-antitrypsin sequence encoding codon 55, e.g., generation of a PCR amplicon of about 100-250 nucleotides, and subsequent sequencing of the PCT amplicon.
Cells expressing the mutant α1-antitrypsin protein are contacted with an expression construct encoding the Cas9:AID (SEQ ID NO: 30) or a Cas9:APOBEC1 (SEQ ID NO: 92) fusion protein and an appropriately designed sgRNA targeting the fusion protein to the mutated nucleotide in codon 55 on the sense strand in the encoding α1-antitrypsin gene. The cytosine deaminase activity of the Cas9:ADAT1 fusion protein results in deamination of the mutant cytosine to uridine thus correcting the mutation. Genomic DNA of the treated cells is extracted and a PCR amplicon of 100-250 nucleotides is amplified with suitable PCR primers. The correction of the T→C point mutation in codon 55 of the α1-antitrypsin gene after treatment of the cells with the fusion protein is confirmed by sequencing the PCR amplicon
A T→C point mutation in codon 509 of the von Willebrand factor gene, resulting in a C509A amino acid substitution in the von Willebrand factor protein is corrected by contacting a nucleic acid encoding the mutant von Willebrand factor protein with a Cas9:ADAT1 fusion protein (SEQ ID NO: 35 or 36) and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the sense strand of the encoding von Willebrand factor gene. See, e.g., Lavergne et al., Br. J. Haematol. 1992; 82: 66-7, for a description of an exemplary von Willebrand factor C509A mutation associated with von Willebrand disease (vWD). The T→C point mutation is confirmed via genomic PCR of the respective von Willebrand factor genomic sequence, e.g., generation of a PCR amplicon of about 100-250 nucleotides around exon 509, and subsequent sequencing of the PCT amplicon.
Cells expressing the mutant von Willebrand factor protein are contacted with an expression construct encoding the Cas9:ADAT1 fusion protein (SEQ ID NO: 35 or 36) and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the sense strand of the encoding von Willebrand factor gene. The cytosine deaminase activity of the Cas9:ADAT1 fusion protein results in deamination of the mutant cytosine in codon 509 to uridine, thus correcting the mutation. Genomic DNA of the treated cells is extracted and a PCR amplicon of 100-250 nucleotides is amplified with suitable PCR primers. The correction of the T→C point mutation in codon 509 of the von Willebrand factor gene after treatment of the cells with the fusion protein is confirmed by sequencing the PCR amplicon.
A T→C point mutation in codon 197 of the Caspase-9 gene, resulting in an L197P amino acid substitution in the Caspase-9 protein is corrected by contacting a nucleic acid encoding the mutant Caspase-9 protein with a Cas9:ADAT1 fusion protein (SEQ ID NO: 35 or 36) and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the sense strand of the encoding Caspase-9 gene. See, e.g., Lenk et al., PLoS Genetics. 2011; 7: e1002104, for a description of an exemplary Caspase-9 L197P mutation associated with neuroblastoma (NB). The T→C point mutation is confirmed via genomic PCR of the respective Caspase-9 genomic sequence, e.g., generation of a PCR amplicon of about 100-250 nucleotides around exon 197, and subsequent sequencing of the PCT amplicon.
Cells expressing the mutant Caspase-9 protein are contacted with an expression construct encoding the Cas9:ADAT1 fusion protein (SEQ ID NO: 35 or 36) and an appropriately designed sgRNA targeting the fusion protein to the mutation site in the sense strand of the encoding Caspase-9 gene. The cytosine deaminase activity of the Cas9:ADAT1 fusion protein results in deamination of the mutant cytosine in codon 197 to uridine, thus correcting the mutation. Genomic DNA of the treated cells is extracted and a PCR amplicon of 100-250 nucleotides is amplified with suitable PCR primers. The correction of the T→C point mutation in codon 197 of the Caspase-9 gene after treatment of the cells with the fusion protein is confirmed by sequencing the PCR amplicon.
Two dCas9-APOBEC1 fusion proteins with different linkers were generated:
MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSI
WRHTSQNTNKHVEVNFIEKFTTERYFCPNTRCSITWFLSWSPCGECSRAI
TEFLSRYPHVTLFIYIARLYHHADPRNRQGLRDLISSGVTIQIMTEQESG
YCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILGLPPCLNILRRKQ
PQLTFFTIALQSCHYQRLPPHILWATGLKGGSMDKKYSIGLAIGTNSVGW
AVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTA
RRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKKHERHPI
FGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIKFRGHF
LIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSK
SRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSK
DTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLS
ASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGYIDGGAS
QEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPHQIHLGE
LHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRFAWMTRK
SEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEYF
TVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDY
FKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILED
IVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLIN
GIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQVSGQGD
SLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIEMARENQ
TTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLYLYYLQN
GRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSD
NVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIK
RQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRK
DFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGDYKVYDV
RKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPLIETNGE
TGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILPKRNSDK
LIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGITI
MERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAG
ELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDE
IIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNL
GAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDLSQLGG
D;
MSSETGPVAVDPTLRRRIEPHEFEVFFDPRELRKETCLLYEINWGGRHSI
WRHTSQNTNKHVEVNFIEKFTTERYFCPNTRCSITWFLSWSPCGECSRAI
TEFLSRYPHVTLFIYIARLYHHADPRNRQGLRDLISSGVTIQIMTEQESG
YCWRNFVNYSPSNEAHWPRYPHLWVRLYVLELYCIILGLPPCLNILRRKQ
PQLTFFTIALQSCHYQRLPPHILWATGLKGGSGGSGGSMDKKYSIGLAIG
TNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEAT
RLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEESFLVEEDKK
HERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMI
KFRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAIL
SARLSKSRRLENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDA
KLQLSKDTYDDDLDNLLAQIGDQYADLFLAAKNLSDAILLSDILRVNTEI
TKAPLSASMIKRYDEHHQDLTLLKALVRQQLPEKYKEIFFDQSKNGYAGY
IDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLLRKQRTFDNGSIPH
QIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARGNSRF
AWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHS
LLYEYFTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVK
QLKEDYFKKIECFDSVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEEN
EDILEDIVLTLTLFEDREMIEERLKTYAHLFDDKVMKQLKRRRYTGWGRL
SRKLINGIRDKQSGKTILDFLKSDGFANRNFMQLIHDDSLTFKEDIQKAQ
VSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGRHKPENIVIE
MARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY
LYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDK
NRGKSDNVPSEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELD
KAGFIKRQLVETRQITKHVAQILDSRMNTKYDENDKLIREVKVITLKSKL
VSDFRKDFQFYKVREINNYHHAHDAYLNAVVGTALIKKYPKLESEFVYGD
YKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKTEITLANGEIRKRPL
IETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSKESILP
KRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKE
LLGITIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKR
MLASAGELQKGNELALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQH
KHYLDEIIEQISEFSKRVILADANLDKVLSAYNKHRDKPIREQAENIIHL
FTLTNLGAPAAFKYFDTTIDRKRYTSTKEVLDATLIHQSITGLYETRIDL
SQLGGD;
Deaminase activity of both fusion proteins were examined. A deaminase assay was adapted from Nuc. Acids Res. 2014, 42, p. 1095; J. Biol. Chem. 2004, 279, p 53379; J. Virology 2014, 88, p. 3850; and J. Virology 2006, 80, p. 5992, the entire contents of each of which are incorporated by reference.
Expression constructs encoding the fusion proteins were inserted into a CMV backbone plasmid (Addgene plasmid 52970; see Guilinger J P, Thompson D B, Liu D R. Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat. Biotechnol. 2014; 32(6): 577-82). The fusion proteins were expressed using a TNT Quick Coupled Transcription/Translation System (Promega). After 90 min, 5 μL of lysate was incubated with 5′-labeled ssDNA substrate (Cy3-ATTATTATTATTCCGCGGATTTATT TATTTATTTATTTATTT, SEQ ID NO: 96) and UDG (Uracil DNA Glycosylase) at 37° C. for 3 hr. A 1M solution of NaOH (10 μL) was then added to cleave the DNA at the abasic site. See
All publications, patents, patent applications, publication, and database entries (e.g., sequence database entries) mentioned herein, e.g., in the Background, Summary, Detailed Description, Examples, and/or References sections, are hereby incorporated by reference in their entirety as if each individual publication, patent, patent application, publication, and database entry was specifically and individually incorporated herein by reference. In case of conflict, the present application, including any definitions herein, will control.
Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents of the embodiments described herein. The scope of the present disclosure is not intended to be limited to the above description, but rather is as set forth in the appended claims.
Articles such as “a,” “an,” and “the” may mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between two or more members of a group are considered satisfied if one, more than one, or all of the group members are present, unless indicated to the contrary or otherwise evident from the context. The disclosure of a group that includes “or” between two or more group members provides embodiments in which exactly one member of the group is present, embodiments in which more than one members of the group are present, and embodiments in which all of the group members are present. For purposes of brevity those embodiments have not been individually spelled out herein, but it will be understood that each of these embodiments is provided herein and may be specifically claimed or disclaimed.
It is to be understood that the invention encompasses all variations, combinations, and permutations in which one or more limitation, element, clause, or descriptive term, from one or more of the claims or from one or more relevant portion of the description, is introduced into another claim. For example, a claim that is dependent on another claim can be modified to include one or more of the limitations found in any other claim that is dependent on the same base claim. Furthermore, where the claims recite a composition, it is to be understood that methods of making or using the composition according to any of the methods of making or using disclosed herein or according to methods known in the art, if any, are included, unless otherwise indicated or unless it would be evident to one of ordinary skill in the art that a contradiction or inconsistency would arise.
Where elements are presented as lists, e.g., in Markush group format, it is to be understood that every possible subgroup of the elements is also disclosed, and that any element or subgroup of elements can be removed from the group. It is also noted that the term “comprising” is intended to be open and permits the inclusion of additional elements or steps. It should be understood that, in general, where an embodiment, product, or method is referred to as comprising particular elements, features, or steps, embodiments, products, or methods that consist, or consist essentially of, such elements, features, or steps, are provided as well. For purposes of brevity those embodiments have not been individually spelled out herein, but it will be understood that each of these embodiments is provided herein and may be specifically claimed or disclaimed.
Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and/or the understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value within the stated ranges in some embodiments, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise. For purposes of brevity, the values in each range have not been individually spelled out herein, but it will be understood that each of these values is provided herein and may be specifically claimed or disclaimed. It is also to be understood that unless otherwise indicated or otherwise evident from the context and/or the understanding of one of ordinary skill in the art, values expressed as ranges can assume any subrange within the given range, wherein the endpoints of the subrange are expressed to the same degree of accuracy as the tenth of the unit of the lower limit of the range.
In addition, it is to be understood that any particular embodiment of the present invention may be explicitly excluded from any one or more of the claims. Where ranges are given, any value within the range may explicitly be excluded from any one or more of the claims. Any embodiment, element, feature, application, or aspect of the compositions and/or methods of the invention, can be excluded from any one or more claims. For purposes of brevity, all of the embodiments in which one or more elements, features, purposes, or aspects is excluded are not set forth explicitly herein.
This application is a national stage filing under 35 U.S.C. § 371 of international PCT application, PCT/US2014/070038, filed Dec. 12, 2014, which claims priority under 35 U.S.C. § 119(e) to U.S. provisional patent application, U.S. Ser. No. 61/915,386 filed Dec. 12, 2013, and U.S. provisional patent application, U.S. Ser. No. 61/980,333 filed Apr. 16, 2014; and also claims priority under 35 U.S.C. § 120 to U.S. patent applications, U.S. Ser. Nos. 14/325,815, 14/326,109, 14/326,140, 14/326,269, 14/326,290, 14/326,318, and 14/326,303, all filed on Jul. 8, 2014; each of which is incorporated herein by reference. This application is a continuation of and claims priority under 35 U.S.C. § 120 to U.S. patent applications, U.S. Ser. Nos. 14/325,815, 14/326,109, 14/326,140, 14/326,290, 14/326,318, and 14/326,303, all filed on Jul. 8, 2014, all of which claim priority under 35 U.S.C. § 119(e) to U.S. provisional patent application, U.S. Ser. No. 61/915,386, filed Dec. 12, 2013, and U.S. provisional patent application, U.S. Ser. No. 61/980,333 filed Apr. 16, 2014, each of which is incorporated herein by reference.
This invention was made with Government support under HR0011-11-2-0003 and N66001-12-C-4207 awarded by the Department of Defense, and under GM095501 awarded by the National Institutes of Health. The Government has certain rights in this invention.
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/US2014/070038 | 12/12/2014 | WO | 00 |
| Publishing Document | Publishing Date | Country | Kind |
|---|---|---|---|
| WO2015/089406 | 6/18/2015 | WO | A |
| Number | Name | Date | Kind |
|---|---|---|---|
| 4182449 | Kozlow | Jan 1980 | A |
| 4235871 | Papahadjopoulos et al. | Nov 1980 | A |
| 4880635 | Janoff et al. | Nov 1989 | A |
| 4906477 | Kurono et al. | Mar 1990 | A |
| 4911928 | Wallach | Mar 1990 | A |
| 4917951 | Wallach | Apr 1990 | A |
| 4920016 | Allen et al. | Apr 1990 | A |
| 4921757 | Wheatley et al. | May 1990 | A |
| 5139941 | Muzyczka et al. | Aug 1992 | A |
| 5449639 | Wei et al. | Sep 1995 | A |
| 5780053 | Ashley et al. | Jul 1998 | A |
| 5835699 | Kimura | Nov 1998 | A |
| 5962313 | Podsakoff et al. | Oct 1999 | A |
| 6057153 | George et al. | May 2000 | A |
| 6453242 | Eisenberg et al. | Sep 2002 | B1 |
| 6503717 | Case et al. | Jan 2003 | B2 |
| 6534261 | Cox, III et al. | Mar 2003 | B1 |
| 6599692 | Case et al. | Jul 2003 | B1 |
| 6607882 | Cox, III et al. | Aug 2003 | B1 |
| 6824978 | Cox, III et al. | Nov 2004 | B1 |
| 6933113 | Case et al. | Aug 2005 | B2 |
| 6979539 | Cox, III et al. | Dec 2005 | B2 |
| 7013219 | Case et al. | Mar 2006 | B2 |
| 7163824 | Cox, III et al. | Jan 2007 | B2 |
| 7479573 | Chu et al. | Jan 2009 | B2 |
| 7794931 | Breaker et al. | Sep 2010 | B2 |
| 7919277 | Russell et al. | Apr 2011 | B2 |
| 7993672 | Huang et al. | Aug 2011 | B2 |
| 8097648 | Littlefield et al. | Jan 2012 | B2 |
| 8361725 | Russell et al. | Jan 2013 | B2 |
| 8394604 | Liu et al. | Mar 2013 | B2 |
| 8492082 | De Franciscis et al. | Jul 2013 | B2 |
| 8546553 | Terns et al. | Oct 2013 | B2 |
| 8569256 | Heyes et al. | Oct 2013 | B2 |
| 8680069 | de Fougerolles et al. | Mar 2014 | B2 |
| 8691750 | Constien et al. | Apr 2014 | B2 |
| 8697359 | Zhang | Apr 2014 | B1 |
| 8709466 | Coady et al. | Apr 2014 | B2 |
| 8728526 | Heller | May 2014 | B2 |
| 8748667 | Budzik et al. | Jun 2014 | B2 |
| 8758810 | Okada et al. | Jun 2014 | B2 |
| 8759103 | Kim et al. | Jun 2014 | B2 |
| 8759104 | Unciti-Broceta et al. | Jun 2014 | B2 |
| 8771728 | Huang et al. | Jul 2014 | B2 |
| 8790664 | Pitard et al. | Jul 2014 | B2 |
| 8795965 | Zhang | Aug 2014 | B2 |
| 8846578 | McCray et al. | Sep 2014 | B2 |
| 8993233 | Zhang et al. | Mar 2015 | B2 |
| 8999641 | Zhang et al. | Apr 2015 | B2 |
| 9068179 | Liu | Jun 2015 | B1 |
| 9163284 | Liu et al. | Oct 2015 | B2 |
| 9228207 | Liu et al. | Jan 2016 | B2 |
| 9234213 | Wu | Jan 2016 | B2 |
| 9322006 | Liu et al. | Apr 2016 | B2 |
| 9322037 | Liu et al. | Apr 2016 | B2 |
| 9340799 | Liu et al. | May 2016 | B2 |
| 9340800 | Liu et al. | May 2016 | B2 |
| 9359599 | Liu et al. | Jun 2016 | B2 |
| 9388430 | Liu et al. | Jul 2016 | B2 |
| 9512446 | Joung et al. | Dec 2016 | B1 |
| 9526724 | Oshlack et al. | Dec 2016 | B2 |
| 9737604 | Liu et al. | Aug 2017 | B2 |
| 9816093 | Donohoue et al. | Nov 2017 | B1 |
| 9822372 | Zhang et al. | Nov 2017 | B2 |
| 9840690 | Karli et al. | Dec 2017 | B2 |
| 9840699 | Liu | Dec 2017 | B2 |
| 9840713 | Zhang | Dec 2017 | B2 |
| 9873907 | Zeiner et al. | Jan 2018 | B2 |
| 9879270 | Hittinger et al. | Jan 2018 | B2 |
| 9938288 | Kishi et al. | Apr 2018 | B1 |
| 9944933 | Storici et al. | Apr 2018 | B2 |
| 9982279 | Gill et al. | May 2018 | B1 |
| 9999671 | Liu et al. | Jun 2018 | B2 |
| 10059940 | Zhong | Aug 2018 | B2 |
| 10077453 | Liu et al. | Sep 2018 | B2 |
| 10113163 | Liu et al. | Oct 2018 | B2 |
| 10167457 | Liu et al. | Jan 2019 | B2 |
| 10227581 | Liu et al. | Mar 2019 | B2 |
| 20040003420 | Kuhn et al. | Jan 2004 | A1 |
| 20040115184 | Smith et al. | Jun 2004 | A1 |
| 20050222030 | Allison et al. | Oct 2005 | A1 |
| 20060088864 | Smolke et al. | Apr 2006 | A1 |
| 20060104984 | Littlefield et al. | May 2006 | A1 |
| 20060246568 | Honjo et al. | Nov 2006 | A1 |
| 20070264692 | Liu et al. | Nov 2007 | A1 |
| 20080124725 | Barrangou et al. | May 2008 | A1 |
| 20080182254 | Hall et al. | Jul 2008 | A1 |
| 20090130718 | Short | May 2009 | A1 |
| 20090234109 | Han et al. | Sep 2009 | A1 |
| 20100076057 | Sontheimer et al. | Mar 2010 | A1 |
| 20100093617 | Barrangou et al. | Apr 2010 | A1 |
| 20100104690 | Barrangou et al. | Apr 2010 | A1 |
| 20100316643 | Eckert et al. | Dec 2010 | A1 |
| 20110059160 | Essner et al. | Mar 2011 | A1 |
| 20110104787 | Church et al. | May 2011 | A1 |
| 20110189776 | Terns et al. | Aug 2011 | A1 |
| 20110217739 | Terns et al. | Sep 2011 | A1 |
| 20120129759 | Liu et al. | May 2012 | A1 |
| 20120141523 | Castado et al. | Jun 2012 | A1 |
| 20120244601 | Bertozzi et al. | Sep 2012 | A1 |
| 20120270273 | Zhang et al. | Oct 2012 | A1 |
| 20130117869 | Duchateau et al. | May 2013 | A1 |
| 20130130248 | Haurwitz et al. | May 2013 | A1 |
| 20130158245 | Russell et al. | Jun 2013 | A1 |
| 20130165389 | Schellenberger et al. | Jun 2013 | A1 |
| 20130309720 | Schultz et al. | Nov 2013 | A1 |
| 20130344117 | Mirosevich et al. | Dec 2013 | A1 |
| 20140004280 | Loomis | Jan 2014 | A1 |
| 20140005269 | Ngwuluka et al. | Jan 2014 | A1 |
| 20140017214 | Cost | Jan 2014 | A1 |
| 20140018404 | Chen et al. | Jan 2014 | A1 |
| 20140044793 | Goll et al. | Feb 2014 | A1 |
| 20140065711 | Liu et al. | Mar 2014 | A1 |
| 20140068797 | Doudna et al. | Mar 2014 | A1 |
| 20140127752 | Zhou et al. | May 2014 | A1 |
| 20140141094 | Smyth et al. | May 2014 | A1 |
| 20140141487 | Feldman et al. | May 2014 | A1 |
| 20140186843 | Zhang et al. | Jul 2014 | A1 |
| 20140186958 | Zhang et al. | Jul 2014 | A1 |
| 20140234289 | Liu et al. | Aug 2014 | A1 |
| 20140248702 | Cong | Sep 2014 | A1 |
| 20140273037 | Wu | Sep 2014 | A1 |
| 20140273226 | Wu | Sep 2014 | A1 |
| 20140273230 | Chen et al. | Sep 2014 | A1 |
| 20140295556 | Joung et al. | Oct 2014 | A1 |
| 20140295557 | Joung et al. | Oct 2014 | A1 |
| 20140342456 | Mali et al. | Nov 2014 | A1 |
| 20140342457 | Mali et al. | Nov 2014 | A1 |
| 20140342458 | Mali et al. | Nov 2014 | A1 |
| 20140349400 | Jakimo et al. | Nov 2014 | A1 |
| 20140356867 | Peter et al. | Dec 2014 | A1 |
| 20140356956 | Church et al. | Dec 2014 | A1 |
| 20140356958 | Mali et al. | Dec 2014 | A1 |
| 20140356959 | Church et al. | Dec 2014 | A1 |
| 20140357523 | Zeiner et al. | Dec 2014 | A1 |
| 20140377868 | Joung et al. | Dec 2014 | A1 |
| 20150010526 | Liu et al. | Jan 2015 | A1 |
| 20150031089 | Lindstrom | Jan 2015 | A1 |
| 20150031132 | Church et al. | Jan 2015 | A1 |
| 20150031133 | Church et al. | Jan 2015 | A1 |
| 20150044191 | Liu et al. | Feb 2015 | A1 |
| 20150044192 | Liu et al. | Feb 2015 | A1 |
| 20150044772 | Zhao | Feb 2015 | A1 |
| 20150050699 | Siksnys et al. | Feb 2015 | A1 |
| 20150056177 | Liu et al. | Feb 2015 | A1 |
| 20150056629 | Guthrie-Honea | Feb 2015 | A1 |
| 20150064138 | Lu et al. | Mar 2015 | A1 |
| 20150064789 | Paschon et al. | Mar 2015 | A1 |
| 20150071898 | Liu et al. | Mar 2015 | A1 |
| 20150071899 | Liu et al. | Mar 2015 | A1 |
| 20150071900 | Liu et al. | Mar 2015 | A1 |
| 20150071901 | Liu et al. | Mar 2015 | A1 |
| 20150071902 | Liu et al. | Mar 2015 | A1 |
| 20150071903 | Liu et al. | Mar 2015 | A1 |
| 20150071906 | Liu et al. | Mar 2015 | A1 |
| 20150079680 | Bradley et al. | Mar 2015 | A1 |
| 20150079681 | Zhang | Mar 2015 | A1 |
| 20150098954 | Hyde et al. | Apr 2015 | A1 |
| 20150118216 | Liu et al. | Apr 2015 | A1 |
| 20150132269 | Orkin et al. | May 2015 | A1 |
| 20150140664 | Byrne et al. | May 2015 | A1 |
| 20150159172 | Miller et al. | Jun 2015 | A1 |
| 20150165054 | Liu et al. | Jun 2015 | A1 |
| 20150166980 | Liu et al. | Jun 2015 | A1 |
| 20150166981 | Liu et al. | Jun 2015 | A1 |
| 20150166982 | Liu et al. | Jun 2015 | A1 |
| 20150166984 | Liu et al. | Jun 2015 | A1 |
| 20150166985 | Liu et al. | Jun 2015 | A1 |
| 20150191744 | Wolfe et al. | Jul 2015 | A1 |
| 20150197759 | Xu et al. | Jul 2015 | A1 |
| 20150211058 | Carstens et al. | Jul 2015 | A1 |
| 20150218573 | Loque et al. | Aug 2015 | A1 |
| 20150225773 | Farmer et al. | Aug 2015 | A1 |
| 20150252358 | Maeder et al. | Sep 2015 | A1 |
| 20150307889 | Petolino et al. | Oct 2015 | A1 |
| 20150315252 | Haugwitz et al. | Nov 2015 | A1 |
| 20160015682 | Cawthorne et al. | Jan 2016 | A2 |
| 20160017393 | Jacobson et al. | Jan 2016 | A1 |
| 20160017396 | Cann et al. | Jan 2016 | A1 |
| 20160032292 | Storici et al. | Feb 2016 | A1 |
| 20160032353 | Braman et al. | Feb 2016 | A1 |
| 20160046952 | Hittinger et al. | Feb 2016 | A1 |
| 20160046961 | Jinek et al. | Feb 2016 | A1 |
| 20160046962 | May et al. | Feb 2016 | A1 |
| 20160053272 | Wurtzel et al. | Feb 2016 | A1 |
| 20160053304 | Wurtzel et al. | Feb 2016 | A1 |
| 20160074535 | Ranganathan et al. | Mar 2016 | A1 |
| 20160076093 | Shendure et al. | Mar 2016 | A1 |
| 20160090603 | Carnes et al. | Mar 2016 | A1 |
| 20160090622 | Liu et al. | Mar 2016 | A1 |
| 20160115488 | Zhang et al. | Apr 2016 | A1 |
| 20160138046 | Wu et al. | May 2016 | A1 |
| 20160186214 | Brouns et al. | Jun 2016 | A1 |
| 20160200779 | Liu et al. | Jul 2016 | A1 |
| 20160201040 | Liu et al. | Jul 2016 | A1 |
| 20160201089 | Gersbach et al. | Jul 2016 | A1 |
| 20160206566 | Lu et al. | Jul 2016 | A1 |
| 20160208243 | Zhang et al. | Jul 2016 | A1 |
| 20160208288 | Liu et al. | Jul 2016 | A1 |
| 20160215275 | Zhong | Jul 2016 | A1 |
| 20160215276 | Liu et al. | Jul 2016 | A1 |
| 20160215300 | May et al. | Jul 2016 | A1 |
| 20160244784 | Jacobson et al. | Aug 2016 | A1 |
| 20160244829 | Bang et al. | Aug 2016 | A1 |
| 20160272965 | Zhang et al. | Sep 2016 | A1 |
| 20160281072 | Zhang | Sep 2016 | A1 |
| 20160304855 | Stark et al. | Oct 2016 | A1 |
| 20160312304 | Sorrentino et al. | Oct 2016 | A1 |
| 20160333389 | Liu et al. | Nov 2016 | A1 |
| 20160340662 | Zhang et al. | Nov 2016 | A1 |
| 20160345578 | Barrangou et al. | Dec 2016 | A1 |
| 20160346360 | Quake et al. | Dec 2016 | A1 |
| 20160346361 | Quake et al. | Dec 2016 | A1 |
| 20160346362 | Quake et al. | Dec 2016 | A1 |
| 20160348074 | Quake et al. | Dec 2016 | A1 |
| 20160350476 | Quake et al. | Dec 2016 | A1 |
| 20160369262 | Reik et al. | Dec 2016 | A1 |
| 20170009242 | McKinley et al. | Jan 2017 | A1 |
| 20170014449 | Bangera et al. | Jan 2017 | A1 |
| 20170020922 | Wagner et al. | Jan 2017 | A1 |
| 20170037432 | Donohoue et al. | Feb 2017 | A1 |
| 20170044520 | Liu et al. | Feb 2017 | A1 |
| 20170044592 | Peter et al. | Feb 2017 | A1 |
| 20170053729 | Kotani et al. | Feb 2017 | A1 |
| 20170058271 | Joung et al. | Mar 2017 | A1 |
| 20170058272 | Carter et al. | Mar 2017 | A1 |
| 20170058298 | Kennedy et al. | Mar 2017 | A1 |
| 20170073663 | Wang et al. | Mar 2017 | A1 |
| 20170087224 | Quake | Mar 2017 | A1 |
| 20170087225 | Quake | Mar 2017 | A1 |
| 20170088587 | Quake | Mar 2017 | A1 |
| 20170088828 | Quake | Mar 2017 | A1 |
| 20170107536 | Zhang et al. | Apr 2017 | A1 |
| 20170107560 | Peter et al. | Apr 2017 | A1 |
| 20170114367 | Hu et al. | Apr 2017 | A1 |
| 20170121693 | Liu et al. | May 2017 | A1 |
| 20170145394 | Yeo et al. | May 2017 | A1 |
| 20170145405 | Tang et al. | May 2017 | A1 |
| 20170145438 | Kantor | May 2017 | A1 |
| 20170152528 | Zhang | Jun 2017 | A1 |
| 20170152787 | Kubo et al. | Jun 2017 | A1 |
| 20170159033 | Kamtekar et al. | Jun 2017 | A1 |
| 20170166928 | Vyas et al. | Jun 2017 | A1 |
| 20170175104 | Doudna et al. | Jun 2017 | A1 |
| 20170175142 | Zhang et al. | Jun 2017 | A1 |
| 20170191047 | Terns et al. | Jul 2017 | A1 |
| 20170191078 | Zhang et al. | Jul 2017 | A1 |
| 20170198269 | Zhang et al. | Jul 2017 | A1 |
| 20170198277 | Kmiec et al. | Jul 2017 | A1 |
| 20170198302 | Feng et al. | Jul 2017 | A1 |
| 20170226522 | Hu et al. | Aug 2017 | A1 |
| 20170233703 | Xie et al. | Aug 2017 | A1 |
| 20170233756 | Begemann et al. | Aug 2017 | A1 |
| 20170247671 | Yung et al. | Aug 2017 | A1 |
| 20170247703 | Sloan et al. | Aug 2017 | A1 |
| 20170268022 | Liu et al. | Sep 2017 | A1 |
| 20170283797 | Robb et al. | Oct 2017 | A1 |
| 20170314016 | Kim et al. | Nov 2017 | A1 |
| 20170362635 | Chamberlain et al. | Dec 2017 | A1 |
| 20180064077 | Dunham et al. | Mar 2018 | A1 |
| 20180066258 | Powell | Mar 2018 | A1 |
| 20180068062 | Zhang et al. | Mar 2018 | A1 |
| 20180073012 | Liu et al. | Mar 2018 | A1 |
| 20180100147 | Yates et al. | Apr 2018 | A1 |
| 20180105867 | Xiao et al. | Apr 2018 | A1 |
| 20180119118 | Lu et al. | May 2018 | A1 |
| 20180127780 | Liu et al. | May 2018 | A1 |
| 20180155720 | Donohoue et al. | Jun 2018 | A1 |
| 20180163213 | Aneja et al. | Jun 2018 | A1 |
| 20180170984 | Harris et al. | Jun 2018 | A1 |
| 20180179503 | Maianti et al. | Jun 2018 | A1 |
| 20180179547 | Zhang et al. | Jun 2018 | A1 |
| 20180201921 | Malcolm | Jul 2018 | A1 |
| 20180230464 | Zhong | Aug 2018 | A1 |
| 20180230471 | Storici et al. | Aug 2018 | A1 |
| 20180236081 | Liu et al. | Aug 2018 | A1 |
| 20180237787 | Maianti et al. | Aug 2018 | A1 |
| 20180245066 | Yao et al. | Aug 2018 | A1 |
| 20180265864 | Li et al. | Sep 2018 | A1 |
| 20180273939 | Yu et al. | Sep 2018 | A1 |
| 20180282722 | Jakimo et al. | Oct 2018 | A1 |
| 20180305688 | Zhong | Oct 2018 | A1 |
| 20180305704 | Zhang | Oct 2018 | A1 |
| 20180312825 | Liu et al. | Nov 2018 | A1 |
| 20180312828 | Liu et al. | Nov 2018 | A1 |
| 20180312835 | Yao et al. | Nov 2018 | A1 |
| 20180327756 | Zhang et al. | Nov 2018 | A1 |
| 20190093099 | Liu et al. | Mar 2019 | A1 |
| Number | Date | Country |
|---|---|---|
| 2012244264 | Nov 2012 | AU |
| 2015252023 | Nov 2015 | AU |
| 2015101792 | Jan 2016 | AU |
| 112015013786 | Jul 2017 | BR |
| 2894668 | Jun 2014 | CA |
| 2894681 | Jun 2014 | CA |
| 2894684 | Jun 2014 | CA |
| 2 852 593 | Nov 2015 | CA |
| 1069962 | Mar 1993 | CN |
| 103224947 | Jul 2013 | CN |
| 103233028 | Aug 2013 | CN |
| 103388006 | Nov 2013 | CN |
| 103614415 | Mar 2014 | CN |
| 103642836 | Mar 2014 | CN |
| 103668472 | Mar 2014 | CN |
| 103820441 | May 2014 | CN |
| 103820454 | May 2014 | CN |
| 103911376 | Jul 2014 | CN |
| 103923911 | Jul 2014 | CN |
| 103981211 | Aug 2014 | CN |
| 103981212 | Aug 2014 | CN |
| 104004778 | Aug 2014 | CN |
| 104004782 | Aug 2014 | CN |
| 104017821 | Sep 2014 | CN |
| 104109687 | Oct 2014 | CN |
| 104178461 | Dec 2014 | CN |
| 104342457 | Feb 2015 | CN |
| 104404036 | Mar 2015 | CN |
| 104450774 | Mar 2015 | CN |
| 104480144 | Apr 2015 | CN |
| 104498493 | Apr 2015 | CN |
| 104504304 | Apr 2015 | CN |
| 104531704 | Apr 2015 | CN |
| 104531705 | Apr 2015 | CN |
| 104560864 | Apr 2015 | CN |
| 104561095 | Apr 2015 | CN |
| 104593418 | May 2015 | CN |
| 104593422 | May 2015 | CN |
| 104611370 | May 2015 | CN |
| 104651392 | May 2015 | CN |
| 104651398 | May 2015 | CN |
| 104651399 | May 2015 | CN |
| 104651401 | May 2015 | CN |
| 104673816 | Jun 2015 | CN |
| 104725626 | Jun 2015 | CN |
| 104726449 | Jun 2015 | CN |
| 104726494 | Jun 2015 | CN |
| 104745626 | Jul 2015 | CN |
| 104762321 | Jul 2015 | CN |
| 104805078 | Jul 2015 | CN |
| 104805099 | Jul 2015 | CN |
| 104805118 | Jul 2015 | CN |
| 104846010 | Aug 2015 | CN |
| 104894068 | Sep 2015 | CN |
| 104894075 | Sep 2015 | CN |
| 104928321 | Sep 2015 | CN |
| 105039339 | Nov 2015 | CN |
| 105039399 | Nov 2015 | CN |
| 105063061 | Nov 2015 | CN |
| 105087620 | Nov 2015 | CN |
| 105112422 | Dec 2015 | CN |
| 105112445 | Dec 2015 | CN |
| 105112519 | Dec 2015 | CN |
| 105121648 | Dec 2015 | CN |
| 105132427 | Dec 2015 | CN |
| 105132451 | Dec 2015 | CN |
| 105177038 | Dec 2015 | CN |
| 105177126 | Dec 2015 | CN |
| 105210981 | Jan 2016 | CN |
| 105219799 | Jan 2016 | CN |
| 105238806 | Jan 2016 | CN |
| 105255937 | Jan 2016 | CN |
| 105274144 | Jan 2016 | CN |
| 105296518 | Feb 2016 | CN |
| 105296537 | Feb 2016 | CN |
| 105316324 | Feb 2016 | CN |
| 105316327 | Feb 2016 | CN |
| 105316337 | Feb 2016 | CN |
| 105331607 | Feb 2016 | CN |
| 105331608 | Feb 2016 | CN |
| 105331609 | Feb 2016 | CN |
| 105331627 | Feb 2016 | CN |
| 105400773 | Mar 2016 | CN |
| 105400779 | Mar 2016 | CN |
| 105400810 | Mar 2016 | CN |
| 105441451 | Mar 2016 | CN |
| 105462968 | Apr 2016 | CN |
| 105463003 | Apr 2016 | CN |
| 105463027 | Apr 2016 | CN |
| 105492608 | Apr 2016 | CN |
| 105492609 | Apr 2016 | CN |
| 105505976 | Apr 2016 | CN |
| 105505979 | Apr 2016 | CN |
| 105518134 | Apr 2016 | CN |
| 105518135 | Apr 2016 | CN |
| 105518137 | Apr 2016 | CN |
| 105518138 | Apr 2016 | CN |
| 105518139 | Apr 2016 | CN |
| 105518140 | Apr 2016 | CN |
| 105543228 | May 2016 | CN |
| 105543266 | May 2016 | CN |
| 105543270 | May 2016 | CN |
| 105567688 | May 2016 | CN |
| 105567689 | May 2016 | CN |
| 105567734 | May 2016 | CN |
| 105567735 | May 2016 | CN |
| 105567738 | May 2016 | CN |
| 105593367 | May 2016 | CN |
| 105594664 | May 2016 | CN |
| 105602987 | May 2016 | CN |
| 105624146 | Jun 2016 | CN |
| 105624187 | Jun 2016 | CN |
| 105646719 | Jun 2016 | CN |
| 105647922 | Jun 2016 | CN |
| 105647962 | Jun 2016 | CN |
| 105647968 | Jun 2016 | CN |
| 105647969 | Jun 2016 | CN |
| 105671070 | Jun 2016 | CN |
| 105671083 | Jun 2016 | CN |
| 105695485 | Jun 2016 | CN |
| 105779448 | Jul 2016 | CN |
| 105779449 | Jul 2016 | CN |
| 105802980 | Jul 2016 | CN |
| 105821039 | Aug 2016 | CN |
| 105821040 | Aug 2016 | CN |
| 105821049 | Aug 2016 | CN |
| 105821072 | Aug 2016 | CN |
| 105821075 | Aug 2016 | CN |
| 105821116 | Aug 2016 | CN |
| 105838733 | Aug 2016 | CN |
| 105861547 | Aug 2016 | CN |
| 105861552 | Aug 2016 | CN |
| 105861554 | Aug 2016 | CN |
| 105886498 | Aug 2016 | CN |
| 105886534 | Aug 2016 | CN |
| 105886616 | Aug 2016 | CN |
| 105907758 | Aug 2016 | CN |
| 105907785 | Aug 2016 | CN |
| 105925608 | Sep 2016 | CN |
| 105950560 | Sep 2016 | CN |
| 105950626 | Sep 2016 | CN |
| 105950633 | Sep 2016 | CN |
| 105950639 | Sep 2016 | CN |
| 105985985 | Oct 2016 | CN |
| 106011104 | Oct 2016 | CN |
| 106011150 | Oct 2016 | CN |
| 106011167 | Oct 2016 | CN |
| 106011171 | Oct 2016 | CN |
| 106032540 | Oct 2016 | CN |
| 106047803 | Oct 2016 | CN |
| 106047877 | Oct 2016 | CN |
| 106047930 | Oct 2016 | CN |
| 106086008 | Nov 2016 | CN |
| 106086028 | Nov 2016 | CN |
| 106086061 | Nov 2016 | CN |
| 106086062 | Nov 2016 | CN |
| 106109417 | Nov 2016 | CN |
| 106119275 | Nov 2016 | CN |
| 106119283 | Nov 2016 | CN |
| 106148286 | Nov 2016 | CN |
| 106148370 | Nov 2016 | CN |
| 106148416 | Nov 2016 | CN |
| 106167525 | Nov 2016 | CN |
| 106167808 | Nov 2016 | CN |
| 106167810 | Nov 2016 | CN |
| 106167821 | Nov 2016 | CN |
| 106172238 | Dec 2016 | CN |
| 106190903 | Dec 2016 | CN |
| 106191057 | Dec 2016 | CN |
| 106191061 | Dec 2016 | CN |
| 106191062 | Dec 2016 | CN |
| 106191064 | Dec 2016 | CN |
| 106191071 | Dec 2016 | CN |
| 106191099 | Dec 2016 | CN |
| 106191107 | Dec 2016 | CN |
| 106191113 | Dec 2016 | CN |
| 106191114 | Dec 2016 | CN |
| 106191116 | Dec 2016 | CN |
| 106191124 | Dec 2016 | CN |
| 106222177 | Dec 2016 | CN |
| 106222193 | Dec 2016 | CN |
| 106222203 | Dec 2016 | CN |
| 106244555 | Dec 2016 | CN |
| 106244591 | Dec 2016 | CN |
| 106244609 | Dec 2016 | CN |
| 106282241 | Jan 2017 | CN |
| 106318934 | Jan 2017 | CN |
| 106318973 | Jan 2017 | CN |
| 106350540 | Jan 2017 | CN |
| 106367435 | Feb 2017 | CN |
| 106399306 | Feb 2017 | CN |
| 106399311 | Feb 2017 | CN |
| 106399360 | Feb 2017 | CN |
| 106399367 | Feb 2017 | CN |
| 106399375 | Feb 2017 | CN |
| 106399377 | Feb 2017 | CN |
| 106434651 | Feb 2017 | CN |
| 106434663 | Feb 2017 | CN |
| 106434688 | Feb 2017 | CN |
| 106434737 | Feb 2017 | CN |
| 106434748 | Feb 2017 | CN |
| 106434752 | Feb 2017 | CN |
| 106434782 | Feb 2017 | CN |
| 106446600 | Feb 2017 | CN |
| 106479985 | Mar 2017 | CN |
| 106480027 | Mar 2017 | CN |
| 106480036 | Mar 2017 | CN |
| 106480067 | Mar 2017 | CN |
| 106480080 | Mar 2017 | CN |
| 106480083 | Mar 2017 | CN |
| 106480097 | Mar 2017 | CN |
| 106544351 | Mar 2017 | CN |
| 106544353 | Mar 2017 | CN |
| 106544357 | Mar 2017 | CN |
| 106554969 | Apr 2017 | CN |
| 106566838 | Apr 2017 | CN |
| 106701763 | May 2017 | CN |
| 106701808 | May 2017 | CN |
| 106701818 | May 2017 | CN |
| 106701823 | May 2017 | CN |
| 106701830 | May 2017 | CN |
| 106754912 | May 2017 | CN |
| 106755026 | May 2017 | CN |
| 106755077 | May 2017 | CN |
| 106755088 | May 2017 | CN |
| 106755091 | May 2017 | CN |
| 106755097 | May 2017 | CN |
| 106755424 | May 2017 | CN |
| 106801056 | Jun 2017 | CN |
| 106834323 | Jun 2017 | CN |
| 106834341 | Jun 2017 | CN |
| 106834347 | Jun 2017 | CN |
| 106845151 | Jun 2017 | CN |
| 106868008 | Jun 2017 | CN |
| 106868031 | Jun 2017 | CN |
| 106906240 | Jun 2017 | CN |
| 106906242 | Jun 2017 | CN |
| 106916820 | Jul 2017 | CN |
| 106916852 | Jul 2017 | CN |
| 106939303 | Jul 2017 | CN |
| 106947750 | Jul 2017 | CN |
| 106947780 | Jul 2017 | CN |
| 106957830 | Jul 2017 | CN |
| 106957831 | Jul 2017 | CN |
| 106957844 | Jul 2017 | CN |
| 106957855 | Jul 2017 | CN |
| 106957858 | Jul 2017 | CN |
| 106967697 | Jul 2017 | CN |
| 106967726 | Jul 2017 | CN |
| 106978428 | Jul 2017 | CN |
| 106987570 | Jul 2017 | CN |
| 106987757 | Jul 2017 | CN |
| 107012164 | Aug 2017 | CN |
| 107012174 | Aug 2017 | CN |
| 107012213 | Aug 2017 | CN |
| 107012250 | Aug 2017 | CN |
| 107022562 | Aug 2017 | CN |
| 107034188 | Aug 2017 | CN |
| 107034218 | Aug 2017 | CN |
| 107034229 | Aug 2017 | CN |
| 107043775 | Aug 2017 | CN |
| 107043779 | Aug 2017 | CN |
| 107043787 | Aug 2017 | CN |
| 107058320 | Aug 2017 | CN |
| 107058328 | Aug 2017 | CN |
| 107058358 | Aug 2017 | CN |
| 107058372 | Aug 2017 | CN |
| 107083392 | Aug 2017 | CN |
| 107099533 | Aug 2017 | CN |
| 107099850 | Aug 2017 | CN |
| 107119053 | Sep 2017 | CN |
| 107119071 | Sep 2017 | CN |
| 107129999 | Sep 2017 | CN |
| 107130000 | Sep 2017 | CN |
| 107142272 | Sep 2017 | CN |
| 107142282 | Sep 2017 | CN |
| 107177591 | Sep 2017 | CN |
| 107177595 | Sep 2017 | CN |
| 107177631 | Sep 2017 | CN |
| 107190006 | Sep 2017 | CN |
| 107190008 | Sep 2017 | CN |
| 107217042 | Sep 2017 | CN |
| 107217075 | Sep 2017 | CN |
| 107227307 | Oct 2017 | CN |
| 107227352 | Oct 2017 | CN |
| 107236737 | Oct 2017 | CN |
| 107236739 | Oct 2017 | CN |
| 107236741 | Oct 2017 | CN |
| 107245502 | Oct 2017 | CN |
| 107254485 | Oct 2017 | CN |
| 107266541 | Oct 2017 | CN |
| 107267515 | Oct 2017 | CN |
| 107287245 | Oct 2017 | CN |
| 107298701 | Oct 2017 | CN |
| 107299114 | Oct 2017 | CN |
| 107304435 | Oct 2017 | CN |
| 107312785 | Nov 2017 | CN |
| 107312793 | Nov 2017 | CN |
| 107312795 | Nov 2017 | CN |
| 107312798 | Nov 2017 | CN |
| 107326042 | Nov 2017 | CN |
| 107326046 | Nov 2017 | CN |
| 107354156 | Nov 2017 | CN |
| 107354173 | Nov 2017 | CN |
| 107356793 | Nov 2017 | CN |
| 107362372 | Nov 2017 | CN |
| 107365786 | Nov 2017 | CN |
| 107365804 | Nov 2017 | CN |
| 107384894 | Nov 2017 | CN |
| 107384922 | Nov 2017 | CN |
| 107384926 | Nov 2017 | CN |
| 107400677 | Nov 2017 | CN |
| 107418974 | Dec 2017 | CN |
| 107435051 | Dec 2017 | CN |
| 107435069 | Dec 2017 | CN |
| 107446922 | Dec 2017 | CN |
| 107446923 | Dec 2017 | CN |
| 107446924 | Dec 2017 | CN |
| 107446932 | Dec 2017 | CN |
| 107446951 | Dec 2017 | CN |
| 107446954 | Dec 2017 | CN |
| 107460196 | Dec 2017 | CN |
| 107474129 | Dec 2017 | CN |
| 107475300 | Dec 2017 | CN |
| 107488649 | Dec 2017 | CN |
| 107502608 | Dec 2017 | CN |
| 107502618 | Dec 2017 | CN |
| 107513531 | Dec 2017 | CN |
| 107519492 | Dec 2017 | CN |
| 107523567 | Dec 2017 | CN |
| 107523583 | Dec 2017 | CN |
| 107541525 | Jan 2018 | CN |
| 107557373 | Jan 2018 | CN |
| 107557378 | Jan 2018 | CN |
| 107557381 | Jan 2018 | CN |
| 107557390 | Jan 2018 | CN |
| 107557393 | Jan 2018 | CN |
| 107557394 | Jan 2018 | CN |
| 107557455 | Jan 2018 | CN |
| 107574179 | Jan 2018 | CN |
| 107586777 | Jan 2018 | CN |
| 107586779 | Jan 2018 | CN |
| 107604003 | Jan 2018 | CN |
| 107619829 | Jan 2018 | CN |
| 107619837 | Jan 2018 | CN |
| 107630006 | Jan 2018 | CN |
| 107630041 | Jan 2018 | CN |
| 107630042 | Jan 2018 | CN |
| 107630043 | Jan 2018 | CN |
| 107641631 | Jan 2018 | CN |
| 107653256 | Feb 2018 | CN |
| 107686848 | Feb 2018 | CN |
| 206970581 | Feb 2018 | CN |
| 107760652 | Mar 2018 | CN |
| 107760663 | Mar 2018 | CN |
| 107760684 | Mar 2018 | CN |
| 107760715 | Mar 2018 | CN |
| 107784200 | Mar 2018 | CN |
| 107794272 | Mar 2018 | CN |
| 107794276 | Mar 2018 | CN |
| 107815463 | Mar 2018 | CN |
| 107828738 | Mar 2018 | CN |
| 107828794 | Mar 2018 | CN |
| 107828826 | Mar 2018 | CN |
| 107828874 | Mar 2018 | CN |
| 107858346 | Mar 2018 | CN |
| 107858373 | Mar 2018 | CN |
| 107880132 | Apr 2018 | CN |
| 107881184 | Apr 2018 | CN |
| 107893074 | Apr 2018 | CN |
| 107893075 | Apr 2018 | CN |
| 107893076 | Apr 2018 | CN |
| 107893080 | Apr 2018 | CN |
| 107893086 | Apr 2018 | CN |
| 107904261 | Apr 2018 | CN |
| 107937427 | Apr 2018 | CN |
| 107937432 | Apr 2018 | CN |
| 107937501 | Apr 2018 | CN |
| 107974466 | May 2018 | CN |
| 107988229 | May 2018 | CN |
| 107988246 | May 2018 | CN |
| 107988256 | May 2018 | CN |
| 107988268 | May 2018 | CN |
| 108018316 | May 2018 | CN |
| 108034656 | May 2018 | CN |
| 108048466 | May 2018 | CN |
| 108102940 | Jun 2018 | CN |
| 108103092 | Jun 2018 | CN |
| 108103098 | Jun 2018 | CN |
| 108103586 | Jun 2018 | CN |
| 108148835 | Jun 2018 | CN |
| 108148837 | Jun 2018 | CN |
| 108148873 | Jun 2018 | CN |
| 108192956 | Jun 2018 | CN |
| 108251423 | Jul 2018 | CN |
| 108251451 | Jul 2018 | CN |
| 108251452 | Jul 2018 | CN |
| 108342480 | Jul 2018 | CN |
| 108359691 | Aug 2018 | CN |
| 108359712 | Aug 2018 | CN |
| 108384784 | Aug 2018 | CN |
| 108396027 | Aug 2018 | CN |
| 108410877 | Aug 2018 | CN |
| 108410906 | Aug 2018 | CN |
| 108410907 | Aug 2018 | CN |
| 108410911 | Aug 2018 | CN |
| 108424931 | Aug 2018 | CN |
| 108441519 | Aug 2018 | CN |
| 108441520 | Aug 2018 | CN |
| 108486108 | Sep 2018 | CN |
| 108486111 | Sep 2018 | CN |
| 108486145 | Sep 2018 | CN |
| 108486146 | Sep 2018 | CN |
| 108486154 | Sep 2018 | CN |
| 108486159 | Sep 2018 | CN |
| 108486234 | Sep 2018 | CN |
| 108504657 | Sep 2018 | CN |
| 108504685 | Sep 2018 | CN |
| 108504693 | Sep 2018 | CN |
| 108546712 | Sep 2018 | CN |
| 108546717 | Sep 2018 | CN |
| 108546718 | Sep 2018 | CN |
| 108559730 | Sep 2018 | CN |
| 108559732 | Sep 2018 | CN |
| 108559745 | Sep 2018 | CN |
| 108559760 | Sep 2018 | CN |
| 108570479 | Sep 2018 | CN |
| 108588071 | Sep 2018 | CN |
| 108588123 | Sep 2018 | CN |
| 108588128 | Sep 2018 | CN |
| 108588182 | Sep 2018 | CN |
| 108610399 | Oct 2018 | CN |
| 108611364 | Oct 2018 | CN |
| 108624622 | Oct 2018 | CN |
| 108642053 | Oct 2018 | CN |
| 108642055 | Oct 2018 | CN |
| 108642077 | Oct 2018 | CN |
| 108642078 | Oct 2018 | CN |
| 108642090 | Oct 2018 | CN |
| 108690844 | Oct 2018 | CN |
| 108707604 | Oct 2018 | CN |
| 108707620 | Oct 2018 | CN |
| 108707621 | Oct 2018 | CN |
| 108707628 | Oct 2018 | CN |
| 108707629 | Oct 2018 | CN |
| 108715850 | Oct 2018 | CN |
| 108728476 | Nov 2018 | CN |
| 108728486 | Nov 2018 | CN |
| 108753772 | Nov 2018 | CN |
| 108753783 | Nov 2018 | CN |
| 108753813 | Nov 2018 | CN |
| 108753817 | Nov 2018 | CN |
| 108753832 | Nov 2018 | CN |
| 108753835 | Nov 2018 | CN |
| 108753836 | Nov 2018 | CN |
| 108795902 | Nov 2018 | CN |
| 108822217 | Nov 2018 | CN |
| 108823248 | Nov 2018 | CN |
| 108823249 | Nov 2018 | CN |
| 108823291 | Nov 2018 | CN |
| 108841845 | Nov 2018 | CN |
| 108853133 | Nov 2018 | CN |
| 108866093 | Nov 2018 | CN |
| 108893529 | Nov 2018 | CN |
| 108913664 | Nov 2018 | CN |
| 108913691 | Nov 2018 | CN |
| 108913714 | Nov 2018 | CN |
| 108913717 | Nov 2018 | CN |
| 208034188 | Nov 2018 | CN |
| 2 604 255 | Jun 2013 | EP |
| 2840140 | Feb 2015 | EP |
| 2 966 170 | Jan 2016 | EP |
| 3 009 511 | Apr 2016 | EP |
| 3031921 | Jun 2016 | EP |
| 3045537 | Jul 2016 | EP |
| 3144390 | Mar 2017 | EP |
| 3199632 | Aug 2017 | EP |
| 3216867 | Sep 2017 | EP |
| 3252160 | Dec 2017 | EP |
| 2 528 177 | Jan 2016 | GB |
| 2 531 454 | Apr 2016 | GB |
| 2531454 | Apr 2016 | GB |
| 2542653 | Mar 2017 | GB |
| 1208045 | Feb 2016 | HK |
| 2007-501626 | Feb 2007 | JP |
| 2008-515405 | May 2008 | JP |
| 2010-539929 | Dec 2010 | JP |
| 2011-081011 | Apr 2011 | JP |
| 2011-523353 | Aug 2011 | JP |
| 2012-525146 | Oct 2012 | JP |
| 2012-531909 | Dec 2012 | JP |
| 101584933 | Jan 2016 | KR |
| 20160133380 | Nov 2016 | KR |
| 20170037025 | Apr 2017 | KR |
| 20170037028 | Apr 2017 | KR |
| 101748575 | Jun 2017 | KR |
| 2018-0022465 | Mar 2018 | KR |
| 2016104674 | Aug 2017 | RU |
| 2634395 | Oct 2017 | RU |
| 2652899 | May 2018 | RU |
| 1608100 | Dec 2017 | TW |
| 2018-29773 | Aug 2018 | TW |
| WO 2001036452 | May 2001 | WO |
| WO 200138547 | May 2001 | WO |
| WO 2002059296 | Aug 2002 | WO |
| WO 2002068676 | Sep 2002 | WO |
| WO 2002103028 | Dec 2002 | WO |
| WO 2004007684 | Jan 2004 | WO |
| WO 2005014791 | Feb 2005 | WO |
| WO 2006002547 | Jan 2006 | WO |
| WO 2006042112 | Apr 2006 | WO |
| WO 2007025097 | Mar 2007 | WO |
| WO 2007136815 | Nov 2007 | WO |
| WO 2008108989 | Sep 2008 | WO |
| WO 2010011565 | Jan 2010 | WO |
| WO 2010011961 | Jan 2010 | WO |
| WO 2010054108 | May 2010 | WO |
| WO 2010054154 | May 2010 | WO |
| WO 2010068289 | Jun 2010 | WO |
| WO 2010075424 | Jul 2010 | WO |
| WO 2010102257 | Sep 2010 | WO |
| WO 2010129019 | Nov 2010 | WO |
| WO 2010129023 | Nov 2010 | WO |
| WO 2010132092 | Nov 2010 | WO |
| WO 2010144150 | Dec 2010 | WO |
| WO 2011002503 | Jan 2011 | WO |
| WO 2011017293 | Feb 2011 | WO |
| WO 2011053868 | May 2011 | WO |
| WO 2011053982 | May 2011 | WO |
| WO 2011075627 | Jun 2011 | WO |
| WO 2011091311 | Jul 2011 | WO |
| WO 2011109031 | Sep 2011 | WO |
| WO 2011143124 | Nov 2011 | WO |
| WO 2012054726 | Apr 2012 | WO |
| WO 2012065043 | May 2012 | WO |
| WO 2012125445 | Sep 2012 | WO |
| WO 2012138927 | Oct 2012 | WO |
| WO 2012149470 | Nov 2012 | WO |
| WO 2012158985 | Nov 2012 | WO |
| WO 2012158986 | Nov 2012 | WO |
| WO 2012164565 | Dec 2012 | WO |
| WO 2013012674 | Jan 2013 | WO |
| WO 2013013105 | Jan 2013 | WO |
| WO 2013047844 | Apr 2013 | WO |
| WO 2013066438 | May 2013 | WO |
| WO 2013098244 | Jul 2013 | WO |
| WO 2013119602 | Aug 2013 | WO |
| WO 2013126794 | Aug 2013 | WO |
| WO 2013130824 | Sep 2013 | WO |
| WO 2013141680 | Sep 2013 | WO |
| WO 2013142378 | Sep 2013 | WO |
| WO 2013142578 | Sep 2013 | WO |
| WO 2013142578 | Sep 2013 | WO |
| WO 2013160230 | Oct 2013 | WO |
| WO 2013166315 | Nov 2013 | WO |
| WO 2013169398 | Nov 2013 | WO |
| WO 2013169802 | Nov 2013 | WO |
| WO 2013176772 | Nov 2013 | WO |
| WO 2013176772 | Nov 2013 | WO |
| WO 2013176915 | Nov 2013 | WO |
| WO 2013176916 | Nov 2013 | WO |
| WO 2013181440 | Dec 2013 | WO |
| WO 2013186754 | Dec 2013 | WO |
| WO 2013188037 | Dec 2013 | WO |
| WO 2013188522 | Dec 2013 | WO |
| WO 2013188638 | Dec 2013 | WO |
| WO 2013192278 | Dec 2013 | WO |
| WO 2014005042 | Jan 2014 | WO |
| WO 2014011237 | Jan 2014 | WO |
| WO 2014011901 | Jan 2014 | WO |
| WO 2014018423 | Jan 2014 | WO |
| WO 2014020608 | Feb 2014 | WO |
| WO 2014022120 | Feb 2014 | WO |
| WO 2014022702 | Feb 2014 | WO |
| WO 2014022702 | Feb 2014 | WO |
| WO 2014036219 | Mar 2014 | WO |
| WO 2014039513 | Mar 2014 | WO |
| WO 2014039523 | Mar 2014 | WO |
| WO 2014039684 | Mar 2014 | WO |
| WO 2014039692 | Mar 2014 | WO |
| WO 2014039702 | Mar 2014 | WO |
| WO 2014039872 | Mar 2014 | WO |
| WO 2014039970 | Mar 2014 | WO |
| WO 2014041327 | Mar 2014 | WO |
| WO 2014043143 | Mar 2014 | WO |
| WO 2014047103 | Mar 2014 | WO |
| WO 2014059173 | Apr 2014 | WO |
| WO 2014059255 | Apr 2014 | WO |
| WO 2014065596 | May 2014 | WO |
| WO 2014066505 | May 2014 | WO |
| WO 2014068346 | May 2014 | WO |
| WO 2014070887 | May 2014 | WO |
| WO 2014071006 | May 2014 | WO |
| WO 2014071219 | May 2014 | WO |
| WO 2014071235 | May 2014 | WO |
| WO 2014072941 | May 2014 | WO |
| WO 2014081729 | May 2014 | WO |
| WO 2014081730 | May 2014 | WO |
| WO 2014081855 | May 2014 | WO |
| WO 2014082644 | Jun 2014 | WO |
| WO 2014085261 | Jun 2014 | WO |
| WO 2014085593 | Jun 2014 | WO |
| WO 2014085830 | Jun 2014 | WO |
| WO 2014089212 | Jun 2014 | WO |
| WO 2014089290 | Jun 2014 | WO |
| WO 2014089348 | Jun 2014 | WO |
| WO 2014089513 | Jun 2014 | WO |
| WO 2014089533 | Jun 2014 | WO |
| WO 2014089541 | Jun 2014 | WO |
| WO 2014093479 | Jun 2014 | WO |
| WO 2014093595 | Jun 2014 | WO |
| WO 2014093622 | Jun 2014 | WO |
| WO 2014093635 | Jun 2014 | WO |
| WO 2014093655 | Jun 2014 | WO |
| WO 2014093661 | Jun 2014 | WO |
| WO 2014093694 | Jun 2014 | WO |
| WO 2014093701 | Jun 2014 | WO |
| WO 2014093709 | Jun 2014 | WO |
| WO 2014093712 | Jun 2014 | WO |
| WO 2014093718 | Jun 2014 | WO |
| WO 2014093736 | Jun 2014 | WO |
| WO 2014093768 | Jun 2014 | WO |
| WO 2014093852 | Jun 2014 | WO |
| WO 2014096972 | Jun 2014 | WO |
| WO 2014099744 | Jun 2014 | WO |
| WO 2014099750 | Jun 2014 | WO |
| WO 2014104878 | Jul 2014 | WO |
| WO 2014110006 | Jul 2014 | WO |
| WO 2014110552 | Jul 2014 | WO |
| WO 2014113493 | Jul 2014 | WO |
| WO 2014123967 | Aug 2014 | WO |
| WO 2014124226 | Aug 2014 | WO |
| WO 2014125668 | Aug 2014 | WO |
| WO 2014127287 | Aug 2014 | WO |
| WO 2014128324 | Aug 2014 | WO |
| WO 2014128659 | Aug 2014 | WO |
| WO 2014130706 | Aug 2014 | WO |
| WO 2014130955 | Aug 2014 | WO |
| WO 2014131833 | Sep 2014 | WO |
| WO 2014138379 | Sep 2014 | WO |
| WO 2014143381 | Sep 2014 | WO |
| WO 2014144094 | Sep 2014 | WO |
| WO 2014144155 | Sep 2014 | WO |
| WO 2014144288 | Sep 2014 | WO |
| WO 2014144592 | Sep 2014 | WO |
| WO 2014144761 | Sep 2014 | WO |
| WO 2014144951 | Sep 2014 | WO |
| WO 2014145599 | Sep 2014 | WO |
| WO 2014145736 | Sep 2014 | WO |
| WO 2014150624 | Sep 2014 | WO |
| WO 2014152432 | Sep 2014 | WO |
| WO 2014153118 | Sep 2014 | WO |
| WO 2014153470 | Sep 2014 | WO |
| WO 2014161821 | Oct 2014 | WO |
| WO 2014164466 | Oct 2014 | WO |
| WO 2014165177 | Oct 2014 | WO |
| WO 2014165349 | Oct 2014 | WO |
| WO 2014165612 | Oct 2014 | WO |
| WO 2014165707 | Oct 2014 | WO |
| WO 2014165825 | Oct 2014 | WO |
| WO 2014172458 | Oct 2014 | WO |
| WO 2014172470 | Oct 2014 | WO |
| WO 2014172489 | Oct 2014 | WO |
| WO 2014173955 | Oct 2014 | WO |
| WO 2014182700 | Nov 2014 | WO |
| WO 2014183071 | Nov 2014 | WO |
| WO 2014184143 | Nov 2014 | WO |
| WO 2014184741 | Nov 2014 | WO |
| WO 2014184744 | Nov 2014 | WO |
| WO 2014186585 | Nov 2014 | WO |
| WO 2014186686 | Nov 2014 | WO |
| WO 2014190181 | Nov 2014 | WO |
| WO 2014191128 | Dec 2014 | WO |
| WO 2014191518 | Dec 2014 | WO |
| WO 2014191521 | Dec 2014 | WO |
| WO 2014191525 | Dec 2014 | WO |
| WO 2014191527 | Dec 2014 | WO |
| WO 2014193583 | Dec 2014 | WO |
| WO 2014194190 | Dec 2014 | WO |
| WO 2014197568 | Dec 2014 | WO |
| WO 2014197748 | Dec 2014 | WO |
| WO 2014199358 | Dec 2014 | WO |
| WO 2014200659 | Dec 2014 | WO |
| WO 2014201015 | Dec 2014 | WO |
| WO 2014204578 | Dec 2014 | WO |
| WO 2014204723 | Dec 2014 | WO |
| WO 2014204724 | Dec 2014 | WO |
| WO 2014204725 | Dec 2014 | WO |
| WO 2014204726 | Dec 2014 | WO |
| WO 2014204727 | Dec 2014 | WO |
| WO 2014204728 | Dec 2014 | WO |
| WO 2014204729 | Dec 2014 | WO |
| WO 2014205192 | Dec 2014 | WO |
| WO 2014207043 | Dec 2014 | WO |
| WO 2015002780 | Jan 2015 | WO |
| WO 2015004241 | Jan 2015 | WO |
| WO 2015006290 | Jan 2015 | WO |
| WO 2015006294 | Jan 2015 | WO |
| WO 2015006437 | Jan 2015 | WO |
| WO 2015006498 | Jan 2015 | WO |
| WO 2015006747 | Jan 2015 | WO |
| WO 2015007194 | Jan 2015 | WO |
| WO 2015010114 | Jan 2015 | WO |
| WO 2015011483 | Jan 2015 | WO |
| WO 2015013583 | Jan 2015 | WO |
| WO 2015017866 | Feb 2015 | WO |
| WO 2015018503 | Feb 2015 | WO |
| WO 2015021353 | Feb 2015 | WO |
| WO 2015021426 | Feb 2015 | WO |
| WO 2015021990 | Feb 2015 | WO |
| WO 2015024017 | Feb 2015 | WO |
| WO 2015024986 | Feb 2015 | WO |
| WO 2015026883 | Feb 2015 | WO |
| WO 2015026885 | Feb 2015 | WO |
| WO 2015026886 | Feb 2015 | WO |
| WO 2015026887 | Feb 2015 | WO |
| WO 2015027134 | Feb 2015 | WO |
| WO 2015028969 | Mar 2015 | WO |
| WO 2015030881 | Mar 2015 | WO |
| WO 2015031619 | Mar 2015 | WO |
| WO 2015031775 | Mar 2015 | WO |
| WO 2015032494 | Mar 2015 | WO |
| WO 2015033293 | Mar 2015 | WO |
| WO 2015034872 | Mar 2015 | WO |
| WO 2015034885 | Mar 2015 | WO |
| WO 2015035136 | Mar 2015 | WO |
| WO 2015035139 | Mar 2015 | WO |
| WO 2015035162 | Mar 2015 | WO |
| WO 2015040075 | Mar 2015 | WO |
| WO 2015040402 | Mar 2015 | WO |
| WO 2015042585 | Mar 2015 | WO |
| WO 2015048577 | Apr 2015 | WO |
| WO 2015048690 | Apr 2015 | WO |
| WO 2015048707 | Apr 2015 | WO |
| WO 2015049897 | Apr 2015 | WO |
| WO 2015051191 | Apr 2015 | WO |
| WO 2015052133 | Apr 2015 | WO |
| WO 2015052231 | Apr 2015 | WO |
| WO 2015052335 | Apr 2015 | WO |
| WO 2015053995 | Apr 2015 | WO |
| WO 2015054253 | Apr 2015 | WO |
| WO 2015054315 | Apr 2015 | WO |
| WO 2015057671 | Apr 2015 | WO |
| WO 2015057834 | Apr 2015 | WO |
| WO 2015057852 | Apr 2015 | WO |
| WO 2015057976 | Apr 2015 | WO |
| WO 2015057980 | Apr 2015 | WO |
| WO 2015059265 | Apr 2015 | WO |
| WO 2015065964 | May 2015 | WO |
| WO 2015066119 | May 2015 | WO |
| WO 2015066634 | May 2015 | WO |
| WO 2015066636 | May 2015 | WO |
| WO 2015066637 | May 2015 | WO |
| WO 2015066638 | May 2015 | WO |
| WO 2015066643 | May 2015 | WO |
| WO 2015069682 | May 2015 | WO |
| WO 2015070083 | May 2015 | WO |
| WO 2015070193 | May 2015 | WO |
| WO 2015070212 | May 2015 | WO |
| WO 2015071474 | May 2015 | WO |
| WO 2015073683 | May 2015 | WO |
| WO 2015073867 | May 2015 | WO |
| WO 2015073990 | May 2015 | WO |
| WO 2015075056 | May 2015 | WO |
| WO 2015075154 | May 2015 | WO |
| WO 2015075175 | May 2015 | WO |
| WO 2015075195 | May 2015 | WO |
| WO 2015075557 | May 2015 | WO |
| WO 2015077058 | May 2015 | WO |
| WO 2015077290 | May 2015 | WO |
| WO 2015077318 | May 2015 | WO |
| WO 2015079056 | Jun 2015 | WO |
| WO 2015079057 | Jun 2015 | WO |
| WO 2015086795 | Jun 2015 | WO |
| WO 2015086798 | Jun 2015 | WO |
| WO 2015088643 | Jun 2015 | WO |
| WO 2015089046 | Jun 2015 | WO |
| WO 2015089077 | Jun 2015 | WO |
| WO 2015089277 | Jun 2015 | WO |
| WO 2015089351 | Jun 2015 | WO |
| WO 2015089354 | Jun 2015 | WO |
| WO 2015089364 | Jun 2015 | WO |
| WO 2015089406 | Jun 2015 | WO |
| WO 2015089419 | Jun 2015 | WO |
| WO 2015089427 | Jun 2015 | WO |
| WO 2015089462 | Jun 2015 | WO |
| WO 2015089465 | Jun 2015 | WO |
| WO 2015089473 | Jun 2015 | WO |
| WO 2015089486 | Jun 2015 | WO |
| WO 2015095804 | Jun 2015 | WO |
| WO 2015099850 | Jul 2015 | WO |
| WO 2015100929 | Jul 2015 | WO |
| WO 2015103057 | Jul 2015 | WO |
| WO 2015103153 | Jul 2015 | WO |
| WO 2015105928 | Jul 2015 | WO |
| WO 2015108993 | Jul 2015 | WO |
| WO 2015109752 | Jul 2015 | WO |
| WO 2015110474 | Jul 2015 | WO |
| WO 2015112790 | Jul 2015 | WO |
| WO 2015112896 | Jul 2015 | WO |
| WO 2015113063 | Jul 2015 | WO |
| WO 2015114365 | Aug 2015 | WO |
| WO 2015115903 | Aug 2015 | WO |
| WO 2015116686 | Aug 2015 | WO |
| WO 2015116969 | Aug 2015 | WO |
| WO 2015117021 | Aug 2015 | WO |
| WO 2015117041 | Aug 2015 | WO |
| WO 2015117081 | Aug 2015 | WO |
| WO 2015118156 | Aug 2015 | WO |
| WO 2015119941 | Aug 2015 | WO |
| WO 2015121454 | Aug 2015 | WO |
| WO 2015122967 | Aug 2015 | WO |
| WO 2015123339 | Aug 2015 | WO |
| WO 2015124715 | Aug 2015 | WO |
| WO 2015124718 | Aug 2015 | WO |
| WO 2015126927 | Aug 2015 | WO |
| WO 2015127428 | Aug 2015 | WO |
| WO 2015127439 | Aug 2015 | WO |
| WO 2015129686 | Sep 2015 | WO |
| WO 2015131101 | Sep 2015 | WO |
| WO 2015133554 | Sep 2015 | WO |
| WO 2015134812 | Sep 2015 | WO |
| WO 2015136001 | Sep 2015 | WO |
| WO 2015138510 | Sep 2015 | WO |
| WO 2015138739 | Sep 2015 | WO |
| WO 2015138855 | Sep 2015 | WO |
| WO 2015138870 | Sep 2015 | WO |
| WO 2015139008 | Sep 2015 | WO |
| WO 2015139139 | Sep 2015 | WO |
| WO 2015143046 | Sep 2015 | WO |
| WO 2015143177 | Sep 2015 | WO |
| WO 2015145417 | Oct 2015 | WO |
| WO 2015148431 | Oct 2015 | WO |
| WO 2015148670 | Oct 2015 | WO |
| WO 2015148680 | Oct 2015 | WO |
| WO 2015148761 | Oct 2015 | WO |
| WO 2015148860 | Oct 2015 | WO |
| WO 2015148863 | Oct 2015 | WO |
| WO 2015153760 | Oct 2015 | WO |
| WO 2015153780 | Oct 2015 | WO |
| WO 2015153789 | Oct 2015 | WO |
| WO 2015153791 | Oct 2015 | WO |
| WO 2015153889 | Oct 2015 | WO |
| WO 2015153940 | Oct 2015 | WO |
| WO 2015155341 | Oct 2015 | WO |
| WO 2015155686 | Oct 2015 | WO |
| WO 2015157070 | Oct 2015 | WO |
| WO 2015157534 | Oct 2015 | WO |
| WO 2015159068 | Oct 2015 | WO |
| WO 2015159086 | Oct 2015 | WO |
| WO 2015159087 | Oct 2015 | WO |
| WO 2015160683 | Oct 2015 | WO |
| WO 2015161276 | Oct 2015 | WO |
| WO 2015163733 | Oct 2015 | WO |
| WO 2015164740 | Oct 2015 | WO |
| WO 2015164748 | Oct 2015 | WO |
| WO 2015165274 | Nov 2015 | WO |
| WO 2015165275 | Nov 2015 | WO |
| WO 2015165276 | Nov 2015 | WO |
| WO 2015166272 | Nov 2015 | WO |
| WO 2015167766 | Nov 2015 | WO |
| WO 2015167956 | Nov 2015 | WO |
| WO 2015168125 | Nov 2015 | WO |
| WO 2015168158 | Nov 2015 | WO |
| WO 2015168404 | Nov 2015 | WO |
| WO 2015168547 | Nov 2015 | WO |
| WO 2015168800 | Nov 2015 | WO |
| WO 2015171603 | Nov 2015 | WO |
| WO 2015171894 | Nov 2015 | WO |
| WO 2015171932 | Nov 2015 | WO |
| WO 2015172128 | Nov 2015 | WO |
| WO 2015173436 | Nov 2015 | WO |
| WO 2015175642 | Nov 2015 | WO |
| WO 2015179540 | Nov 2015 | WO |
| WO 2015183025 | Dec 2015 | WO |
| WO 2015183026 | Dec 2015 | WO |
| WO 2015183885 | Dec 2015 | WO |
| WO 2015184259 | Dec 2015 | WO |
| WO 2015184262 | Dec 2015 | WO |
| WO 2015184268 | Dec 2015 | WO |
| WO 2015188056 | Dec 2015 | WO |
| WO 2015188065 | Dec 2015 | WO |
| WO 2015188094 | Dec 2015 | WO |
| WO 2015188109 | Dec 2015 | WO |
| WO 2015188132 | Dec 2015 | WO |
| WO 2015188135 | Dec 2015 | WO |
| WO 2015188191 | Dec 2015 | WO |
| WO 2015189693 | Dec 2015 | WO |
| WO 2015191693 | Dec 2015 | WO |
| WO 2015191899 | Dec 2015 | WO |
| WO 2015191911 | Dec 2015 | WO |
| WO 2015193858 | Dec 2015 | WO |
| WO 2015195547 | Dec 2015 | WO |
| WO 2015195621 | Dec 2015 | WO |
| WO 2015195798 | Dec 2015 | WO |
| WO 2015198020 | Dec 2015 | WO |
| WO 2015200334 | Dec 2015 | WO |
| WO 2015200378 | Dec 2015 | WO |
| WO 2015200555 | Dec 2015 | WO |
| WO 2015200805 | Dec 2015 | WO |
| WO 2016001978 | Jan 2016 | WO |
| WO 2016004010 | Jan 2016 | WO |
| WO 2016007347 | Jan 2016 | WO |
| WO 2016007604 | Jan 2016 | WO |
| WO 2016007948 | Jan 2016 | WO |
| WO 2016011080 | Jan 2016 | WO |
| WO 2016011210 | Jan 2016 | WO |
| WO 2016011428 | Jan 2016 | WO |
| WO 2016012544 | Jan 2016 | WO |
| WO 2016012552 | Jan 2016 | WO |
| WO 2016014409 | Jan 2016 | WO |
| WO 2016014565 | Jan 2016 | WO |
| WO 2016014794 | Jan 2016 | WO |
| WO 2016014837 | Jan 2016 | WO |
| WO 2016016119 | Feb 2016 | WO |
| WO 2016016358 | Feb 2016 | WO |
| WO 2016019144 | Feb 2016 | WO |
| WO 2016020399 | Feb 2016 | WO |
| WO 2016021972 | Feb 2016 | WO |
| WO 2016021973 | Feb 2016 | WO |
| WO 2016022363 | Feb 2016 | WO |
| WO 2016022866 | Feb 2016 | WO |
| WO 2016022931 | Feb 2016 | WO |
| WO 2016025131 | Feb 2016 | WO |
| WO 2016025469 | Feb 2016 | WO |
| WO 2016025759 | Feb 2016 | WO |
| WO 2016026444 | Feb 2016 | WO |
| WO 2016028682 | Feb 2016 | WO |
| WO 2016028843 | Feb 2016 | WO |
| WO 2016028887 | Feb 2016 | WO |
| WO 2016033088 | Mar 2016 | WO |
| WO 2016033230 | Mar 2016 | WO |
| WO 2016033246 | Mar 2016 | WO |
| WO 2016033298 | Mar 2016 | WO |
| WO 2016035044 | Mar 2016 | WO |
| WO 2016036754 | Mar 2016 | WO |
| WO 2016037157 | Mar 2016 | WO |
| WO 2016040030 | Mar 2016 | WO |
| WO 2016040594 | Mar 2016 | WO |
| WO 2016044182 | Mar 2016 | WO |
| WO 2016044416 | Mar 2016 | WO |
| WO 2016046635 | Mar 2016 | WO |
| WO 2016049024 | Mar 2016 | WO |
| WO 2016049163 | Mar 2016 | WO |
| WO 2016049230 | Mar 2016 | WO |
| WO 2016049251 | Mar 2016 | WO |
| WO 2016049258 | Mar 2016 | WO |
| WO 2015048801 | Apr 2016 | WO |
| WO 2016053397 | Apr 2016 | WO |
| WO 2016054326 | Apr 2016 | WO |
| WO 2016057061 | Apr 2016 | WO |
| WO 2016057821 | Apr 2016 | WO |
| WO 2016057835 | Apr 2016 | WO |
| WO 2016057850 | Apr 2016 | WO |
| WO 2016057951 | Apr 2016 | WO |
| WO 2016057961 | Apr 2016 | WO |
| WO 2016061073 | Apr 2016 | WO |
| WO 2016061374 | Apr 2016 | WO |
| WO 2016061481 | Apr 2016 | WO |
| WO 2016061523 | Apr 2016 | WO |
| WO 2016064894 | Apr 2016 | WO |
| WO 2016069282 | May 2016 | WO |
| WO 2016069283 | May 2016 | WO |
| WO 2016069591 | May 2016 | WO |
| WO 2016069910 | May 2016 | WO |
| WO 2016069912 | May 2016 | WO |
| WO 2016070037 | May 2016 | WO |
| WO 2016070070 | May 2016 | WO |
| WO 2016070129 | May 2016 | WO |
| WO 2016072399 | May 2016 | WO |
| WO 2016072936 | May 2016 | WO |
| WO 2016073433 | May 2016 | WO |
| WO 2016073559 | May 2016 | WO |
| WO 2016073990 | May 2016 | WO |
| WO 2016075662 | May 2016 | WO |
| WO 2016076672 | May 2016 | WO |
| WO 2016077273 | May 2016 | WO |
| WO 2016077350 | May 2016 | WO |
| WO 2016080097 | May 2016 | WO |
| WO 2016080795 | May 2016 | WO |
| WO 2016081923 | May 2016 | WO |
| WO 2016081924 | May 2016 | WO |
| WO 2016082135 | Jun 2016 | WO |
| WO 2016083811 | Jun 2016 | WO |
| WO 2016084084 | Jun 2016 | WO |
| WO 2016084088 | Jun 2016 | WO |
| WO 2016086177 | Jun 2016 | WO |
| WO 2016089433 | Jun 2016 | WO |
| WO 2016089866 | Jun 2016 | WO |
| WO 2016089883 | Jun 2016 | WO |
| WO 2016090385 | Jun 2016 | WO |
| WO 2016094679 | Jun 2016 | WO |
| WO 2016094845 | Jun 2016 | WO |
| WO 2016094867 | Jun 2016 | WO |
| WO 2016094872 | Jun 2016 | WO |
| WO 2016094874 | Jun 2016 | WO |
| WO 2016094880 | Jun 2016 | WO |
| WO 2016094888 | Jun 2016 | WO |
| WO 2016097212 | Jun 2016 | WO |
| WO 2016097231 | Jun 2016 | WO |
| WO 2016097751 | Jun 2016 | WO |
| WO 2016099887 | Jun 2016 | WO |
| WO 2016100272 | Jun 2016 | WO |
| WO 2016100389 | Jun 2016 | WO |
| WO 2016100568 | Jun 2016 | WO |
| WO 2016100571 | Jun 2016 | WO |
| WO 2016100951 | Jun 2016 | WO |
| WO 2016100955 | Jun 2016 | WO |
| WO 2016100974 | Jun 2016 | WO |
| WO 2016103233 | Jun 2016 | WO |
| WO 2016104716 | Jun 2016 | WO |
| WO 2016106236 | Jun 2016 | WO |
| WO 2016106239 | Jun 2016 | WO |
| WO 2016106244 | Jun 2016 | WO |
| WO 2016106338 | Jun 2016 | WO |
| WO 2016108926 | Jul 2016 | WO |
| WO 2016109255 | Jul 2016 | WO |
| WO 2016109840 | Jul 2016 | WO |
| WO 2016110214 | Jul 2016 | WO |
| WO 2016110453 | Jul 2016 | WO |
| WO 2016110511 | Jul 2016 | WO |
| WO 2016110512 | Jul 2016 | WO |
| WO 2016111546 | Jul 2016 | WO |
| WO 2016112242 | Jul 2016 | WO |
| WO 2016112351 | Jul 2016 | WO |
| WO 2016112963 | Jul 2016 | WO |
| WO 2016114972 | Jul 2016 | WO |
| WO 2016115179 | Jul 2016 | WO |
| WO 2016115326 | Jul 2016 | WO |
| WO 2016115355 | Jul 2016 | WO |
| WO 2016116032 | Jul 2016 | WO |
| WO 2016120480 | Aug 2016 | WO |
| WO 2016123071 | Aug 2016 | WO |
| WO 2016123230 | Aug 2016 | WO |
| WO 2016123243 | Aug 2016 | WO |
| WO 2016123578 | Aug 2016 | WO |
| WO 2016126747 | Aug 2016 | WO |
| WO 2016130600 | Aug 2016 | WO |
| WO 2016130697 | Aug 2016 | WO |
| WO 2016131009 | Aug 2016 | WO |
| WO 2016132122 | Aug 2016 | WO |
| WO 2016133165 | Aug 2016 | WO |
| WO 2016135507 | Sep 2016 | WO |
| WO 2016135557 | Sep 2016 | WO |
| WO 2016135558 | Sep 2016 | WO |
| WO 2016135559 | Sep 2016 | WO |
| WO 2016137774 | Sep 2016 | WO |
| WO 2016137949 | Sep 2016 | WO |
| WO 2016141224 | Sep 2016 | WO |
| WO 2016141893 | Sep 2016 | WO |
| WO 2016142719 | Sep 2016 | WO |
| WO 2016145150 | Sep 2016 | WO |
| WO 2016148994 | Sep 2016 | WO |
| WO 2016149484 | Sep 2016 | WO |
| WO 2016149547 | Sep 2016 | WO |
| WO 2016150336 | Sep 2016 | WO |
| WO 2016150855 | Sep 2016 | WO |
| WO 2016154016 | Sep 2016 | WO |
| WO 2016154579 | Sep 2016 | WO |
| WO 2016154596 | Sep 2016 | WO |
| WO 2016155482 | Oct 2016 | WO |
| WO 2016161004 | Oct 2016 | WO |
| WO 2016161207 | Oct 2016 | WO |
| WO 2016161260 | Oct 2016 | WO |
| WO 2016161380 | Oct 2016 | WO |
| WO 2016161446 | Oct 2016 | WO |
| WO 2016164356 | Oct 2016 | WO |
| WO 2016164797 | Oct 2016 | WO |
| WO 2016166340 | Oct 2016 | WO |
| WO 2016167300 | Oct 2016 | WO |
| WO 2016170484 | Oct 2016 | WO |
| WO 2016172359 | Oct 2016 | WO |
| WO 2016172727 | Oct 2016 | WO |
| WO 2016174056 | Nov 2016 | WO |
| WO 2016174151 | Nov 2016 | WO |
| WO 2016174250 | Nov 2016 | WO |
| WO 2016176191 | Nov 2016 | WO |
| WO 2016176404 | Nov 2016 | WO |
| WO 2016176690 | Nov 2016 | WO |
| WO 2016177682 | Nov 2016 | WO |
| WO 2016178207 | Nov 2016 | WO |
| WO 2016179038 | Nov 2016 | WO |
| WO 2016179112 | Nov 2016 | WO |
| WO 2016181357 | Nov 2016 | WO |
| WO 2016182893 | Nov 2016 | WO |
| WO 2016182917 | Nov 2016 | WO |
| WO 2016182959 | Nov 2016 | WO |
| WO 2016183236 | Nov 2016 | WO |
| WO 2016183298 | Nov 2016 | WO |
| WO 2016183345 | Nov 2016 | WO |
| WO 2016183402 | Nov 2016 | WO |
| WO 2016183438 | Nov 2016 | WO |
| WO 2016183448 | Nov 2016 | WO |
| WO 2016184955 | Nov 2016 | WO |
| WO 2016184989 | Nov 2016 | WO |
| WO 2016185411 | Nov 2016 | WO |
| WO 2016186745 | Nov 2016 | WO |
| WO 2016186772 | Nov 2016 | WO |
| WO 2016186946 | Nov 2016 | WO |
| WO 2016186953 | Nov 2016 | WO |
| WO 2016187717 | Dec 2016 | WO |
| WO 2016187904 | Dec 2016 | WO |
| WO 2016191684 | Dec 2016 | WO |
| WO 2016191869 | Dec 2016 | WO |
| WO 2016196273 | Dec 2016 | WO |
| WO 2016196282 | Dec 2016 | WO |
| WO 2016196308 | Dec 2016 | WO |
| WO 2016196361 | Dec 2016 | WO |
| WO 2016196499 | Dec 2016 | WO |
| WO 2016196539 | Dec 2016 | WO |
| WO 2016196655 | Dec 2016 | WO |
| WO 2016196805 | Dec 2016 | WO |
| WO 2016196887 | Dec 2016 | WO |
| WO 2016197132 | Dec 2016 | WO |
| WO 2016197133 | Dec 2016 | WO |
| WO 2016197354 | Dec 2016 | WO |
| WO 2016197355 | Dec 2016 | WO |
| WO 2016197356 | Dec 2016 | WO |
| WO 2016197357 | Dec 2016 | WO |
| WO 2016197358 | Dec 2016 | WO |
| WO 2016197359 | Dec 2016 | WO |
| WO 2016197360 | Dec 2016 | WO |
| WO 2016197361 | Dec 2016 | WO |
| WO 2016197362 | Dec 2016 | WO |
| WO 2016198361 | Dec 2016 | WO |
| WO 2016198500 | Dec 2016 | WO |
| WO 2016200263 | Dec 2016 | WO |
| WO 2016201047 | Dec 2016 | WO |
| WO 2016201138 | Dec 2016 | WO |
| WO 2016201152 | Dec 2016 | WO |
| WO 2016201153 | Dec 2016 | WO |
| WO 2016201155 | Dec 2016 | WO |
| WO 2016205276 | Dec 2016 | WO |
| WO 2016205613 | Dec 2016 | WO |
| WO 2016205623 | Dec 2016 | WO |
| WO 2016205680 | Dec 2016 | WO |
| WO 2016205688 | Dec 2016 | WO |
| WO 2016205703 | Dec 2016 | WO |
| WO 2016205711 | Dec 2016 | WO |
| WO 2016205728 | Dec 2016 | WO |
| WO 2016205745 | Dec 2016 | WO |
| WO 2016205749 | Dec 2016 | WO |
| WO 2016205759 | Dec 2016 | WO |
| WO 2016205764 | Dec 2016 | WO |
| WO 2017001572 | Jan 2017 | WO |
| WO 2017001988 | Jan 2017 | WO |
| WO 2017004261 | Jan 2017 | WO |
| WO 2017004279 | Jan 2017 | WO |
| WO 2017004616 | Jan 2017 | WO |
| WO 2017005807 | Jan 2017 | WO |
| WO 2017009399 | Jan 2017 | WO |
| WO 2017010556 | Jan 2017 | WO |
| WO 2017011519 | Jan 2017 | WO |
| WO 2017011721 | Jan 2017 | WO |
| WO 2017011804 | Jan 2017 | WO |
| WO 2017015015 | Jan 2017 | WO |
| WO 2017015101 | Jan 2017 | WO |
| WO 2017015567 | Jan 2017 | WO |
| WO 2017015637 | Jan 2017 | WO |
| WO 2017017016 | Feb 2017 | WO |
| WO 2017019867 | Feb 2017 | WO |
| WO 2017019895 | Feb 2017 | WO |
| WO 2017023803 | Feb 2017 | WO |
| WO 2017023974 | Feb 2017 | WO |
| WO 2017024047 | Feb 2017 | WO |
| WO 2017024319 | Feb 2017 | WO |
| WO 2017024343 | Feb 2017 | WO |
| WO 2017024602 | Feb 2017 | WO |
| WO 2017025323 | Feb 2017 | WO |
| WO 2017027423 | Feb 2017 | WO |
| WO 2017028768 | Feb 2017 | WO |
| WO 2017029664 | Feb 2017 | WO |
| WO 2017031360 | Feb 2017 | WO |
| WO 2017031483 | Feb 2017 | WO |
| WO 2017035416 | Mar 2017 | WO |
| WO 2017040348 | Mar 2017 | WO |
| WO 2017040511 | Mar 2017 | WO |
| WO 2017040709 | Mar 2017 | WO |
| WO 2017040786 | Mar 2017 | WO |
| WO 2017040793 | Mar 2017 | WO |
| WO 2017040813 | Mar 2017 | WO |
| WO 2017043573 | Mar 2017 | WO |
| WO 2017043656 | Mar 2017 | WO |
| WO 2017044419 | Mar 2017 | WO |
| WO 2017044776 | Mar 2017 | WO |
| WO 2017044857 | Mar 2017 | WO |
| WO 2017049129 | Mar 2017 | WO |
| WO 2017050963 | Mar 2017 | WO |
| WO 2017053312 | Mar 2017 | WO |
| WO 2017053431 | Mar 2017 | WO |
| WO 2017053713 | Mar 2017 | WO |
| WO 2017053729 | Mar 2017 | WO |
| WO 2017053753 | Mar 2017 | WO |
| WO 2017053762 | Mar 2017 | WO |
| WO 2017053879 | Mar 2017 | WO |
| WO 2017054721 | Apr 2017 | WO |
| WO 2017058658 | Apr 2017 | WO |
| WO 2017059241 | Apr 2017 | WO |
| WO 2017062605 | Apr 2017 | WO |
| WO 2017062723 | Apr 2017 | WO |
| WO 2017062754 | Apr 2017 | WO |
| WO 2017062855 | Apr 2017 | WO |
| WO 2017062886 | Apr 2017 | WO |
| WO 2017062983 | Apr 2017 | WO |
| WO 2017064439 | Apr 2017 | WO |
| WO 2017064546 | Apr 2017 | WO |
| WO 2017064566 | Apr 2017 | WO |
| WO 2017066175 | Apr 2017 | WO |
| WO 2017066497 | Apr 2017 | WO |
| WO 2017066588 | Apr 2017 | WO |
| WO 2017066707 | Apr 2017 | WO |
| WO 2017068077 | Apr 2017 | WO |
| WO 2017068377 | Apr 2017 | WO |
| WO 2017069829 | Apr 2017 | WO |
| WO 2017070029 | Apr 2017 | WO |
| WO 2017070032 | Apr 2017 | WO |
| WO 2017070169 | Apr 2017 | WO |
| WO 2017070284 | Apr 2017 | WO |
| WO 2017070598 | Apr 2017 | WO |
| WO 2017070605 | Apr 2017 | WO |
| WO 2017070632 | Apr 2017 | WO |
| WO 2017070633 | Apr 2017 | WO |
| WO 2017072590 | May 2017 | WO |
| WO 2017074526 | May 2017 | WO |
| WO 2017074962 | May 2017 | WO |
| WO 2017075261 | May 2017 | WO |
| WO 2017075335 | May 2017 | WO |
| WO 2017075475 | May 2017 | WO |
| WO 2017077135 | May 2017 | WO |
| WO 2017077329 | May 2017 | WO |
| WO 2017078751 | May 2017 | WO |
| WO 2017079400 | May 2017 | WO |
| WO 2017079428 | May 2017 | WO |
| WO 2017079673 | May 2017 | WO |
| WO 2017079724 | May 2017 | WO |
| WO 2017081097 | May 2017 | WO |
| WO 2017081288 | May 2017 | WO |
| WO 2017083368 | May 2017 | WO |
| WO 2017083722 | May 2017 | WO |
| WO 2017083766 | May 2017 | WO |
| WO 2017087395 | May 2017 | WO |
| WO 2017090724 | Jun 2017 | WO |
| WO 2017091510 | Jun 2017 | WO |
| WO 2017091630 | Jun 2017 | WO |
| WO 2017092201 | Jun 2017 | WO |
| WO 2017093370 | Jun 2017 | WO |
| WO 2017095111 | Jun 2017 | WO |
| WO 2017096041 | Jun 2017 | WO |
| WO 2017096237 | Jun 2017 | WO |
| WO 2017100158 | Jun 2017 | WO |
| WO 2017100431 | Jun 2017 | WO |
| WO 2017104404 | Jun 2017 | WO |
| WO 2017105251 | Jun 2017 | WO |
| WO 2017105350 | Jun 2017 | WO |
| WO 2017105991 | Jun 2017 | WO |
| WO 2017106414 | Jun 2017 | WO |
| WO 2017106528 | Jun 2017 | WO |
| WO 2017106537 | Jun 2017 | WO |
| WO 2017106569 | Jun 2017 | WO |
| WO 2017106616 | Jun 2017 | WO |
| WO 2017106657 | Jun 2017 | WO |
| WO 2017106767 | Jun 2017 | WO |
| WO 2017109134 | Jun 2017 | WO |
| WO 2017109757 | Jun 2017 | WO |
| WO 2017112620 | Jun 2017 | WO |
| WO 2017115268 | Jul 2017 | WO |
| WO 2017115268 | Jul 2017 | WO |
| WO 2017117395 | Jul 2017 | WO |
| WO 2017118598 | Jul 2017 | WO |
| WO 2017118720 | Jul 2017 | WO |
| WO 2017123609 | Jul 2017 | WO |
| WO 2017123910 | Jul 2017 | WO |
| WO 2017124086 | Jul 2017 | WO |
| WO 2017124100 | Jul 2017 | WO |
| WO 2017124652 | Jul 2017 | WO |
| WO 2017126987 | Jul 2017 | WO |
| WO 2017127807 | Jul 2017 | WO |
| WO 2017131237 | Aug 2017 | WO |
| WO 2017132112 | Aug 2017 | WO |
| WO 2017136520 | Aug 2017 | WO |
| WO 2017136629 | Aug 2017 | WO |
| WO 2017136794 | Aug 2017 | WO |
| WO 2017139264 | Aug 2017 | WO |
| WO 2017139505 | Aug 2017 | WO |
| WO 2017141173 | Aug 2017 | WO |
| WO 2017142835 | Aug 2017 | WO |
| WO 2017142999 | Aug 2017 | WO |
| WO 2017143042 | Aug 2017 | WO |
| WO 2017147278 | Aug 2017 | WO |
| WO 2017147432 | Aug 2017 | WO |
| WO 2017147446 | Aug 2017 | WO |
| WO 2017147555 | Aug 2017 | WO |
| WO 2017151444 | Sep 2017 | WO |
| WO 2017152015 | Sep 2017 | WO |
| WO 2017155717 | Sep 2017 | WO |
| WO 2017157422 | Sep 2017 | WO |
| WO 2017158153 | Sep 2017 | WO |
| WO 2017160689 | Sep 2017 | WO |
| WO 2017160752 | Sep 2017 | WO |
| WO 2017160890 | Sep 2017 | WO |
| WO 2017161068 | Sep 2017 | WO |
| WO 2017165826 | Sep 2017 | WO |
| WO 2017165862 | Sep 2017 | WO |
| WO 2017172644 | Oct 2017 | WO |
| WO 2017172645 | Oct 2017 | WO |
| WO 2017172860 | Oct 2017 | WO |
| WO 2017173004 | Oct 2017 | WO |
| WO 2017173054 | Oct 2017 | WO |
| WO 2017173092 | Oct 2017 | WO |
| WO 2017174329 | Oct 2017 | WO |
| WO 2017176529 | Oct 2017 | WO |
| WO 2017176806 | Oct 2017 | WO |
| WO 2017178590 | Oct 2017 | WO |
| WO 2017180694 | Oct 2017 | WO |
| WO 2017180711 | Oct 2017 | WO |
| WO 2017180915 | Oct 2017 | WO |
| WO 2017180926 | Oct 2017 | WO |
| WO 2017181107 | Oct 2017 | WO |
| WO 2017181735 | Oct 2017 | WO |
| WO 2017182468 | Oct 2017 | WO |
| WO 2017184334 | Oct 2017 | WO |
| WO 2017184768 | Oct 2017 | WO |
| WO 2017184786 | Oct 2017 | WO |
| WO 2017186550 | Nov 2017 | WO |
| WO 2017189308 | Nov 2017 | WO |
| WO 2017189336 | Nov 2017 | WO |
| WO 2017190257 | Nov 2017 | WO |
| WO 2017190664 | Nov 2017 | WO |
| WO 2017191210 | Nov 2017 | WO |
| WO 2017192172 | Nov 2017 | WO |
| WO 2017192512 | Nov 2017 | WO |
| WO 2017192544 | Nov 2017 | WO |
| WO 2017192573 | Nov 2017 | WO |
| WO 2017193029 | Nov 2017 | WO |
| WO 2017193053 | Nov 2017 | WO |
| WO 2017196768 | Nov 2017 | WO |
| WO 2017197038 | Nov 2017 | WO |
| WO 2017197238 | Nov 2017 | WO |
| WO 2017197301 | Nov 2017 | WO |
| WO 2017201476 | Nov 2017 | WO |
| WO 2017205290 | Nov 2017 | WO |
| WO 2017205423 | Nov 2017 | WO |
| WO 2017207589 | Dec 2017 | WO |
| WO 2017208247 | Dec 2017 | WO |
| WO 2017209809 | Dec 2017 | WO |
| WO 2017213896 | Dec 2017 | WO |
| WO 2017213898 | Dec 2017 | WO |
| WO 2017214460 | Dec 2017 | WO |
| WO 2017216392 | Dec 2017 | WO |
| WO 2017216771 | Dec 2017 | WO |
| WO 2017218185 | Dec 2017 | WO |
| WO 2017219027 | Dec 2017 | WO |
| WO 2017219033 | Dec 2017 | WO |
| WO 2017220751 | Dec 2017 | WO |
| WO 2017222370 | Dec 2017 | WO |
| WO 2017222773 | Dec 2017 | WO |
| WO 2017222834 | Dec 2017 | WO |
| WO 2017223107 | Dec 2017 | WO |
| WO 2017223330 | Dec 2017 | WO |
| WO 2018000657 | Jan 2018 | WO |
| WO 2018002719 | Jan 2018 | WO |
| WO 2018005117 | Jan 2018 | WO |
| WO 2018005289 | Jan 2018 | WO |
| WO 2018005691 | Jan 2018 | WO |
| WO 2018005782 | Jan 2018 | WO |
| WO 2018005873 | Jan 2018 | WO |
| WO 201806693 | Jan 2018 | WO |
| WO 2018009520 | Jan 2018 | WO |
| WO 2018009562 | Jan 2018 | WO |
| WO 2018009822 | Jan 2018 | WO |
| WO 2018013821 | Jan 2018 | WO |
| WO 2018013990 | Jan 2018 | WO |
| WO 2018014384 | Jan 2018 | WO |
| WO 2018015444 | Jan 2018 | WO |
| WO 2018015936 | Jan 2018 | WO |
| WO 2018017754 | Jan 2018 | WO |
| WO 2018018979 | Feb 2018 | WO |
| WO 2018020248 | Feb 2018 | WO |
| WO 2018022480 | Feb 2018 | WO |
| WO 2018022634 | Feb 2018 | WO |
| WO 2018025206 | Feb 2018 | WO |
| WO 2018026723 | Feb 2018 | WO |
| WO 2018026976 | Feb 2018 | WO |
| WO 2018027078 | Feb 2018 | WO |
| WO 2018030608 | Feb 2018 | WO |
| WO 2018031683 | Feb 2018 | WO |
| WO 2018035250 | Feb 2018 | WO |
| WO 2018035300 | Feb 2018 | WO |
| WO 2018035423 | Feb 2018 | WO |
| WO 2018035503 | Feb 2018 | WO |
| WO 2018039145 | Mar 2018 | WO |
| WO 2018039438 | Mar 2018 | WO |
| WO 2018039440 | Mar 2018 | WO |
| WO 2018039448 | Mar 2018 | WO |
| WO 2018045630 | Mar 2018 | WO |
| WO 2018048827 | Mar 2018 | WO |
| WO 2018049168 | Mar 2018 | WO |
| WO 2018051347 | Mar 2018 | WO |
| WO 2018058064 | Mar 2018 | WO |
| WO 2018062866 | Apr 2018 | WO |
| WO 2018064352 | Apr 2018 | WO |
| WO 2018064371 | Apr 2018 | WO |
| WO 2018064516 | Apr 2018 | WO |
| WO 2018067546 | Apr 2018 | WO |
| WO 2018067846 | Apr 2018 | WO |
| WO 2018068053 | Apr 2018 | WO |
| WO 2018069474 | Apr 2018 | WO |
| WO 2018071623 | Apr 2018 | WO |
| WO 2018071663 | Apr 2018 | WO |
| WO 2018071868 | Apr 2018 | WO |
| WO 2018071892 | Apr 2018 | WO |
| WO 2018074979 | Apr 2018 | WO |
| WO 2018079134 | May 2018 | WO |
| WO 2018080573 | May 2018 | WO |
| WO 2018081504 | May 2018 | WO |
| WO 2018081535 | May 2018 | WO |
| WO 2018081728 | May 2018 | WO |
| WO 2018083128 | May 2018 | WO |
| WO 2018083606 | May 2018 | WO |
| WO 2018085288 | May 2018 | WO |
| WO 2018086623 | May 2018 | WO |
| WO 2018093990 | May 2018 | WO |
| WO 2018098383 | May 2018 | WO |
| WO 2018098480 | May 2018 | WO |
| WO 2018098587 | Jun 2018 | WO |
| WO 2018099256 | Jun 2018 | WO |
| WO 2018103686 | Jun 2018 | WO |
| WO 2018106268 | Jun 2018 | WO |
| WO 2018107028 | Jun 2018 | WO |
| WO 2018107103 | Jun 2018 | WO |
| WO 2018107129 | Jun 2018 | WO |
| WO 2018108272 | Jun 2018 | WO |
| WO 2018109101 | Jun 2018 | WO |
| WO 2018111946 | Jun 2018 | WO |
| WO 2018111947 | Jun 2018 | WO |
| WO 2018112336 | Jun 2018 | WO |
| WO 2018112446 | Jun 2018 | WO |
| WO 2018119354 | Jun 2018 | WO |
| WO 2018119359 | Jun 2018 | WO |
| WO 2018130830 | Jul 2018 | WO |
| WO 2018135838 | Jul 2018 | WO |
| WO 2018136396 | Jul 2018 | WO |
| WO 2018138385 | Aug 2018 | WO |
| WO 2018148246 | Aug 2018 | WO |
| WO 2018148256 | Aug 2018 | WO |
| WO 2018148647 | Aug 2018 | WO |
| WO 2018149418 | Aug 2018 | WO |
| WO 2018149888 | Aug 2018 | WO |
| WO 2018152418 | Aug 2018 | WO |
| WO 2018154380 | Aug 2018 | WO |
| WO 2018154387 | Aug 2018 | WO |
| WO 2018154412 | Aug 2018 | WO |
| WO 2018154413 | Aug 2018 | WO |
| WO 2018154418 | Aug 2018 | WO |
| WO 2018154439 | Aug 2018 | WO |
| WO 2018154459 | Aug 2018 | WO |
| WO 2018154462 | Aug 2018 | WO |
| WO 2018156372 | Aug 2018 | WO |
| WO 2018161009 | Sep 2018 | WO |
| WO 2018165504 | Sep 2018 | WO |
| WO 2018165629 | Sep 2018 | WO |
| WO 2018170015 | Sep 2018 | WO |
| WO 2018170340 | Sep 2018 | WO |
| WO 2018175502 | Sep 2018 | WO |
| WO 2018177351 | Oct 2018 | WO |
| WO 2018179578 | Oct 2018 | WO |
| WO 2018183403 | Oct 2018 | WO |
| WO 2018195545 | Oct 2018 | WO |
| WO 2018195555 | Oct 2018 | WO |
| WO 2018197020 | Nov 2018 | WO |
| WO 2018197495 | Nov 2018 | WO |
| WO 2018202800 | Nov 2018 | WO |
| WO 2018204493 | Nov 2018 | WO |
| WO 2018208755 | Nov 2018 | WO |
| WO 2018208998 | Nov 2018 | WO |
| WO 2018209158 | Nov 2018 | WO |
| WO 2018209320 | Nov 2018 | WO |
| WO 2018213708 | Nov 2018 | WO |
| WO 2018213726 | Nov 2018 | WO |
| WO 2018213771 | Nov 2018 | WO |
| WO 2018213791 | Nov 2018 | WO |
| WO 2018217852 | Nov 2018 | WO |
| WO 2018217981 | Nov 2018 | WO |
| WO 2018218166 | Nov 2018 | WO |
| WO 2018218188 | Nov 2018 | WO |
| WO 2018218206 | Nov 2018 | WO |
| Entry |
|---|
| U.S. Appl. No. 61/716,256, Jinek et al., filed Oct. 19, 2012. |
| U.S. Appl. No. 61/717,324, Cho et al., filed Oct. 23, 2012. |
| U.S. Appl. No. 61/734,256, Chen et al., filed Dec. 6, 2012. |
| U.S. Appl. No. 61/758,624, Chen et al., filed Jan. 30, 2013. |
| U.S. Appl. No. 61/761,046, Knight et al., filed Feb. 5, 2013. |
| U.S. Appl. No. 61/794,422, Knight et al., filed Mar. 15, 2013. |
| U.S. Appl. No. 61/803,599, Kim et al., filed Mar. 20, 2013. |
| U.S. Appl. No. 61/837,481, Cho et al., filed Jun. 20, 2013. |
| Partial Supplementary European Search Report for Application No. EP 12845790.0, dated Mar. 18, 2015. |
| Supplementary European Search Report for Application No. EP 12845790.0, dated Oct. 12, 2015. |
| International Search Report and Written Opinion for PCT/US2012/047778, dated May 30, 2013. |
| International Preliminary Report on Patentability for PCT/US2012/047778, dated Feb. 6, 2014. |
| International Search Report and Written Opinion for PCT/US2014/052231, dated Dec. 4, 2014. |
| International Search Report and Written Opinion for PCT/US2014/052231, dated Jan. 30, 2015 (Corrected Version). |
| International Preliminary Report on Patentability for PCT/US2014/052231, dated Mar. 3, 2016. |
| International Search Report and Written Opinion for PCT/US2014/050283, dated Nov. 6, 2014. |
| International Preliminary Report on Patentability for PCT/US2014/050283, dated Feb. 18, 2016. |
| International Search Report and Written Opinion for PCT/US2014/054247, dated Mar. 27, 2015. |
| International Preliminary Report on Patentability for PCT/US2014/054247, dated Mar. 17, 2016. |
| Invitation to Pay Additional Fees for PCT/US2014/054291, dated Dec. 18, 2014. |
| International Search Report and Written Opinion for PCT/US2014/054291, dated Mar. 27, 2015. |
| International Preliminary Report on Patentability for PCT/US2014/054291, dated Mar. 17, 2016. |
| International Search Report and Written Opinion for PCT/US2014/054252, dated Mar. 5, 2015. |
| International Preliminary Report on Patentability or PCT/US2014/054252, dated Mar. 17, 2016. |
| International Search Report and Written Opinion for PCT/US2014/070038, dated Apr. 14, 2015. |
| International Preliminary Report on Patentability for PCT/US2014/070038, dated Jun. 23, 2016. |
| International Search Report and Written Opinion for PCT/US2015/042770, dated Feb. 23, 2016. |
| International Search Report and Written Opinion for PCT/US2015/058479, dated Feb. 11, 2016. |
| International Search Report for PCT/US2013/032589, dated Jul. 26, 2013. |
| Alexandrov et al., Signatures of mutational processes in human cancer. Nature. Aug. 22, 2013;500(7463):415-21. doi: 10.1038/nature12477. Epub Aug. 14, 2013. |
| Ali et al., Novel genetic abnormalities in Bernard-Soulier syndrome in India. Ann Hematol. Mar. 2014;93(3):381-4. doi: 10.1007/s00277-013-1895-x. Epub Sep. 1, 2013. |
| Barrangou et al., CRISPR provides acquired resistance against viruses in prokaryotes. Science. Mar. 23, 2007;315(5819):1709-12. |
| Barrangou, RNA-mediated programmable DNA cleavage. Nat Biotechnol. Sep. 2012;30(9):836-8. doi: 10.1038/nbt.2357. |
| Bedell et al., In vivo genome editing using a high-efficiency TALEN system. Nature. Nov. 1, 2012;491(7422):114-8. Doi: 10.1038/nature11537. Epub Sep. 23, 2012. |
| Beumer et al., Efficient gene targeting in Drosophila with zinc-finger nucleases. Genetics. Apr. 2006;172(4):2391-403. Epub Feb. 1, 2006. |
| Bhagwat, DNA-cytosine deaminases: from antibody maturation to antiviral defense. DNA Repair (Amst). Jan. 5, 2004;3(1):85-9. |
| Boch, TALEs of genome targeting. Nat Biotechnol. Feb. 2011;29(2):135-6. Doi: 10.1038/nbt.1767. |
| Boeckle et al., Melittin analogs with high lytic activity at endosomal pH enhance transfection with purified targeted PEI polyplexes. J Control Release. May 15, 2006;112(2):240-8. Epub Mar. 20, 2006. |
| Branden and Tooze, Introduction to Protein Structure. 1999; 2nd edition. Garland Science Publisher: 3-12. |
| Brown et al., Serine recombinases as tools for genome engineering. Methods. Apr. 2011;53(4):372-9. doi: 10.1016/j.ymeth.2010.12.031. Epub Dec. 30, 2010. |
| Bulow et al., Multienzyme systems obtained by gene fusion. Trends Biotechnol. Jul. 1991;9(7):226-31. |
| Cade et al., Highly efficient generation of heritable zebrafish gene mutations using homo- and heterodimeric TALENs. Nucleic Acids Res. Sep. 2012;40(16):8001-10. Doi: 10.1093/nar/gks518. Epub Jun. 7, 2012. |
| Cameron, Recent advances in transgenic technology. Mol Biotechnol. Jun. 1997;7(3):253-65. |
| Cargill et al.,Characterization of single-nucleotide polymorphisms in coding regions of human genes. Nat Genet. Jul. 1999;22(3):231-8. |
| Caron et al., Intracellular delivery of a Tat-eGFP fusion protein into muscle cells. Mol Ther. Mar. 2001;3(3):310-8. |
| Carroll et al., Gene targeting in Drosophila and Caenorhabditis elegans with zinc-finger nucleases. Methods Mol Biol. 2008;435:63-77. doi: 10.1007/978-1-59745-232-8_5. |
| Carroll et al., Progress and prospects: zinc-finger nucleases as gene therapy agents. Gene Ther. Nov. 2008;15(22):1463-8. doi: 10.1038/gt.2008.145. Epub Sep. 11, 2008. |
| Carroll, A CRISPR approach to gene targeting. Mol Ther. Sep. 2012;20(9):1658-60. doi: 10.1038/mt.2012.171. |
| Cermak et al., Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting. Nucleic Acids Res. Jul. 2011;39(12):e82. Doi: 10.1093/nar/gkr218. Epub Apr. 14, 2011. |
| Charpentier et al., Biotechnology: Rewriting a genome. Nature. Mar. 7, 2013;495(7439):50-1. doi: 10.1038/495050a. |
| Chelico et al., Biochemical basis of immunological and retroviral responses to DNA-targeted cytosine deamination by activation-induced cytidine deaminase and APOBEC3G. J Biol Chem. Oct. 9, 2009;284(41):27761-5. doi: 10.1074/jbc.R109.052449. Epub Aug. 13, 2009. |
| Chichili et al., Linkers in the structural biology of protein-protein interactions. Protein Science. 2013;22:153-67. |
| Chipev et al., A leucine-proline mutation in the H1 subdomain of keratin 1 causes epidermolytic hyperkeratosis. Cell. Sep. 4, 1992;70(5):821-8. |
| Cho et al., Analysis of off-target effects of CRISPR/Cas-derived RNA-guided endonucleases and nickases. Genome Res. Jan. 2014;24(1):132-41. doi: 10.1101/gr.162339.113. Epub Nov. 19, 2013. |
| Cho et al., Targeted genome engineering in human cells with the Cas9 RNA-guided endonuclease. Nat Biotechnol. Mar. 2013;31(3):230-2. doi: 10.1038/nbt.2507. Epub Jan. 29, 2013. |
| Christian et al, Targeting G with TAL effectors: a comparison of activities of TALENs constructed with NN and NK repeat variable di-residues. PLoS One. 2012;7(9):e45383. doi: 10.1371/journal.pone.0045383. Epub Sep. 24, 2012. |
| Christian et al., Targeting DNA double-strand breaks with TAL effector nucleases. Genetics. Oct. 2010;186(2):757-61. Doi: 10.1534/genetics.110.120717. Epub Jul. 26, 2010. |
| Chung-Il et al., Artificial control of gene expression in mammalian cells by modulating RNA interference through aptamer-small molecule interaction. RNA. May 2006;12(5):710-6. Epub Apr. 10, 2006. |
| Chylinski et al., The tracrRNA and Cas9 families of type II CRISPR-Cas immunity systems. RNA Biol. May 2013;10(5):726-37. doi: 10.4161/rna.24321. Epub Apr. 5, 2013. |
| Cole-Strauss et al., Correction of the mutation responsible for sickle cell anemia by an RNA-DNA oligonucleotide. Science. Sep. 6, 1996;273(5280):1386-9. |
| Cong et al., Multiplex genome engineering using CRISPR/Cas systems. Science. Feb. 15, 2013;339(6121):819-23. doi: 10.1126/science.1231143. Epub Jan. 3, 2013. |
| Conticello, The AID/APOBEC family of nucleic acid mutators. Genome Biol. 2008;9(6):229. doi: 10.1186/gb-2008-9-6-229. Epub Jun. 17, 2008. |
| Cradick et al., CRISPR/Cas9 systems targeting Î2-globin and CCR5 genes have substantial off-target activity. Nucleic Acids Res. Nov. 1, 2013;41(20):9584-92. doi: 10.1093/nar/gkt714. Epub Aug. 11, 2013. |
| Cradick et al., ZFN-site searches genomes for zinc finger nuclease target sites and off-target sites. BMC Bioinformatics. May 13, 2011;12:152. doi: 10.1186/1471-2105-12-152. |
| Cradick et al., Zinc-finger nucleases as a novel therapeutic strategy for targeting hepatitis B virus DNAs. Mol Ther. May 2010;18(5):947-54. Doi: 10.1038/mt.2010.20. Epub Feb. 16, 2010. |
| Cui et al., Targeted integration in rat and mouse embryos with zinc-finger nucleases. Nat Biotechnol. Jan. 2011;29(1):64-7. Doi: 10.1038/nbt.1731. Epub Dec. 12, 2010. |
| Dahlem et al., Simple methods for generating and detecting locus-specific mutations induced with TALENs in the zebrafish genome. PLoS Genet. 2012;8(8):e1002861. doi: 10.1371/journal.pgen.1002861. Epub Aug. 16, 2012. |
| De Souza, Primer: genome editing with engineered nucleases. Nat Methods. Jan. 2012;9(1):27. |
| Deltcheva et al., CRISPR RNA maturation by trans-encoded small RNA and host factor RNase III. Nature. Mar. 31, 2011;471(7340):602-7. doi: 10.1038/nature09886. |
| Dicarlo et al., Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic Acids Res. Apr. 2013;41(7):4336-43. doi: 10.1093/nar/gkt135. Epub Mar. 4, 2013. |
| Ding et al., A TALEN genome-editing system for generating human stem cell-based disease models. Cell Stem Cell. Feb. 7, 2013;12(2):238-51. Doi: 10.1016/j.stem.2012.11.011. Epub Dec. 13, 2012. |
| Doyon et al., Heritable targeted gene disruption in zebrafish using designed zinc-finger nucleases. Nat Biotechnol. Jun. 2008;26(6):702-8. Doi: 10.1038/nbt1409. Epub May 25, 2008. |
| Eltoukhy et al., Nucleic acid-mediated intracellular protein delivery by lipid-like nanoparticles. Biomaterials. Aug. 2014;35(24):6454-61. doi: 10.1016/j.biomaterials.2014.04.014. Epub May 13, 2014. |
| Esvelt et al., Genome-scale engineering for systems and synthetic biology. Mol Syst Biol. 2013;9:641. doi: 10.1038/msb.2012.66. |
| Esvelt et al., Orthogonal Cas9 proteins for RNA-guided gene regulation and editing. Nat Methods. Nov. 2013;10(11):1116-21. doi: 10.1038/nmeth.2681. Epub Sep. 29, 2013. |
| Fonfara et al., Phylogeny of Cas9 determines functional exchangeability of dual-RNA and Cas9 among orthologous type II CRISPR-Cas systems. Nucleic Acids Res. Feb. 2014;42(4):2577-90. doi: 10.1093/nar/gkt1074. Epub Nov. 22, 2013. |
| Fu et al., Improving CRISPR-Cas nuclease specificity using truncated guide RNAs. Nat Biotechnol. Mar. 2014;32(3):279-84. doi: 10.1038/nbt.2808. Epub Jan. 26, 2014. |
| Fu et al., High-frequency off-target mutagenesis induced by CRISPR-Cas nucleases in human cells. Nat Biotechnol. Sep. 2013;31(9):822-6. doi: 10.1038/nbt.2623. Epub Jun. 23, 2013. |
| Fuchs et al., Polyarginine as a multifunctional fusion tag. Protein Sci. Jun. 2005;14(6):1538-44. |
| Fujisawa et al., Disease-associated mutations in CIAS1 induce cathepsin B-dependent rapid cell death of human THP-1 monocytic cells. Blood. Apr. 1, 2007;109(7):2903-11. |
| Gaj et al., ZFN, TALEN, and CRISPR/Cas-based methods for genome engineering. Trends Biotechnol. Jul. 2013;31(7):397-405. doi: 10.1016/j.tibtech.2013.04.004. Epub May 9, 2013. |
| Gallo et al., A novel pathogenic PSEN1 mutation in a family with Alzheimer's disease: phenotypical and neuropathological features. J Alzheimers Dis. 2011;25(3):425-31. doi: 10.3233/JAD-2011-110185. |
| Gasiunas et al., Cas9-crRNA ribonucleoprotein complex mediates specific DNA cleavage for adaptive immunity in bacteria. Proc Natl Acad Sci U S A. Sep. 25, 2012;109(39):E2579-86. Epub Sep. 4, 2012. Supplementary materials included. |
| Gasiunas et al., RNA-dependent DNA endonuclease Cas9 of the CRISPR system: Holy Grail of genome editing? Trends Microbiol. Nov. 2013;21(11):562-7. doi: 10.1016/j.tim.2013.09.001. Epub Oct. 1, 2013. |
| Genbank Submission; NIH/NCBI, Accession No. J04623. Kita et al., Apr. 26, 1993. 2 pages. |
| Genbank Submission; NIH/NCBI, Accession No. NC_002737.1. Ferretti et al., Jun. 27, 2013. 1 page. |
| Genbank Submission; NIH/NCBI, Accession No. NC_015683.1. Trost et al., Jul. 6, 2013. 1 page. |
| Genbank Submission; NIH/NCBI, Accession No. NC_016782.1. Trost et al., Jun. 11, 2013. 1 page. |
| Genbank Submission; NIH/NCBI, Accession No. NC_016786.1. Trost et al., Aug. 28, 2013. 1 page. |
| Genbank Submission; NIH/NCBI, Accession No. NC_017053.1. Fittipaldi et al., Jul. 6, 2013. 1 page. |
| Genbank Submission; NIH/NCBI, Accession No. NC_017317.1. Trost et al., Jun. 11, 2013. 1 page. |
| Genbank Submission; NIH/NCBI, Accession No. NC_017861.1. Heidelberg et al., Jun. 11, 2013. 1 page. |
| Genbank Submission; NIH/NCBI, Accession No. NC_018010.1. Lucas et al., Jun. 11, 2013. 2 pages. |
| Genbank Submission; NIH/NCBI, Accession No. NC_018721.1. Feng et al., Jun. 11, 2013. 1 pages. |
| Genbank Submission; NIH/NCBI, Accession No. NC_021284.1. Ku et al., Jul. 12, 2013. 1 page. |
| Genbank Submission; NIH/NCBI, Accession No. NC_021314.1. Zhang et al., Jul. 15, 2013. 1 page. |
| Genbank Submission; NIH/NCBI, Accession No. NC_021846.1. Lo et al., Jul. 22, 2013. 1 page. |
| Genbank Submission; NIH/NCBI, Accession No. NP_472073.1. Glaser et al., Jun. 27, 2013. 2 pages. |
| Genbank Submission; NIH/NCBI, Accession No. P42212. Prasher et al., Mar. 19, 2014. 7 pages. |
| Genbank Submission; NIH/NCBI, Accession No. YP_002342100.1. Bernardini et al., Jun. 10, 2013. 2 pages. |
| Genbank Submission; NIH/NCBI, Accession No. YP_002344900.1. Gundogdu et al., Mar. 19, 2014. 2 pages. |
| Genbank Submission; NIH/NCBI, Accession No. YP_820832.1. Makarova et al., Aug. 27, 2013. 2 pages. |
| Gerber et al., RNA editing by base deamination: more enzymes, more targets, new mysteries. Trends Biochem Sci. Jun. 2001;26(6):376-84. |
| Gilbert et al., CRISPR-mediated modular RNA-guided regulation of transcription in eukaryotes. Cell. 2013 154(2):442-51. |
| Gilleron et al., Image-based analysis of lipid nanoparticle-mediated siRNA delivery, intracellular trafficking and endosomal escape. Nat Biotechnol. Jul. 2013;31(7):638-46. doi: 10.1038/nbt.2612. Epub Jun. 23, 2013. |
| Guilinger et al., Broad specificity profiling of TALENs results in engineered nucleases with improved DNA-cleavage specificity. Nat Methods. Apr. 2014;11(4):429-35. doi: 10.1038/nmeth.2845. Epub Feb. 16, 2014. |
| Guilinger et al., Fusion of catalytically inactive Cas9 to FokI nuclease improves the specificity of genome modification. Nat Biotechnol. Jun. 2014;32(6):577-82. doi: 10.1038/nbt.2909. Epub Apr. 25, 2014. |
| Guo et al., Protein tolerance to random amino acid change. Proc Natl Acad Sci U S A. Jun. 22, 2004;101(25):9205-10. Epub Jun. 14, 2004. |
| Hale et al., RNA-guided RNA cleavage by a CRISPR RNA-Cas protein complex. Cell. Nov. 25, 2009;139(5):945-56. doi: 10.1016/j.ce11.2009.07.040. |
| Hartung et al., Correction of metabolic, craniofacial, and neurologic abnormalities in MPS I mice treated at birth with adeno-associated virus vector transducing the human alpha-L-iduronidase gene. Mol Ther. Jun. 2004;9(6):866-75. |
| Hasadsri et al., Functional protein delivery into neurons using polymeric nanoparticles. J Biol Chem. Mar. 13, 2009;284(11):6972-81. doi: 10.1074/jbc.M805956200. Epub Jan. 7, 2009. |
| Hill et al., Functional analysis of conserved histidines in ADP-glucose pyrophosphorylase from Escherichia coli.Biochem Biophys Res Commun. Mar. 17, 1998;244(2):573-7. |
| Hockemeyer et al., Efficient targeting of expressed and silent genes in human ESCs and iPSCs using zinc-finger nucleases. Nat Biotechnol. Sep. 2009;27(9):851-7. doi: 10.1038/nbt.1562. Epub Aug. 13, 2009. |
| Hockemeyer et al., Genetic engineering of human pluripotent cells using TALE nucleases. Nat Biotechnol. Jul. 7, 2011;29(8):731-4. doi: 10.1038/nbt.1927. |
| Holden et al., Crystal structure of the anti-viral APOBEC3G catalytic domain and functional implications. Nature. Nov. 6, 2008;456(7218):121-4. doi: 10.1038/nature07357. Epub Oct. 12, 2008. |
| Horvath et al., CRISPR/Cas, the immune system of bacteria and archaea. Science. Jan. 8, 2010;327(5962):167-70. doi: 10.1126/science.1179555. |
| Houdebine, The methods to generate transgenic animals and to control transgene expression. J Biotechnol. Sep. 25, 2002;98(2-3):145-60. |
| Hsu et al., DNA targeting specificity of RNA-guided Cas9 nucleases. Nat Biotechnol. Sep. 2013;31(9):827-32. doi: 10.1038/nbt.2647. Epub Jul. 21, 2013. |
| Huang et al., Heritable gene targeting in zebrafish using customized TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):699-700. doi: 10.1038/nbt.1939. |
| Humbert et al., Targeted gene therapies: tools, applications, optimization. Crit Rev Biochem Mol Biol. May-Jun. 2012;47(3):264-81. doi: 10.3109/10409238.2012.658112. |
| Hurt et al., Highly specific zinc finger proteins obtained by directed domain shuffling and cell-based selection. Proc Natl Acad Sci U S A. Oct. 14, 2003;100(21):12271-6. Epub Oct. 3, 2003. |
| Hwang et al., Efficient genome editing in zebrafish using a CRISPR-Cas system. Nat Biotechnol. Mar. 2013;31(3):227-9. doi: 10.1038/nbt.2501. Epub Jan. 29, 2013. |
| Ikediobi et al., Mutation analysis of 24 known cancer genes in the NCI-60 cell line set. Mol Cancer Ther. Nov. 2006;5(11):2606-12. Epub Nov. 6, 2006. |
| Irrthum et al., Congenital hereditary lymphedema caused by a mutation that inactivates VEGFR3 tyrosine kinase. Am J Hum Genet. Aug. 2000;67(2):295-301. Epub Jun. 9, 2000. |
| Jamieson et al., Drug discovery with engineered zinc-finger proteins. Nat Rev Drug Discov. May 2003;2(5):361-8. |
| Jansen et al., Backbone and nucleobase contacts to glucosamine-6-phosphate in the glmS ribozyme. Nat Struct Mol Biol. Jun. 2006;13(6):517-23. Epub May 14, 2006. |
| Jenkins et al., Comparison of a preQ1 riboswitch aptamer in metabolite-bound and free states with implications for gene regulation. J Biol Chem. Jul. 15, 2011;286(28):24626-37. doi: 10.1074/jbc.M111.230375. Epub May 18, 2011. |
| Jiang et al., RNA-guided editing of bacterial genomes using CRISPR-Cas systems. Nat Biotechnol. Mar. 2013;31(3):233-9. doi: 10.1038/nbt.2508. Epub Jan. 29, 2013. |
| Jinek et al., A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science. Aug. 17, 2012;337(6096):816-21. doi: 10.1126/science.1225829. Epub Jun. 28, 2012. |
| Jinek et al., RNA-programmed genome editing in human cells. Elife. Jan. 29, 2013;2:e00471. doi: 10.7554/eLife.00471. |
| Jinek et al., Structures of Cas9 endonucleases reveal RNA-mediated conformational activation. Science. Mar. 14, 2014;343(6176):1247997. doi: 10.1126/science.1247997. Epub Feb. 6, 2014. |
| Jore et al., Structural basis for CRISPR RNA-guided DNA recognition by Cascade. Nat Struct Mol Biol. May 2011;18(5):529-36. doi: 10.1038/nsmb.2019. Epub Apr. 3, 2011. |
| Joung et al.,TALENs: a widely applicable technology for targeted genome editing. Nat Rev Mol Cell Biol. Jan. 2013;14(1):49-55. doi: 10.1038/nrm3486. Epub Nov. 21, 2012. |
| Kaiser et al., Gene therapy. Putting the fingers on gene repair. Science. Dec. 23, 2005;310(5756):1894-6. |
| Kandavelou et al., Targeted manipulation of mammalian genomes using designed zinc finger nucleases. Biochem Biophys Res Commun. Oct. 9, 2009;388(1):56-61. doi: 10.1016/j.bbrc.2009.07.112. Epub Jul. 25, 2009. |
| Kappel et al., Regulating gene expression in transgenic animals.Curr Opin Biotechnol. Oct. 1992;3(5):548-53. |
| Karpenshif et al., From yeast to mammals: recent advances in genetic control of homologous recombination. DNA Repair (Amst). Oct. 1, 2012;11(10):781-8. doi: 10.1016/j.dnarep.2012.07.001. Epub Aug. 11, 2012. Review. |
| Kim et al., A library of TAL effector nucleases spanning the human genome. Nat Biotechnol. Mar. 2013;31(3):251-8. Doi: 10.1038/nbt.2517. Epub Feb. 17, 2013. |
| Kim et al., Highly efficient RNA-guided genome editing in human cells via delivery of purified Cas9 ribonucleoproteins. Genome Res. Jun. 2014;24(6):1012-9. doi: 10.1101/gr.171322.113. Epub Apr. 2, 2014. |
| Kim et al., TALENs and ZFNs are associated with different mutationsignatures. Nat Methods. Mar. 2013;10(3):185. doi: 10.1038/nmeth.2364. Epub Feb. 10, 2013. |
| Kim et al., Targeted genome editing in human cells with zinc finger nucleases constructed via modular assembly. Genome Res. Jul. 2009;19(7):1279-88. doi: 10.1101/gr.089417.108. Epub May 21, 2009. |
| Klauser et al., An engineered small RNA-mediated genetic switch based on a ribozyme expression platform. Nucleic Acids Res. May 1, 2013;41(10):5542-52. doi: 10.1093/nar/gkt253. Epub Apr. 12, 2013. |
| Kumar et al., Structural and functional consequences of the mutation of a conserved arginine residue in alphaA and alphaB crystallins. J Biol Chem. Aug. 20, 1999;274(34):24137-41. |
| Kundu et al., Leucine to proline substitution by SNP at position 197 in Caspase-9 gene expression leads to neuroblastoma: a bioinformatics analysis. 3 Biotech. 2013; 3:225-34. |
| Larson et al., CRISPR interference (CRISPRi) for sequence-specific control of gene expression. Nat Protoc. Nov. 2013;8(11):2180-96. doi: 10.1038/nprot.2013.132. Epub Oct. 17, 2013. |
| Lavergne et al., Defects in type IIA von Willebrand disease: a cysteine 509 to arginine substitution in the mature von Willebrand factor disrupts a disulphide loop involved in the interaction with platelet glycoprotein Ib-IX. Br J Haematol. Sep. 1992;82(1):66-72. |
| Lazar et al., Transforming growth factor alpha: mutation of aspartic acid 47 and leucine 48 results in different biological activities. Mol Cell Biol. Mar. 1988;8(3):1247-52. |
| Lee et al., PIK3CA gene is frequently mutated in breast carcinomas and hepatocellular carcinomas. Oncogene. Feb. 17, 2005;24(8):1477-80. |
| Lei et al., Efficient targeted gene disruption in Xenopus embryos using engineered transcription activator-like effector nucleases (TALENs). Proc Natl Acad Sci U S A. Oct. 23, 2012;109(43):17484-9. Doi: 10.1073/pnas.1215421109. Epub Oct. 8, 2012. |
| Lenk et al., Pathogenic mechanism of the FIG4 mutation responsible for Charcot-Marie-Tooth disease CMT4J. PLoS Genet. Jun. 2011;7(6):e1002104. doi: 10.1371/journal.pgen.1002104. Epub Jun. 2, 2011. |
| Lewis et al., A serum-resistant cytofectin for cellular delivery of antisense oligodeoxynucleotides and plasmid DNA. Proc Natl Acad Sci U S A. Apr. 16, 1996;93(8):3176-81. |
| Lewis et al., Codon 129 polymorphism of the human prion protein influences the kinetics of amyloid formation. J Gen Virol. Aug. 2006;87(Pt 8):2443-9. |
| Li et al., Current approaches for engineering proteins with diverse biological properties. Adv Exp Med Biol. 2007;620:18-33. |
| Li et al., Modularly assembled designer TAL effector nucleases for targeted gene knockout and gene replacement in eukaryotes. Nucleic Acids Res. Aug. 2011;39(14):6315-25. doi: 10.1093/nar/gkr188. Epub Mar. 31, 2011. |
| Li et al., TAL nucleases (TALNs): hybrid proteins composed of TAL effectors and FokI DNA-cleavage domain. Nucleic Acids Res. Jan. 2011;39(1):359-72. doi: 10.1093/nar/gkq704. Epub Aug. 10, 2010. |
| Liu et al., Cell-penetrating peptide-mediated delivery of TALEN proteins via bioconjugation for genome engineering. PLoS One. Jan. 20, 2014;9(1):e85755. doi: 10.1371/journal.pone.0085755. eCollection 2014. |
| Liu et al., Design of polydactyl zinc-finger proteins for unique addressing within complex genomes. Proc Natl Acad Sci U S A. May 27, 1997;94(11):5525-30. |
| Liu et al., Fast Colorimetric Sensing of Adenosine and Cocaine Based on a General Sensor Design Involving Aptamers and Nanoparticles. Angew Chem. 2006;118(1):96-100. |
| Lombardo et al., Gene editing in human stem cells using zinc finger nucleases and integrase-defective lentiviral vector delivery. Nat Biotechnol. Nov. 2007;25(11):1298-306. Epub Oct. 28, 2007. |
| Lundberg et al., Delivery of short interfering RNA using endosomolytic cell-penetrating peptides. FASEB J. Sep. 2007;21(11):2664-71. Epub Apr. 26, 2007. |
| Maeder et al., CRISPR RNA-guided activation of endogenous human genes. Nat Methods. Oct. 2013;10(10):977-9. doi: 10.1038/nmeth.2598. Epub Jul. 25, 2013. |
| Maeder et al., Rapid “open-source” engineering of customized zinc-finger nucleases for highly efficient gene modification. Mol Cell. Jul. 25, 2008;31(2):294-301. doi:10.1016/j.molcel.2008.06.016. |
| Maeder et al., Robust, synergistic regulation of human gene expression using TALE activators. Nat Methods. Mar. 2013;10(3):243-5. doi: 10.1038/nmeth.2366. Epub Feb. 10, 2013. |
| Mahfouz et al., De novo-engineered transcription activator-like effector (TALE) hybrid nuclease with novel DNA binding specificity creates double-strand breaks. Proc Natl Acad Sci U S A. Feb. 8, 2011;108(6):2623-8. doi: 10.1073/pnas.1019533108. Epub Jan. 24, 2011. |
| Mali et al., Cas9 as a versatile tool for engineering biology. Nat Methods. Oct. 2013;10(10):957-63. doi: 10.1038/nmeth.2649. |
| Mali et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nat Biotechnol. Sep. 2013;31(9):833-8. doi: 10.1038/nbt.2675. Epub Aug. 1, 2013. |
| Mali et al., RNA-guided human genome engineering via Cas9. Science. Feb. 15, 2013;339(6121):823-6. doi: 10.1126/science.1232033. Epub Jan. 3, 2013. |
| Mani et al., Design, engineering, and characterization of zinc finger nucleases. Biochem Biophys Res Commun. Sep. 23, 2005;335(2):447-57. |
| Meng et al., Targeted gene inactivation in zebrafish using engineered zinc-finger nucleases. Nat Biotechnol. Jun. 2008;26(6):695-701. doi: 10.1038/nbt1398. Epub May 25, 2008. |
| Miller et al., A TALE nuclease architecture for efficient genome editing. Nat Biotechnol. Feb. 2011;29(2):143-8. doi:10.1038/nbt.1755. Epub Dec. 22, 2010. |
| Miller et al., An improved zinc-finger nuclease architecture for highly specific genome editing. Nat Biotechnol. Jul. 2007;25(7):778-85. Epub Jul. 1, 2007. |
| Minoretti et al., A W148R mutation in the human FOXD4 gene segregating with dilated cardiomyopathy, obsessive-compulsive disorder, and suicidality. Int J Mol Med. Mar. 2007;19(3):369-72. |
| Moore et al., Improved somatic mutagenesis in zebrafish using transcription activator-like effector nucleases (TALENs). PloS One. 2012;7(5):e37877. Doi: 10.1371/journal.pone.0037877. Epub May 24, 2012. |
| Morbitzer et al., Assembly of custom TALE-type DNA binding domains by modular cloning. Nucleic Acids Res. Jul. 2011;39(13):5790-9. doi: 10.1093/nar/gkr151. Epub Mar. 18, 2011. |
| Morris et al., A peptide carrier for the delivery of biologically active proteins into mammalian cells. Nat Biotechnol. Dec. 2001;19(12):1173-6. |
| Moscou et al., A simple cipher governs DNA recognition by TAL effectors. Science. Dec. 11, 2009;326(5959):1501. doi: 10.1126/science.1178817. |
| Mullins et al., Transgenesis in nonmurine species. Hypertension. Oct. 1993;22(4):630-3. |
| Mussolino et al., A novel TALE nuclease scaffold enables high genome editing activity in combination with low toxicity. Nucleic Acids Res. Nov. 2011;39(21):9283-93. Doi: 10.1093/nar/gkr597. Epub Aug. 3, 2011. |
| Mussolino et al., TALE nucleases: tailored genome engineering made easy. Curr Opin Biotechnol. Oct. 2012;23(5):644-50. doi: 10.1016/j.copbio.2012.01.013. Epub Feb. 17, 2012. |
| Narayanan et al., Clamping down on weak terminal base pairs: oligonucleotides with molecular caps as fidelity-enhancing elements at the 5′- and 3′-terminal residues. Nucleic Acids Res. May 20, 2004;32(9):2901-11. Print 2004. |
| Navaratnam et al., An overview of cytidine deaminases. Int J Hematol. Apr. 2006;83(3):195-200. |
| NCBI Reference Sequence: NM_002427.3. Wu et al., May 3, 2014. 5 pages. |
| Nishimasu et al., Crystal structure of Cas9 in complex with guide RNA and target DNA. Cell. Feb. 27, 2014;156(5):935-49. doi: 10.1016/j.cell.2014.02.001. Epub Feb. 13, 2014. |
| [No Author Listed], EMBL Accession No. Q99ZW2. Nov. 2012. 2 pages. |
| [No Author Listed], Invitrogen Lipofectamine™ 2000 product sheets, 2002. 2 pages. |
| [No Author Listed], Invitrogen Lipofectamine™ 2000 product sheets, 2005. 3 pages. |
| [No Author Listed], Invitrogen Lipofectamine™ LTX product sheets, 2011. 4 pages. |
| [No Author Listed], Thermo Fisher Scientific—How Cationic Lipid Mediated Transfection Works, retrieved from the internet Aug. 27, 2015. 2 pages. |
| Nomura et al., Synthetic mammalian riboswitches based on guanine aptazyme. Chem Commun (Camb). Jul. 21, 2012;48(57):7215-7. doi: 10.1039/c2cc33140c. Epub Jun. 13, 2012. |
| Noris et al., A phenylalanine-55 to serine amino-acid substitution in the human glycoprotein IX leucine-rich repeat is associated with Bernard-Soulier syndrome. Br J Haematol. May 1997;97(2):312-20. |
| O'Connell et al., Programmable RNA recognition and cleavage by CRISPR/Cas9. Nature. Dec. 11, 2014;516(7530):263-6. doi: 10.1038/nature13769. Epub Sep. 28, 2014. |
| Osborn et al., TALEN-based gene correction for epidermolysis bullosa. Mol Ther. Jun. 2013;21(6):1151-9. doi: 10.1038/mt.2013.56. Epub Apr. 2, 2013. |
| Pan et al., Biological and biomedical applications of engineered nucleases. Mol Biotechnol. Sep. 2013;55(1):54-62. doi: 10.1007/s12033-012-9613-9. |
| Pattanayak et al., Determining the specificities of TALENs, Cas9, and other genome-editing enzymes. Methods Enzymol. 2014;546:47-78. doi: 10.1016/B978-0-12-801185-0.00003-9. |
| Pattanayak et al., High-throughput profiling of off-target DNA cleavage reveals RNA-programmed Cas9 nuclease specificity. Nat Biotechnol. Sep. 2013;31(9):839-43. doi: 10.1038/nbt.2673. Epub Aug. 11, 2013. |
| Pattanayak et al., Revealing off-target cleavage specificities of zinc-finger nucleases by in vitro selection. Nat Methods. Aug. 7, 2011;8(9):765-70. doi: 10.1038/nmeth.1670. |
| Pavletich et al., Zinc finger-DNA recognition: crystal structure of a Zif268-DNA complex at 2.1 A. Science. May 10, 1991;252(5007):809-17. |
| Pennisi et al., The CRISPR craze. Science. Aug. 23, 2013;341(6148):833-6. doi: 10.1126/science.341.6148.833. |
| Pennisi et al., The tale of the TALEs. Science. Dec. 14, 2012;338(6113):1408-11. doi: 10.1126/science.338.6113.1408. |
| Perez et al., Establishment of HIV-1 resistance in CD4+ T cells by genome editing using zinc-finger nucleases. Nat Biotechnol. Jul. 2008;26(7):808-16. Doi: 10.1038/nbt1410. Epub Jun. 29, 2008. |
| Perez-Pinera et al., Advances in targeted genome editing. Curr Opin Chem Biol. Aug. 2012;16(3-4):268-77. doi: 10.1016/j.cbpa.2012.06.007. Epub Jul. 20, 2012. |
| Perez-Pinera et al., RNA-guided gene activation by CRISPR-Cas9-based transcription factors. Nat Methods. Oct. 2013;10(10):973-6. doi: 10.1038/nmeth.2600. Epub Jul. 25, 2013. |
| Petek et al., Frequent endonuclease cleavage at off-target locations in vivo. Mol Ther. May 2010;18(5):983-6. Doi: 10.1038/mt.2010.35. Epub Mar. 9, 2010. |
| Phillips, The challenge of gene therapy and DNA delivery. J Pharm Pharmacol. Sep. 2001;53(9):1169-74. |
| Poller et al., A leucine-to-proline substitution causes a defective alpha 1-antichymotrypsin allele associated with familial obstructive lung disease. Genomics. Sep. 1993;17(3):740-3. |
| Porteus, Design and testing of zinc finger nucleases for use in mammalian cells. Methods Mol Biol. 2008;435:47-61. doi: 10.1007/978-1-59745-232-8_4. |
| Proudfoot et al., Zinc finger recombinases with adaptable DNA sequence specificity. PLoS One. Apr. 29, 2011;6(4):e19537. doi: 10.1371/journal.pone.0019537. |
| Qi et al., Engineering naturally occurring trans-acting non-coding RNAs to sense molecular signals. Nucleic Acids Res. Jul. 2012;40(12):5775-86. doi: 10.1093/nar/gks168. Epub Mar. 1, 2012. |
| Qi et al., Repurposing CRISPR as an RNA-guided platform for sequence-specific control of gene expression. Cell. Feb. 28, 2013;152(5):1173-83. doi: 10.1016/j.cell.2013.02.022. |
| Ramakrishna et al., Gene disruption by cell-penetrating peptide-mediated delivery of Cas9 protein and guide RNA. Genome Res. Jun. 2014;24(6):1020-7. doi: 10.1101/gr.171264.113. Epub Apr. 2, 2014. |
| Ramirez et al., Engineered zinc finger nickases induce homology-directed repair with reduced mutagenic effects. Nucleic Acids Res. Jul. 2012;40(12):5560-8. doi: 10.1093/nar/gks179. Epub Feb. 28, 2012. |
| Ramirez et al., Unexpected failure rates for modular assembly of engineered zinc fingers. Nat Methods. May 2008;5(5):374-5. Doi: 10.1038/nmeth0508-374. |
| Ran et al., Double nicking by RNA-guided CRISPR Cas9 for enhanced genome editing specificity. Cell. Sep. 12, 2013;154(6):1380-9. doi: 10.1016/j.cell.2013.08.021. Epub Aug. 29, 2013. |
| Reynaud et al., What role for AID: mutator, or assembler of the immunoglobulin mutasome? Nat Immunol. Jul. 2003;4(7):631-8. |
| Reyon et al., FLASH assembly of TALENs for high-throughput genome editing. Nat Biotechnol. May 2012;30(5):460-5. doi: 10.1038/nbt.2170. |
| Sage et al., Proliferation of functional hair cells in vivo in the absence of the retinoblastoma protein. Science. Feb. 18, 2005;307(5712):1114-8. Epub Jan. 13, 2005. |
| Samal et al., Cationic polymers and their therapeutic potential. Chem Soc Rev. Nov. 7, 2012;41(21):7147-94. doi: 10.1039/c2cs35094g. Epub Aug. 10, 2012. |
| Sander et al., CRISPR-Cas systems for editing, regulating and targeting genomes. Nat Biotechnol. Apr. 2014;32(4):347-55. doi: 10.1038/nbt.2842. Epub Mar. 2, 2014. |
| Sander et al., In silico abstraction of zinc finger nuclease cleavage profiles reveals an expanded landscape of off-target sites. Nucleic Acids Res. Oct. 2013;41(19):e181. doi: 10.1093/nar/gkt716. Epub Aug. 14, 2013. |
| Sander et al., Targeted gene disruption in somatic zebrafish cells using engineered TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):697-8. doi: 10.1038/nbt.1934. |
| Sang, Prospects for transgenesis in the chick. Mech Dev. Sep. 2004;121(9):1179-86. |
| Santiago et al., Targeted gene knockout in mammalian cells by using engineered zinc-finger nucleases. Proc Natl Acad Sci U S A. Apr. 15, 2008;105(15):5809-14. doi: 10.1073/pnas.0800940105. Epub Mar. 21, 2008. |
| Sapranauskas et al., The Streptococcus thermophilus CRISPR/Cas system provides immunity in Escherichia coli. Nucleic Acids Res. Nov. 2011;39(21):9275-82. doi: 10.1093/nar/gkr606. Epub Aug. 3, 2011. |
| Sashital et al., Mechanism of foreign DNA selection in a bacterial adaptive immune system. Mol Cell. Jun. 8, 2012;46(5):606-15. doi: 10.1016/j.molcel.2012.03.020. Epub Apr. 19, 2012. |
| Schriefer et al., Low pressure DNA shearing: a method for random DNA sequence analysis. Nucleic Acids Res. Dec. 25, 1990;18(24):7455-6. |
| Schwank et al., Functional repair of CFTR by CRISPR/Cas9 in intestinal stem cell organoids of cystic fibrosis patients. Cell Stem Cell. Dec. 5, 2013;13(6):653-8. doi:10.1016/j.stem.2013.11.002. |
| Schwarze et al., In vivo protein transduction: delivery of a biologically active protein into the mouse. Science. Sep. 3, 1999;285(5433):1569-72. |
| Segal et al., Toward controlling gene expression at will: selection and design of zinc finger domains recognizing each of the 5′-GNN-3′ DNA target sequences. Proc Natl Acad Sci U S A. Mar. 16, 1999;96(6):2758-63. |
| Sells et al., Delivery of protein into cells using polycationic liposomes. Biotechniques. Jul. 1995;19(1):72-6, 78. |
| Semenova et al., Interference by clustered regularly interspaced short palindromic repeat (CRISPR) RNA is governed by a seed sequence. Proc Natl Acad Sci U S A. Jun. 21, 2011;108(25):10098-103. doi: 10.1073/pnas.1104144108. Epub Jun. 6, 2011. |
| Shah et al., Kinetic control of one-pot trans-splicing reactions by using a wild-type and designed split intein. Angew Chem Int Ed Engl. Jul. 11, 2011;50(29):6511-5. doi: 10.1002/anie.201102909. Epub Jun. 8, 2011. |
| Shalem et al., Genome-scale CRISPR-Cas9 knockout screening in human cells. Science. Jan. 3, 2014;343(6166):84-7. doi: 10.1126/science.1247005. Epub Dec. 12, 2013. |
| Sheridan, First CRISPR-Cas patent opens race to stake out intellectual property. Nat Biotechnol. 2014;32(7):599-601. |
| Sheridan, Gene therapy finds its niche. Nat Biotechnol. Feb. 2011;29(2):121-8. doi: 10.1038/nbt.1769. |
| Siebert et al., An improved PCR method for walking in uncloned genomic DNA. Nucleic Acids Res. Mar. 25, 1995;23(6):1087-8. |
| Sternberg et al., DNA interrogation by the CRISPR RNA-guided endonuclease Cas9. Nature.Mar. 6, 2014;507(7490):62-7. doi: 10.1038/nature13011. Epub Jan. 29, 2014. |
| Szczepek et al., Structure-based redesign of the dimerization interface reduces the toxicity of zinc-finger nucleases. Nat Biotechnol. Jul. 2007;25(7):786-93. Epub Jul. 1, 2007. |
| Tebas et al., Gene editing of CCR5 in autologous CD4 T cells of persons infected with HIV. N Engl J Med. Mar. 6, 2014;370(10):901-10. doi: 10.1056/NEJMoa1300662. |
| Tessarollo et al., Targeted mutation in the neurotrophin-3 gene results in loss of muscle sensory neurons. Proc Natl Acad Sci U S A. Dec. 6, 1994;91(25):11844-8. |
| Tesson et al., Knockout rats generated by embryo microinjection of TALENs. Nat Biotechnol. Aug. 5, 2011;29(8):695-6. doi: 10.1038/nbt.1940. |
| Thompson et al., Engineering and identifying supercharged proteins for macromolecule delivery into mammalian cells. Methods Enzymol. 2012;503:293-319. doi: 10.1016/B978-0-12-396962-0.00012-4. |
| Thorpe et al., Functional correction of episomal mutations with short DNA fragments and RNA-DNA oligonucleotides. J Gene Med. Mar.-Apr. 2002;4(2):195-204. |
| Tsai et al., Dimeric CRISPR RNA-guided FokI nucleases for highly specific genome editing. Nat Biotechnol. Jun. 2014;32(6):569-76. doi: 10.1038/nbt.2908. Epub Apr. 25, 2014. |
| Turan et al., Site-specific recombinases: from tag-and-target- to tag-and-exchange-based genomic modifications. FASEB J. Dec. 2011;25(12):4088-107. doi: 10.1096/fj.11-186940. Epub Sep. 2, 2011. Review. |
| Uniprot Submission; UniProt, Accession No. P01011. Last modified Jun. 11, 2014, version 2. 15 pages. |
| UniProt Submission; UniProt, Accession No. P01011. Last modified Sep. 18, 2013, version 2. 15 pages. |
| UniProt Submission; UniProt, Accession No. P04264. Last modified Jun. 11, 2014, version 6. 15 pages. |
| UniProt Submission; UniProt, Accession No. P04275. Last modified Jul. 9, 2014, version 107. 29 pages. |
| Urnov et al., Genome editing with engineered zinc finger nucleases. Nat Rev Genet. Sep. 2010;11(9):636-46. doi: 10.1038/nrg2842. |
| Urnov et al., Highly efficient endogenous human gene correction using designed zinc-finger nucleases. Nature. Jun. 2, 2005;435(7042):646-51. Epub Apr. 3, 2005. |
| Vanamee et al., FokI requires two specific DNA sites for cleavage. J Mol Biol. May 25, 2001;309(1):69-78. |
| Wacey et al., Disentangling the perturbational effects of amino acid substitutions in the DNA-binding domain of p53. Hum Genet. Jan. 1999;104(1):15-22. |
| Wadia et al., Modulation of cellular function by TAT mediated transduction of full length proteins. Curr Protein Pept Sci. Apr. 2003;4(2):97-104. |
| Wadia et al., Transducible TAT-HA fusogenic peptide enhances escape of TAT-fusion proteins after lipid raft macropinocytosis. Nat Med. Mar. 2004;10(3):310-5. Epub Feb. 8, 2004. |
| Wah et al., Structure of FokI has implications for DNA cleavage. Proc Natl Acad Sci U S A. Sep. 1, 1998 ;95(18):10564-9. |
| Wang et al., Genetic screens in human cells using the CRISPR-Cas9 system. Science. Jan. 3, 2014;343(6166):80-4. doi: 10.1126/science.1246981. Epub Dec. 12, 2013. |
| Wang et al., One-step generation of mice carrying mutations in multiple genes by CRISPR/Cas-mediated genome engineering. Cell. May 9, 2013;153(4):910-8. doi: 10.1016/j.ce11.2013.04.025. Epub May 2, 2013. |
| Wang et al., Riboswitches that sense S-adenosylhomocysteine and activate genes involved in coenzyme recycling. Mol Cell. Mar. 28, 2008;29(6):691-702. doi: 10.1016/j.molcel.2008.01.012. |
| Wang et al., Targeted gene addition to a predetermined site in the human genome using a ZFN-based nicking enzyme. Genome Res. Jul. 2012;22(7):1316-26. doi: 10.1101/gr.122879.111. Epub Mar. 20, 2012. |
| Wang et al., Efficient delivery of genome-editing proteins using bioreducible lipid nanoparticles. Proc Natl Acad Sci U S A. Feb. 29, 2016. pii: 201520244. [Epub ahead of print]. |
| Weber et al., Assembly of designer TAL effectors by Golden Gate cloning. PLoS One. 2011;6(5):e19722. doi:10.1371/journal.pone.0019722. Epub May 19, 2011. |
| Weinberger et al., Disease-causing mutations C277R and C277Y modify gating of human ClC-1 chloride channels in myotonia congenita. J Physiol. Aug. 1, 2012;590(Pt 15):3449-64. doi: 0.1113/jphysiol.2012.232785. Epub May 28, 2012. |
| Wiedenheft et al., RNA-guided genetic silencing systems in bacteria and archaea. Nature. Feb. 15, 2012;482(7385):331-8. doi: 10.1038/nature10886. Review. |
| Wolfe et al., Analysis of zinc fingers optimized via phage display: evaluating the utility of a recognition code. J Mol Biol. Feb. 5, 1999;285(5):1917-34. |
| Wood et al., Targeted genome editing across species using ZFNs and TALENs. Science. Jul. 15, 2011;333(6040):307. doi: 10.1126/science.1207773. Epub Jun. 23, 2011. |
| Wu et al., Correction of a genetic disease in mouse via use of CRISPR-Cas9. Cell Stem Cell. Dec. 5, 2013;13(6):659-62. doi: 10.1016/j.stem.2013.10.016. |
| Yanover et al., Extensive protein and DNA backbone sampling improves structure-based specificity prediction for C2H2 zinc fingers. Nucleic Acids Res. Jun. 2011;39(11):4564-76. doi: 10.1093/nar/gkr048. Epub Feb. 22, 2011. |
| Yazaki et al., Hereditary systemic amyloidosis associated with a new apolipoprotein AII stop codon mutation Stop78Arg. Kidney Int. Jul. 2003;64(1):11-6. |
| Yin et al., Genome editing with Cas9 in adult mice corrects a disease mutation and phenotype. Nat Biotechnol. Jun. 2014;32(6):551-3. doi: 10.1038/nbt.2884. Epub Mar. 30, 2014. |
| Zhang et al., Conditional gene manipulation: Cre-ating a new biological era. J Zhejiang Univ Sci B. Jul. 2012;13(7):511-24. doi: 10.1631/jzus.B1200042. Review. |
| Zhang et al., CRISPR/Cas9 for genome editing: progress, implications and challenges. Hum Mol Genet. Sep. 15, 2014;23(R1):R40-6. doi: 10.1093/hmg/ddu125. Epub Mar. 20, 2014. |
| Zhang et al., Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription. Nat Biotechnol. Feb. 2011;29(2):149-53. doi: 10.1038/nbt.1775. Epub Jan. 19, 2011. |
| Zou et al., Gene targeting of a disease-related gene in human induced pluripotent stem and embryonic stem cells. Cell Stem Cell. Jul. 2, 2009;5(1):97-110. doi: 10.1016/j.stem.2009.05.023. Epub Jun. 18, 2009. |
| Abudayyeh et al., C2c2 is a single-component programmable RNA-guided RNA-targeting CRISPR effector. Science Aug. 2016;353(6299):aaf5573. DOI: 10.1126/science.aaf5573. |
| Addgene Plasmid # 44246. pdCas9-humanized, 2017, Stanley Qi. |
| Addgene Plasmid # 73021. PCMV-BE3, 2017, David Liu. |
| Addgene Plasmid # 79620. pcDNA3.1_pCMV-nCas-PmCDA1-ugi pH1-gRNA(HPRT), 2017, Akihiko Kondo. |
| Anders et al., Structural basis of PAM-dependent target DNA recognition by the Cas9 endonuclease. Nature. Sep. 25, 2014;513(7519):569-73. doi: 10.1038/nature13579. Epub Jul. 27, 2014. |
| Barnes et al., Repair and genetic consequences of endogenous DNA base damage in mammalian cells. Annu Rev Genet. 2004;38:445-76. |
| Beale et al., Comparison of the differential context-dependence of DNA deamination by APOBEC enzymes: correlation with mutation spectra in vivo. J Mol Biol. Mar. 26, 2004;337(3):585-96. |
| Begley, Scientists unveil the ‘most clever CRISPR gadget’ so far. STAT, Apr. 20, 2016. https://www.statnews.com/2016/04/20/clever-crispr-advance-unveiled/. |
| Billon et al., CRISPR-Mediated Base Editing Enables Efficient Disruption of Eukaryotic Genes through Induction of STOP Codons. Mol Cell. Sep. 21, 2017;67(6):1068-1079.e4. doi: 10.1016/j.molcel.2017.08.008. Epub Sep. 7, 2017. |
| Birling et al., Site-specific recombinases for manipulation of the mouse genome. Methods Mol Biol. 2009;561:245-63. doi: 10.1007/978-1-60327-019-9_16. |
| Bitinaite et al., FokI dimerization is required for DNA cleavage. Proc Natl Acad Sci U S A. Sep. 1, 1998;95(18):10570-5. |
| Bolotin et al., Clustered regularly interspaced short palindrome repeats (CRISPRs) have spacers of extrachromosomal origin. Microbiology. Aug. 2005;151(Pt 8):2551-61. |
| Borman, Improved route to single-base genome editing. Chemical & Engineering News, Apr. 25, 2016;94(17)p5. http://cen.acs.org/articles/94/i17/Improved-route-single-base-genome.html. |
| Briner et al., Guide RNA functional modules direct Cas9 activity and orthogonality. Mol Cell. Oct. 23, 2014;56(2):333-339. doi: 10.1016/j.molcel.2014.09.019 . . . . |
| Britt et al., Re-engineering plant gene targeting. Trends Plant Sci. Feb. 2003;8(2):90-5. |
| Brouns et al., Small CRISPR RNAs guide antiviral defense in prokaryotes. Science. Aug. 15, 2008;321(5891):960-4. doi: 10.1126/science.1159689. |
| Brusse et al., Spinocerebellar ataxia associated with a mutation in the fibroblast growth factor 14 gene (SCA27): A new phenotype. Mov Disord. Mar. 2006;21(3):396-401. |
| Buchholz et al., Alteration of Cre recombinase site specificity by substrate-linked protein evolution. Nat Biotechnol. Nov. 2001;19(11):1047-52. |
| Buchwald et al., Long-term, continuous intravenous heparin administration by an implantable infusion pump in ambulatory patients with recurrent venous thrombosis. Surgery. Oct. 1980;88(4):507-16. |
| Burstein et al., New CRISPR-Cas systems from uncultivated microbes. Nature Feb. 2017;542(7640):237-240. |
| Caldecott et al., Single-strand break repair and genetic disease. Nat Rev Genet. Aug. 2008;9(8):619-31. doi: 10.1038/nrg2380. |
| Chadwick et al., In Vivo Base Editing of PCSK9 (Proprotein Convertase Subtilisin/Kexin Type 9) as a Therapeutic Alternative to Genome Editing. Arterioscler Thromb Vasc Biol. Sep. 2017;37(9):1741-1747. doi: 10.1161/ATVBAHA.117.309881. Epub Jul. 27, 2017. |
| Chaikind et al., A programmable Cas9-serine recombinase fusion protein that operates on DNA sequences in mammalian cells. Nucleic Acids Res. Nov. 16, 2016;44(20):9758-9770. Epub Aug. 11, 2016. |
| Chavez et al., Highly efficient Cas9-mediated transcriptional programming. Nat Methods. Apr. 2015;12(4):326-8. doi: 10.1038/nmeth.3312. Epub Mar. 2, 2015. |
| Chavez et al., Precise Cas9 targeting enables genomic mutation prevention. Jun. 14, 2016. doi:https://doi.org/10.1101/058974. [Preprint]. |
| Chavez et al., Precise Cas9 targeting enables genomic mutation prevention. Proc Natl Acad Sci U S A. Apr. 3, 2018;115(14):3669-3673. doi: 10.1073/pnas.1718148115. Epub Mar. 19, 2018. |
| Chavez et al., Therapeutic applications of the PhiC31 integrase system. Curr Gene Ther. Oct. 2011;11(5):375-81. Review. |
| Chelico et al., Stochastic properties of processive cytidine DNA deaminases AID and APOBEC3G. Philos Trans R Soc Lond B Biol Sci. Mar. 12, 2009;364(1517):583-93. doi: 10.1098/rstb.2008.0195. |
| Chen et al., Structure of the DNA deaminase domain of the HIV-1 restriction factor APOBEC3G. Nature. Mar. 6, 2008;452(7183):116-9. doi: 10.1038/nature06638. Epub Feb. 20, 2008. |
| Chew et al., A multifunctional AAV-CRISPR-Cas9 and its host response. Nat Methods. Oct. 2016;13(10):868-74. doi: 10.1038/nmeth.3993. Epub Sep. 5, 2016. |
| Chu et al., Increasing the efficiency of homology-directed repair for CRISPR-Cas9-induced precise gene editing in mammalian cells. Nat Biotech. Feb. 13, 2015;33:543-8. |
| Covino et al., The CCL2/CCR2 Axis in the Pathogenesis of HIV-1 Infection: A New Cellular Target for Therapy? Current Drug Targets Dec. 2016;17(1):76-110. DOI : 10.2174/138945011701151217110917. |
| Cox et al., Conditional gene expression in the mouse inner ear using Cre-loxP. J Assoc Res Otolaryngol. Jun. 2012;13(3):295-322. doi: 10.1007/s10162-012-0324-5. Epub Apr. 24, 2012. |
| Cox et al., Therapeutic genome editing: prospects and challenges. Nat Med. Feb. 2015;21(2):121-31. doi: 10.1038/nm.3793. |
| Cunningham et al., Ensembl 2015. Nucleic Acids Res. Jan. 2015;43(Database issue):D662-9. doi: 10.1093/nar/gku1010. Epub Oct. 28, 2014. |
| Davis et al., DNA double strand break repair via non-homologous end-joining. Transl Cancer Res. Jun. 2013;2(3):130-143. |
| Davis et al., Small molecule-triggered Cas9 protein with improved genome-editing specificity. Nat Chem Biol. May 2015;11(5):316-8. doi: 10.1038/nchembio.1793. Epub Apr. 6, 2015. |
| Dicarlo et al., Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic Acids Research Apr. 2013;41(7):4336-43. |
| Ding et al., Permanent alteration of PCSK9 with in vivo CRISPR-Cas9 genome editing. Circ Res. Aug. 15, 2014;115(5):488-92. doi: 10.1161/CIRCRESAHA.115.304351. Epub Jun. 10, 2014. |
| Doench et al., Optimized sgRNA design to maximize activity and minimize off-target effects of CRISPR-Cas9. Nat Biotechnol. Feb. 2016;34(2):184-191. doi: 10.1038/nbt.3437. |
| Dormiani et al., Long-term and efficient expression of human β-globin gene in a hematopoietic cell line using a new site-specific integrating non-viral system. Gene Ther. Aug. 2015;22(8):663-74. doi: 10.1038/gt.2015.30. Epub Apr. 1, 2015. |
| Doudna et al., Genome editing. The new frontier of genome engineering with CRISPR-Cas9. Science. Nov. 28, 2014;346(6213):1258096. doi: 10.1126/science.1258096. |
| Dunaime, Breakthrough method means CRISPR just got a lot more relevant to human health. The Verge. Apr. 20, 2016. http://www.theverge.com/2016/4/20/11450262/crispr-base-editing-single-nucleotides-dna-gene-liu-harvard. |
| During et al., Controlled release of dopamine from a polymeric brain implant: in vivo characterization. Ann Neurol. Apr. 1989;25(4):351-6. |
| East-Seletsky et al., Two distinct RNase activities of CRISPR-C2c2 enable guide-RNA processing and RNA detection. Nature Oct. 2016;538(7624):270-3. |
| Endo et al., Toward establishing an efficient and versatile gene targeting system in higher plants. Biocatalysis and Agricultural Biotechnology 2014;3,(1):2-6. |
| Extended European Search Report for EP 15830407.1, dated Mar. 2, 2018. |
| Fang et al., Synthetic Studies Towards Halichondrins: Synthesis of the Left Halves of Norhalichondrins and Homohalichondrins. Tetrahedron Letters 1992;33(12):1557-1560. |
| Ferretti et al., Complete genome sequence of an M1 strain of Streptococcus pyogenes. Proc Natl Acad Sci U S A. Apr. 10, 2001;98(8):4658-63. |
| Ferry et al., Rational design of inducible CRISPR guide RNAs for de novo assembly of transcriptional programs. Nat Commun. Mar. 3, 2017;8:14633. doi: 10.1038/ncomms14633. |
| Fine et al., Trans-spliced Cas9 allows cleavage of HBB and CCR5 genes in human cells using compact expression cassettes. Scientific Reports 2015;5(1):Article No. 10777. doi:10.1038/srep10777. With Supplementary Information. |
| Fischer et al., Cryptic epitopes induce high-titer humoral immune response in patients with cancer. J Immunol. Sep. 1, 2010;185(5):3095-102. doi: 10.4049/jimmunol.0902166. Epub Jul. 26, 2010. |
| Freshney, Culture of Animal Cells. A Manual of Basic Technique. Alan R. Liss, Inc. New York. 1983;4. |
| Fukui et al., DNA Mismatch Repair in Eukaryotes and Bacteria. J Nucleic Acids. Jul. 27, 2010;2010. pii: 260512. doi: 10.4061/2010/260512. |
| Fung et al., Repair at single targeted DNA double-strand breaks in pluripotent and differentiated human cells. PLoS One. 2011;6(5):e20514. doi: 10.1371/journal.pone.0020514. Epub May 25, 2011. |
| Gaj et al., A comprehensive approach to zinc-finger recombinase customization enables genomic targeting in human cells. Nucleic Acids Res. Feb. 6, 2013;41(6):3937-46. |
| Gaj et al., Enhancing the specificity of recombinase-mediated genome engineering through dimer interface redesign. J Am Chem Soc. Apr. 2, 2014;136(13):5047-56. doi: 10.1021/ja4130059. Epub Mar. 20, 2014. |
| Gaj et al., Expanding the scope of site-specific recombinases for genetic and metabolic engineering. Biotechnol Bioeng. Jan. 2014;111(1):1-15. doi: 10.1002/bit.25096. Epub Sep. 13, 2013. |
| Gao et al., DNA-guided genome editing using the Natronobacterium gregoryi Argonaute. Nat Biotechnol. Jul. 2016;34(7):768-73. doi: 10.1038/nbt.3547. Epub May 2, 2016. |
| Gardlik et al., Vectors and delivery systems in gene therapy. Med Sci Monit. Apr. 2005;11(4):RA110-21. Epub Mar. 24, 2005. |
| Garneau et al., The CRISPR/Cas bacterial immune system cleaves bacteriophage and plasmid DNA. Nature. Nov. 4, 2010;468(7320):67-71. doi: 10.1038/nature09523. |
| Gersbach et al., Directed evolution of recombinase specificity by split gene reassembly. Nucleic Acids Res. Jul. 2010;38(12):4198-206. doi: 10.1093/nar/gkq125. Epub Mar. 1, 2010. |
| Gersbach et al., Targeted plasmid integration into the human genome by an engineered zinc-finger recombinase. Nucleic Acids Res. Sep. 1, 2011;39(17):7868-78. doi: 10.1093/nar/gkr421. Epub Jun. 7, 2011. |
| Gonzalez et al., An iCRISPR platform for rapid, multiplexable, and inducible genome editing in human pluripotent stem cells. Cell Stem Cell. Aug. 7, 2014;15(2):215-26. doi: 10.1016/j.stem.2014.05.018. Epub Jun. 12, 2014. |
| Haeussler et al., Evaluation of off-target and on-target scoring algorithms and integration into the guide RNA selection tool CRISPOR. Genome Biol. Jul. 5, 2016;17(1):148. doi: 10.1186/s13059-016-1012-2. |
| Han, New CRISPR/Cas9-based Tech Edits Single Nucleotides Without Breaking DNA. Genome Web, Apr. 20, 2016. https://www.genomeweb.com/gene-silencinggene-editing/new-crisprcas9-based-tech-edits-single-nucleotides-without-breaking-dna. |
| Harris et al., RNA editing enzyme APOBEC1 and some of its homologs can act as DNA mutators. Mol Cell. Nov. 2002;10(5):1247-53. |
| Heller et al., Replisome assembly and the direct restart of stalled replication forks. Nat Rev Mol Cell Biol. Dec. 2006;7(12):932-43. Epub Nov. 8, 2006. |
| Hess et al., Directed evolution using dCas9-targeted somatic hypermutation in mammalian cells. Nat Methods. Dec. 2016;13(12):1036-1042. doi: 10.1038/nmeth.4038. Epub Oct. 31, 2016. |
| Hickford et al., Antitumour polyether macrolides: four new halichondrins from the New Zealand deep-water marine sponge Lissodendoryx sp. Bioorg Med Chem. Mar. 15, 2009;17(6):2199-203. doi: 10.1016/j.bmc.2008.10.093. Epub Nov. 19, 2008. |
| Hilton et al., Enabling functional genomics with genome engineering. Genome Res. Oct. 2015;25(10):1442-55. doi: 10.1101/gr.190124.115. |
| Hondares et al., Peroxisome Proliferator-activated Receptor α (PPARα) Induces PPARγ Coactivator 1α (PGC-1α) Gene Expression and Contributes to Thermogenic Activation of Brown Fat. J Biol. Chem Oct. 2011; 286(50):43112-22. doi: 10.1074/jbc.M111.252775. |
| Hou et al., Efficient genome engineering in human pluripotent stem cells using Cas9 from Neisseria meningitidis. Proc Natl Acad Sci U S A. Sep. 24, 2013;110(39):15644-9. doi: 10.1073/pnas.1313587110. Epub Aug. 12, 2013. |
| Howard et al., Intracerebral drug delivery in rats with lesion-induced memory deficits. J Neurosurg. Jul. 1989;71(1):105-12. |
| Hower et al., Shape-based peak identification for ChIP-Seq. BMC Bioinformatics. Jan. 12, 2011;12:15. doi: 10.1186/1471-2105-12-15. |
| Hu et al., Chemical Biology Approaches to Genome Editing: Understanding, Controlling, and Delivering Programmable Nucleases. Cell Chem Biol. Jan. 21, 2016;23(1):57-73. doi: 10.1016/j.chembiol.2015.12.009. |
| Hwang et al., Efficient In Vivo Genome Editing Using RNA-Guided Nucleases. Nat Biotechnol. Mar. 2013; 31(3): 227-229. doi: 10.1038/nbt.2501. Epub Jan. 29, 2013. |
| International Preliminary Report on Patentability for PCT/US2016/058344, dated May 3, 2018. |
| International Preliminary Report on Patentability for PCT/US2015/042770, dated Dec. 19, 2016. |
| International Preliminary Report on Patentability for PCT/US2015/058479, dated May 11, 2017. |
| International Search Report and Written Opinion for PCT/US2016/044546, dated Dec. 28, 2016. |
| International Search Report and Written Opinion for PCT/US2016/058344, dated Apr. 20, 2017. |
| International Search Report and Written Opinion for PCT/US2017/045381, dated Oct. 26, 2017. |
| International Search Report and Written Opinion for PCT/US2017/046144, dated Oct. 10, 2017. |
| International Search Report and Written Opinion for PCT/US2017/056671, dated Feb. 20, 2018. |
| International Search Report and Written Opinion for PCT/US2017/068105, dated Apr. 4, 2018. |
| International Search Report and Written Opinion for PCT/US2017/068114, dated Mar. 20, 2018. |
| International Search Report and Written Opinion for PCT/US2017/48390, dated Jan. 9, 2018. |
| International Search Report for PCT/US2018/021664, dated Jun. 21, 2018. |
| International Search Report for PCT/US2018/021878, dated Aug. 20, 2018. |
| International Search Report for PCT/US2018/021880, dated Jun. 20, 2018. |
| International Search Report for PCT/US2018/024208, dated Aug. 23, 2018. |
| International Search Report for PCT/US2018/025887, dated Jun. 21, 2018. |
| International Search Report for PCT/US2018/032460, dated Jul. 11, 2018. |
| Invitation to Pay Additional Fees for PCT/US2016/058344, dated Mar. 1, 2017. |
| Invitation to Pay Additional Fees for PCT/US2017/056671, dated Dec. 21, 2017. |
| Invitation to Pay Additional Fees for PCT/US2017/48390, dated Nov. 7, 2017. |
| Invitation to Pay Additional Fees for PCT/US2018/021878, dated Jun. 8, 2018. |
| Ishino et al., Nucleotide sequence of the iap gene, responsible for alkaline phosphatase isozyme conversion in Escherichia coli, and identification of the gene product. J Bacteriol. Dec. 1987;169(12):5429-33. |
| Jansen et al., Identification of genes that are associated with DNA repeats in prokaryotes. Mol Microbiol. Mar. 2002;43(6):1565-75. |
| Jiang et al., Structures of a CRISPR-Cas9 R-loop complex primed for DNA cleavage. Science. Feb. 19, 2016;351(6275):867-71. doi: 10.1126/science.aad8282. Epub Jan. 14, 2016. |
| Karpinsky et al., Directed evolution of a recombinase that excises the provirus of most HIV-1 primary isolates with high specificity. Nat Biotechnol. Apr. 2016;34(4):401-9. doi: 10.1038/nbt.3467. Epub Feb. 22, 2016. |
| Kaya et al., A bacterial Argonaute with noncanonical guide RNA specificity. Proc. Natl. Acad. Sci. USA Apr. 2016;113(15):4057-62. |
| Kellendonk et al., Regulation of Cre recombinase activity by the synthetic steroid RU 486. Nucleic Acids Res. Apr. 15, 1996;24(8):1404-11. |
| Kim et al., Genome-wide target specificities of CRISPR RNA-guided programmable deaminases. Nat Biotechnol. May 2017;35(5):475-480. doi: 10.1038/nbt.3852. Epub Apr. 10, 2017. |
| Kim et al., Highly efficient RNA-guided base editing in mouse embryos. Nat Biotechnol. May 2017;35(5):435-437. doi: 10.1038/nbt.3816. Epub Feb. 27, 2017. |
| Kim et al., Increasing the genome-targeting scope and precision of base editing with engineered Cas9-cytidine deaminase fusions. Nat Biotechnol. Apr. 2017;35(4):371-376. doi: 10.1038/nbt.3803. Epub Feb. 13, 2017. |
| Kim et al., The role of apolipoprotein E in Alzheimer's disease. Neuron. Aug. 13, 2009;63(3):287-303. doi: 10.1016/j.neuron.2009.06.026. |
| Kim et al., Transcriptional repression by zinc finger peptides. Exploring the potential for applications in gene therapy. J Biol Chem. Nov. 21, 1997;272(47):29795-800. |
| Kitamura et al., Uracil DNA glycosylase counteracts APOBEC3G-induced hypermutation of hepatitis B viral genomes: excision repair of covalently closed circular DNA. PLoS Pathog. 2013;9(5):e1003361. doi: 10.1371/journal.ppat.1003361. Epub May 16, 2013. |
| Kleinstiver et al., Broadening the targeting range of Staphylococcus aureus CRISPR-Cas9 by modifying PAM recognition. Nat Biotechnol. Dec. 2015;33(12):1293-1298. doi: 10.1038/nbt.3404. Epub Nov. 2, 2015. |
| Kleinstiver et al., Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature. Jul. 23, 2015;523(7561):481-5. doi: 10.1038/nature14592. Epub Jun. 22, 2015. |
| Kleinstiver et al., High-fidelity CRISPR-Cas9 nucleases with no detectable genome-wide off-target effects. Nature. Jan. 28, 2016;529(7587):490-5. doi: 10.1038/nature16526. Epub Jan. 6, 2016. |
| Kleinstiver et al., Monomeric site-specific nucleases for genome editing. Proc Natl Acad Sci U S A. May 22, 2012;109(21):8061-6. doi: 10.1073/pnas.1117984109. Epub May 7, 2012. |
| Klippel et al., Isolation and characterization of unusual gin mutants. EMBO J. Dec. 1, 1988;7(12):3983-9. |
| Klippel et al., The DNA invertase Gin of phage Mu: formation of a covalent complex with DNA via a phosphoserine at amino acid position 9. EMBO J. Apr. 1988;7(4):1229-37. |
| Kohli et al., Local sequence targeting in the AID/APOBEC family differentially impacts retroviral restriction and antibody diversification. J Biol Chem. Dec. 24, 2010;285(52):40956-64. doi: 10.1074/jbc.M110.177402. Epub Oct. 6, 2010. |
| Komor et al., CRISPR-Based Technologies for the Manipulation of Eukaryotic Genomes. Cell. Jan. 12, 2017;168(1-2):20-36. doi: 10.1016/j.cell.2016.10.044. |
| Komor et al., Improved base excision repair inhibition and bacteriophage Mu Gam protein yields C:G-to-T:A base editors with higher efficiency and product purity. Sci Adv. Aug. 30, 2017;3(8):eaao4774. doi: 10.1126/sciadv.aao4774. eCollection Aug. 2017. |
| Komor et al., Programmable editing of a target base in genomic DNA without double-stranded DNA cleavage. Nature. Apr. 20, 2016;533(7603):420-4. doi: 10.1038/nature17946. |
| Kouzminova et al., Patterns of chromosomal fragmentation due to uracil-DNA incorporation reveal a novel mechanism of replication-dependent double-stranded breaks. Mol Microbiol. Apr. 2008;68(1):202-15. doi: 10.1111/j.1365-2958.2008.06149.x. |
| Kunz et al., DNA Repair in mammalian cells: Mismatched repair: variations on a theme. Cell Mol Life Sci. Mar. 2009;66(6):1021-38. doi: 10.1007/s00018-009-8739-9. |
| Kury et al., De Novo Disruption of the Proteasome Regulatory Subunit PSMD12 Causes a Syndromic Neurodevelopmental Disorder. Am J Hum Genet. Feb. 2, 2017;100(2):352-363. doi: 10.1016/j.ajhg.2017.01.003. Epub Jan. 26, 2017. |
| Kuscu et al., CRISPR-STOP: gene silencing through base-editing-induced nonsense mutations. Nat Methods. Jul. 2017;14(7):710-712. doi: 10.1038/nmeth.4327. Epub Jun. 5, 2017. |
| Kuscu et al., Genome-wide analysis reveals characteristics of off-target sites bound by the Cas9 endonuclease. Nat Biotechnol. Jul. 2014;32(7):677-83. doi: 10.1038/nbt.2916. Epub May 18, 2014. |
| Landrum et al., ClinVar: public archive of interpretations of clinically relevant variants. Nucleic Acids Res. Jan. 4, 2016;44(D1):D862-8. doi: 10.1093/nar/gkv1222. Epub Nov. 17, 2015. |
| Langer et al., Chemical and Physical Structure of Polymers as Carriers for Controlled Release of Bioactive Agents: A Review. Journal of Macromolecular Science, 2006;23(1):61-126. DOI: 10.1080/07366578308079439. |
| Langer et al., New methods of drug delivery. Science. Sep. 28, 1990;249(4976):1527-33. |
| Lau et al., Molecular basis for discriminating between normal and damaged bases by the human alkyladenine glycosylase, AAG. Proc Natl Acad Sci U S A. Dec. 5, 2000;97(25):13573-8. |
| Ledford, Gene-editing hack yields pinpoint precision. Nature, Apr. 20, 2016. http://www.nature.com/news/gene-editing-hack-yields-pinpoint-precision-1.19773. |
| Lee et al., A chimeric thyroid hormone receptor constitutively bound to DNA requires retinoid X receptor for hormone-dependent transcriptional activation in yeast. Mol Endocrinol. Sep. 1994;8(9):1245-52. |
| Lee et al., Failure to detect DNA-guided genome editing using Natronobacterium gregoryi Argonaute. Nat Biotechnol. Nov. 28, 2016;35(1):17-18. doi: 10.1038/nbt.3753. |
| Lee et al., Recognition of liposomes by cells: in vitro binding and endocytosis mediated by specific lipid headgroups and surface charge density. Biochim Biophys Acta. Jan. 31, 1992;1103(2):185-97. |
| Lee et al., Ribozyme Mediated gRNA Generation for In Vitro and In Vivo CRISPR/Cas9 Mutagenesis. PLoS One. Nov. 10, 2016;11(11):e0166020. doi: 10.1371/journal.pone.0166020. eCollection 2016. |
| Levy et al., Inhibition of calcification of bioprosthetic heart valves by local controlled-release diphosphonate. Science. Apr. 12, 1985;228(4696):190-2. |
| Lewis et al., Building the Class 2 CRISPR-Cas Arsenal. Mol Cell 2017;65(3);377-379. |
| Li et al., Base editing with a Cpf1-cytidine deaminase fusion. Nat Biotechnol. Apr. 2018;36(4):324-327. doi: 10.1038/nbt.4102. Epub Mar. 19, 2018. |
| Li et al., Generation of Targeted Point Mutations in Rice by a Modified CRISPR/Cas9 System. Mol Plant. Mar. 6, 2017;10(3):526-529. doi: 10.1016/j.molp.2016.12.001. Epub Dec. 8, 2016. |
| Li et al., Highly efficient and precise base editing in discarded human tripronuclear embryos. Protein Cell. Aug. 19, 2017. doi: 10.1007/s13238-017-0458-7. [Epub ahead of print]. |
| Li et al., Multiplex and homologous recombination-mediated genome editing in Arabidopsis and Nicotiana benthamiana using guide RNA and Cas9. Nat Biotechnol. Aug. 2013;31(8):688-91. doi: 10.1038/nbt.2654. |
| Liang et al., Rapid and highly efficient mammalian cell engineering via Cas9 protein transfection. Send to; J Biotechnol. Aug. 20, 2015;208:44-53. doi: 10.1016/j.jbiotec.2015.04.024. |
| Lieber et al., Mechanism and regulation of human non-homologous DNA end-joining. Nat Rev Mol Cell Biol. Sep. 2003;4(9):712-20. |
| Lin et al., Enhanced homology-directed human genome engineering by controlled timing of CRISPR/Cas9 delivery. Elife. Dec. 15, 2014;3:e04766. doi: 10.7554/eLife.04766. |
| Liu et al., C2c1-sgRNA Complex Structure Reveals RNA-Guided DNA Cleavage Mechanism. Molecular Cell Jan. 2017;65(2):310-22. |
| Liu et al., Apolipoprotein E and Alzheimer disease: risk, mechanisms and therapy. Nat Rev Neurol. Feb. 2013;9(2):106-18. doi: 10.1038/nrneurol.2012.263. Epub Jan. 8, 2013. |
| Liu et al., Balancing AID and DNA repair during somatic hypermutation. Trends Immunol. Apr. 2009;30(4):173-81. doi: 10.1016/j.it.2009.01.007. |
| Liu et al., Distance determination by GIY-YIG intron endonucleases: discrimination between repression and cleavage functions. Nucleic Acids Res. Mar. 31, 2006;34(6):1755-64. Print 2006. |
| Losey et al., Crystal structure of Staphylococcus sureus tRNA adenosine deaminase tadA in complex with RNA. Nature Struct. Mol. Biol. Feb. 2006;13(2):153-9. |
| Lu et al., Precise Editing of a Target Base in the Rice Genome Using a Modified CRISPR/Cas9 System. Mol Plant. Mar. 6, 2017;10(3):523-525. doi: 10.1016/j.molp.2016.11.013. Epub Dec. 6, 2016. |
| Lundquist et al., Site-directed mutagenesis and characterization of uracil-DNA glycosylase inhibitor protein. Role of specific carboxylic amino acids in complex formation with Escherichia coli uracil-DNA glycosylase. J Biol Chem. Aug. 22, 1997;272(34):21408-19. |
| Lyons et al., Efficient Recognition of an Unpaired Lesion by a DNA Repair Glycosylase. J. Am. Chem. Soc., 2009;131(49):17742-3. DOI: 10.1021/ja908378y. |
| Ma et al., Targeted AID-mediated mutagenesis (TAM) enables efficient genomic diversification in mammalian cells. Nature Methods. Oct. 2016;13:1029-35. doi:10.1038/nmeth.4027. |
| Makarova et al., Prokaryotic homologs of Argonaute proteins are predicted to function as key components of a novel system of defense against mobile genetic elements. Biology Direct 2009;4:29. |
| Makarova et al., An updated evolutionary classification of CRISPR-Cas systems. Nat Rev Microbiol. Nov. 2015;13(11):722-36. doi: 10.1038/nrmicro3569. Epub Sep. 28, 2015. |
| Makarova et al., Evolution and classification of the CRISPR-Cas systems. Nat Rev Microbiol. Jun. 2011;9(6):467-77. doi: 10.1038/nrmicro2577. Epub May 9, 2011. |
| Marioni et al., DNA methylation age of blood predicts all-cause mortality in later life. Genome Biol. Jan. 30, 2015;16:25. doi: 10.1186/s13059-015-0584-6. |
| Marraffini et al., CRISPR interference limits horizontal gene transfer in Staphylococci by targeting DNA. Science. Dec. 19, 2008;322(5909):1843-5. doi: 10.1126/science.1165771. |
| Maruyama et al., Increasing the efficiency of precise genome editing with CRISPR-Cas9 by inhibition of nonhomologous end joining. Nat Biotechnol. May 2015;33(5):538-42. doi: 10.1038/nbt.3190. Epub Mar. 23, 2015. |
| Mei et al., Recent Progress in CRISPR/Cas9 Technology. J Genet Genomics. Feb. 20, 2016;43(2):63-75. doi: 10.1016/j.jgg.2016.01.001. Epub Jan. 18, 2016. |
| Mercer et al., Chimeric TALE recombinases with programmable DNA sequence specificity. Nucleic Acids Res. Nov. 2012;40(21):11163-72. doi: 10.1093/nar/gks875. Epub Sep. 26, 2012. |
| Minoche et al., Evaluation of genomic high-throughput sequencing data generated on Illumina HiSeq and genome analyzer systems. Genome Biol. Nov. 8, 2011;12(11):R112. doi: 10.1186/gb-2011-12-11-r112. |
| Mojica et al., Intervening sequences of regularly spaced prokaryotic repeats derive from foreign genetic elements. J Mol Evol. Feb. 2005;60(2):174-82. |
| Mol et al., Crystal structure of human uracil-DNA glycosylase in complex with a protein inhibitor: protein mimicry of DNA. Cell. Sep. 8, 1995;82(5):701-8. |
| Nishida et al., Targeted nucleotide editing using hybrid prokaryotic and vertebrate adaptive immune systems. Science. Sep. 16, 2016;353(6305):1248. pii: aaf8729. doi: 10.1126/science.aaf8729. Epub Aug. 4, 2016. |
| Offord, Advances in Genome Editing. The Scientist, Apr. 20, 2016. http://www.the-scientist.com/?articles.view/articleNo/45903/title/Advances-in-Genome-Editing/. |
| Parker et al., Admixture mapping identifies a quantitative trait locus associated with FEV1/FVC in the COPDGene Study. Genet Epidemiol. Nov. 2014;38(7):652-9. doi: 10.1002/gepi.21847. Epub Aug. 11, 2014. |
| Pearl, Structure and function in the uracil-DNA glycosylase superfamily. Mutat Res. Aug. 30, 2000;460(3-4):165-81. |
| Petolino et al., Editing Plant Genomes: a new era of crop improvement. Plant Biotechnol J. Feb. 2016;14(2):435-6. doi: 10.1111/pbi.12542. |
| Plasterk et al., DNA inversions in the chromosome of Escherichia coli and in bacteriophage Mu: relationship to other site-specific recombination systems. Proc Natl Acad Sci U S A. Sep. 1983;80(17):5355-8. |
| Plosky et al., CRISPR-Mediated Base Editing without DNA Double-Strand Breaks. Mol Cell. May 19, 2016;62(4):477-8. doi: 10.1016/j.molcel.2016.05.006. |
| Pluciennik et al., PCNA function in the activation and strand direction of MutLα endonuclease in mismatch repair. Proc Natl Acad Sci U S A. Sep. 14, 2010;107(37):16066-71. doi: 10.1073/pnas.1010662107. Epub Aug. 16, 2010. |
| Pourcel et al., CRISPR elements in Yersinia pestis acquire new repeats by preferential uptake of bacteriophage DNA, and provide additional tools for evolutionary studies. Microbiology. Mar. 2005;151(Pt 3):653-63. |
| Prashant et al., CAS9 transcriptional activators for target specificity screening and paired nickases for cooperative genome engineering. Nature Biotechnology 2013;31(9):833-8. |
| Prorocic et al., Zinc-finger recombinase activities in vitro. Nucleic Acids Res. Nov. 2011;39(21):9316-28. doi: 10.1093/nar/gkr652. Epub Aug. 17, 2011. |
| Prykhozhij et al., CRISPR multitargeter: a web tool to find common and unique CRISPR single guide RNA targets in a set of similar sequences. PLoS One. Mar. 5, 2015;10(3):e0119372. doi: 10.1371/journal.pone.0119372. eCollection 2015. |
| Putnam et al., Protein mimicry of DNA from crystal structures of the uracil-DNA glycosylase inhibitor protein and its complex with Escherichia coli uracil-DNA glycosylase. J Mol Biol. Mar. 26, 1999;287(2):331-46. |
| Ran et al., Genome engineering using the CRISPR-Cas9 system. Nat Protoc. Nov. 2013;8(11):2281-308. doi: 10.1038/nprot.2013.143. Epub Oct. 24, 2013. |
| Ran et al., In vivo genome editing using Staphylococcus aureus Cas9. Nature. Apr. 9, 2015;520(7546):186-91. doi: 10.1038/nature14299. Epub Apr. 1, 2015. |
| Rath et al., Fidelity of end joining in mammalian episomes and the impact of Metnase on joint processing. BMC Mol Biol. Mar. 22, 2014;15:6. doi: 10.1186/1471-2199-15-6. |
| Ravishankar et al., X-ray analysis of a complex of Escherichia coli uracil DNA glycosylase (EcUDG) with a proteinaceous inhibitor. The structure elucidation of a prokaryotic UDG. Nuclei Acids Res. 26 (21): 4880-4887 (1998). |
| Ray et al., Homologous recombination: ends as the means. Trends Plant Sci. Oct. 2002;7(10):435-40. |
| Rebuzzini et al., New mammalian cellular systems to study mutations introduced at the break site by non-homologous end-joining. DNA Repair (Amst). May 2, 2005;4(5):546-55. |
| Rees et al., Improving the DNA specificity and applicability of base editing through protein engineering and protein delivery. Nat Commun. Jun. 6, 2017;8:15790. doi: 10.1038/ncomms15790. |
| Richardson et al., Enhancing homology-directed genome editing by catalytically active and inactive CRISPR-Cas9 using asymmetric donor DNA. Nat Biotechnol. Mar. 2016;34(3):339-44. doi: 10.1038/nbt.3481. Epub Jan. 20, 2016. |
| Richter et al., Function and regulation of clustered regularly interspaced short palindromic repeats (CRISPR) / CRISPR associated (Cas) systems. Viruses. Oct. 19, 2012;4(10):2291-311. doi: 10.3390/v4102291. |
| Rong et al., Homologous recombination in human embryonic stem cells using CRISPR/Cas9 nickase and a long DNA donor template. Protein Cell. Apr. 2014;5(4):258-60. doi: 10.1007/s13238-014-0032-5. |
| Rowland et al., Regulatory mutations in Sin recombinase support a structure-based model of the synaptosome. Mol Microbiol. Oct. 2009;74(2):282-98. doi: 10.1111/j.1365-2958.2009.06756.x. Epub Jun. 8, 2009. |
| Sadelain et al., Safe harbours for the integration of new DNA in the human genome. Nat Rev Cancer. Dec. 1, 2011;12(1):51-8. doi: 10.1038/nrc3179. |
| Sanjana et al., A transcription activator-like effector toolbox for genome engineering. Nat Protoc. Jan. 5, 2012;7(1):171-92. doi: 10.1038/nprot.2011.431. |
| Saraconi et al., The RNA editing enzyme APOBEC1 induces somatic mutations and a compatible mutational signature is present in esophageal adenocarcinomas. Genome Biol. Jul. 31, 2014;15(7):417. doi: 10.1186/s13059-014-0417-z. |
| Saudek et al., A preliminary trial of the programmable implantable medication system for insulin delivery. N Engl J Med. Aug. 31, 1989;321(9):574-9. |
| Sclimenti et al., Directed evolution of a recombinase for improved genomic integration at a native human sequence. Nucleic Acids Res. Dec. 15, 2001;29(24):5044-51. |
| Sefton et al., Implantable pumps. Crit Rev Biomed Eng. 1987;14(3):201-40. |
| Seripa et al., The missing ApoE allele. Ann Hum Genet. Jul. 2007;71(Pt 4):496-500. Epub Jan. 22, 2007. |
| Shah et al., Inteins: nature's gift to protein chemists. Chem Sci. 2014;5(1):446-461. |
| Shah et al., Target-specific variants of Flp recombinase mediate genome engineering reactions in mammalian cells. FEBS J. Sep. 2015;282(17):3323-33. doi: 10.1111/febs.13345. Epub Jul. 1, 2015. |
| Sharbeen et al., Ectopic restriction of DNA repair reveals that UNG2 excises AID-induced uracils predominantly or exclusively during G1 phase. J Exp Med. May 7, 2012;209(5):965-74. doi: 10.1084/jem.20112379. Epub Apr. 23, 2012. |
| Shcherbakova et al., Near-infrared fluorescent proteins for multicolor in vivo imaging. Nat Methods. Aug. 2013;10(8):751-4. doi: 10.1038/nmeth.2521. Epub Jun. 16, 2013. |
| Shee et al., Engineered proteins detect spontaneous DNA breakage in human and bacterial cells. Elife. Oct. 29, 2013;2:e01222. doi: 10.7554/eLife.01222. |
| Shimantani et al., Targeted base editing in rice and tomato using a CRISPR-Cas9 cytidine deaminase fusion. Nat Biotechnol. May 2017;35(5):441-443. doi: 10.1038/nbt.3833. Epub Mar. 27, 2017. |
| Shimojima et al., Spinocerebellar ataxias type 27 derived from a disruption of the fibroblast growth factor 14 gene with mimicking phenotype of paroxysmal non-kinesigenic dyskinesia. Brain Dev. Mar. 2012;34(3):230-3. doi: 10.1016/j.braindev.2011.04.014. Epub May 19, 2011. |
| Shmakov et al., Discovery and Functional Characterization of Diverse Class 2 CRISPR Cas Systems. Molecular Cell Nov. 2015;60(3):385-97. |
| Simonelli et al., Base excision repair intermediates are mutagenic in mammalian cells. Nucleic Acids Res. Aug. 2, 2005;33(14):4404-11. Print 2005. |
| Sirk et al., Expanding the zinc-finger recombinase repertoire: directed evolution and mutational analysis of serine recombinase specificity determinants. Nucleic Acids Res. Apr. 2014;42(7):4755-66. doi: 10.1093/nar/gkt1389. Epub Jan. 21, 2014. |
| Sjoblom et al., The consensus coding sequences of human breast and colorectal cancers. Science. Oct. 13, 2006;314(5797):268-74. Epub Sep. 7, 2006. |
| Slaymaker et al., Rationally engineered Cas9 nucleases with improved specificity. Science. Jan. 1, 2016;351(6268):84-8. doi: 10.1126/science.aad5227. Epub Dec. 1, 2015. |
| Smith et al., Expression of a dominant negative retinoic acid receptor γ in Xenopus embryos leads to partial resistance to retinoic acid. Roux Arch Dev Biol. Mar. 1994;203(5):254-265. doi: 10.1007/BF00360521. |
| Stenglein et al., APOBEC3 proteins mediate the clearance of foreign DNA from human cells. Nat Struct Mol Biol. Feb. 2010;17(2):222-9. doi: 10.1038/nsmb.1744. Epub Jan. 10, 2010. |
| Stephens et al., The landscape of cancer genes and mutational processes in breast cancer. Nature Jun. 2012;486:400-404. doi:10.1038/nature11017. |
| Stevens et al., Design of a Split Intein with Exceptional Protein-Splicing Activity. J Am Chem Soc. Feb. 24, 2016;138(7):2162-5. doi: 10.1021/jacs.5b13528. Epub Feb. 8, 2016. |
| Swarts et al., Argonaute of the archaeon Pyrococcus furiosus is a DNA-guided nuclease that targets cognate DNA. Nucleic Acids Res. May 26, 2015;43(10):5120-9. doi: 10.1093/nar/gkv415. Epub Apr. 29, 2015. |
| Swarts et al., DNA-guided DNA interference by a prokaryotic Argonaute. Nature. Mar. 13, 2014;507(7491):258-61. doi: 10.1038/nature12971. Epub Feb. 16, 2014. |
| Swarts et al., The evolutionary journey of Argonaute proteins. Nat Struct Mol Biol. Sep. 2014;21(9):743-53. doi: 10.1038/nsmb.2879. |
| Tagalakis et al., Lack of RNA-DNA oligonucleotide (chimeraplast) mutagenic activity in mouse embryos. Mol Reprod Dev. Jun. 2005;71(2):140-4. |
| Tang et al., Aptazyme-embedded guide RNAs enable ligand-responsive genome editing and transcriptional activation. Nat Commun. Jun. 28, 2017;8:15939. doi: 10.1038/ncomms15939. |
| Thyagarajan et al., Mammalian genomes contain active recombinase recognition sites. Gene. Feb. 22, 2000;244(1-2):47-54. |
| Thyagarajan et al., Site-specific genomic integration in mammalian cells mediated by phage phiC31 integrase. Mol Cell Biol. Jun. 2001;21(12):3926-34. |
| Tirumalai et al., Recognition of core-type DNA sites by lambda integrase. J Mol Biol. Jun. 12, 1998;279(3):513-27. |
| Tourdot et al., A general strategy to enhance immunogenicity of low-affinity HLA-A2. 1-associated peptides: implication in the identification of cryptic tumor epitopes. Eur J Immunol. Dec. 2000;30(12):3411-21. |
| Tsai et al., GUIDE-seq enables genome-wide profiling of off-target cleavage by CRISPR-Cas nucleases. Nat Biotechnol. Feb. 2015;33(2):187-97. doi: 10.1038/nbt.3117. Epub Dec. 16, 2014. |
| Turan et al., Recombinase-mediated cassette exchange (RMCE)—a rapidly-expanding toolbox for targeted genomic modifications. Gene. Feb. 15, 2013;515(1):1-27. doi: 10.1016/j.gene.2012.11.016. Epub Nov. 29, 2012. |
| Turan et al., Recombinase-mediated cassette exchange (RMCE): traditional concepts and current challenges. J Mol Biol. Mar. 25, 2011;407(2):193-221. doi: 10.1016/j.jmb.2011.01.004. Epub Jan. 15, 2011. |
| Vagner et al., Efficiency of homologous DNA recombination varies along the Bacillus subtilis chromosome. J Bacteriol. Sep. 1988;170(9):3978-82. |
| Van Swieten et al., A mutation in the fibroblast growth factor 14 gene is associated with autosomal dominant cerebellar ataxia [corrected]. Am J Hum Genet. Jan. 2003;72(1):191-9. Epub Dec. 13, 2002. |
| Wang et al., CRISPR-Cas9 Targeting of PCSK9 in Human Hepatocytes In Vivo—Brief Report. Arterioscler Thromb Vasc Biol. May 2016;36(5):783-6. doi: 10.1161/ATVBAHA.116.307227. Epub Mar. 3, 2016. |
| Wang et al., Nucleation, propagation and cleavage of target RNAs in Ago silencing complexes. Nature. Oct. 8, 2009;461(7265):754-61. doi: 10.1038/nature08434. |
| Wang et al., Recombinase technology: applications and possibilities. Plant Cell Rep. Mar. 2011;30(3):267-85. doi: 10.1007/s00299-010-0938-1. Epub Oct. 24, 2010. |
| Wang et al., Uracil-DNA glycosylase inhibitor gene of bacteriophage PBS2 encodes a binding protein specific for uracil-DNA glycosylase. J Biol Chem. Jan. 15, 1989;264(2):1163-71. |
| Warren et al., A chimeric Cre recombinase with regulated directionality. Proc Natl Acad Sci U S A. Nov. 25, 2008;105(47):18278-83. doi: 10.1073/pnas.0809949105. Epub Nov. 14, 2008. |
| Warren et al., Mutations in the amino-terminal domain of lambda-integrase have differential effects on integrative and excisive recombination. Mol Microbiol. Feb. 2005;55(4):1104-12. |
| Wijnker et al., Managing meiotic recombination in plant breeding. Trends Plant Sci. Dec. 2008;13(12):640-6. doi: 10.1016/j.tplants.2008.09.004. Epub Oct. 22, 2008. |
| Wolf et al., tadA, an essential tRNA-specific adenosine deaminase from Escherichia coli. EMBO J. Jul. 15, 2002;21(14):3841-51. |
| Wu et al., Genome-wide binding of the CRISPR endonuclease Cas9 in mammalian cells. Nat Biotechnol. Jul. 2014;32(7):670-6. doi: 10.1038/nbt.2889. Epub Apr. 20, 2014. |
| Xu et al., Sequence determinants of improved CRISPR sgRNA design. Genome Res. Aug. 2015;25(8):1147-57. doi: 10.1101/gr.191452.115. Epub Jun. 10, 2015. |
| Yahata et al., Unified, Efficient, and Scalable Synthesis of Halichondrins: Zirconium/Nickel-Mediated One-Pot Ketone Synthesis as the Final Coupling Reaction. Angew Chem Int Ed Engl. Aug. 28, 2017;56(36):10796-10800. doi: 10.1002/anie.201705523. Epub Jul. 28, 2017. |
| Yamamoto et al., Virological and immunological bases for HIV-1 vaccine design. Uirusu 2007;57(2):133-139. https://doi.org/10.2222/jsv.57.133. |
| Yamano et al., Crystal Structure of Cpf1 in Complex with Guide RNA and Target DNA. Cell May 2016;165(4)949-62. |
| Yang et al., Engineering and optimising deaminase fusions for genome editing. Nat Commun. Nov. 2, 2016;7:13330. doi: 10.1038/ncomms13330. |
| Yang et al., Genome editing with targeted deaminases. BioRxiv. Preprint. First posted online Jul. 28, 2016. |
| Yang et al., New CRISPR-Cas systems discovered. Cell Res. Mar. 2017;27(3):313-314. doi: 10.1038/cr.2017.21. Epub Feb. 21, 2017. |
| Yang et al., PAM-dependent Target DNA Recognition and Cleavage by C2C1 CRISPR-Cas endonuclease. Cell Dec. 2016;167(7):1814-28. |
| Yuan et al., Tetrameric structure of a serine integrase catalytic domain. Structure. Aug. 6, 2008;16(8):1275-86. doi: 10.1016/j.str.2008.04.018. |
| Yuen et al., Control of transcription factor activity and osteoblast differentiation in mammalian cells using an evolved small-molecule-dependent intein. J Am Chem Soc. Jul. 12, 2006;128(27):8939-46. |
| Zetsche et al., A split-Cas9 architecture for inducible genome editing and transcription modulation. Nat Biotechnol. Feb. 2015;33(2):139-42. doi: 10.1038/nbt.3149. |
| Zetsche et al., Cpf1 is a single RNA-guided endonuclease of a class 2 CRISPR-Cas system. Cell. Oct. 22, 2015;163(3):759-71. doi: 10.1016/j.cell.2015.09.038. Epub Sep. 25, 2015. |
| Zhang et al., Comparison of non-canonical PAMs for CRISPR/Cas9-mediated DNA cleavage in human cells. Sci Rep. Jun. 2014;4:5405. |
| Zhang et al., Programmable base editing of zebrafish genome using a modified CRISPR-Cas9 system. Nat Commun. Jul. 25, 2017;8(1):118. doi: 10.1038/s41467-017-00175-6. |
| Zhang et al., Stabilized plasmid-lipid particles for regional gene therapy: formulation and transfection properties. Gene Ther. Aug. 1999;6(8):1438-47. |
| Zheng et al., DNA editing in DNA/RNA hybrids by adenosine deaminases that act on RNA. Nucleic Acids Res. Apr. 7, 2017;45(6):3369-3377. doi: 10.1093/nar/gkx050. |
| Zong et al., Precise base editing in rice, wheat and maize with a Cas9-cytidine deaminase fusion. Nat Biotechnol. May 2017;35(5):438-440. doi: 10.1038/nbt.3811. Epub Feb. 27, 2017. |
| Zuris et al., Cationic lipid-mediated delivery of proteins enables efficient protein-based genome editing in vitro and in vivo. Nat Biotechnol. 2015;33:73-80. |
| Chavez et al., Precise Cas9 targeting enables genomic mutation prevention. Jun. 14, 2016. [Preprint]. |
| Nishida et al., Targeted nucleotide editing using hybrid prokaryotic and vertebrate adaptive immune systems. Science. Sep. 16, 2016;353(6305). pii: aaf8729. doi: 10.1126/science.aaf8729. Epub Aug. 4, 2016. |
| Qi et al., Engineering naturally occuring trans-acting non-coding RNAs to sense molecular signals. Nucleic Acids Res. Jul. 2012;40(12):5775-86. doi: 10.1093/nar/gks168. Epub Mar. 1, 2012. |
| Truong et al., Development of an intein-mediated split-Cas9 system for gene therapy. Nucleic Acids Res. Jul. 27, 2015;43(13):6450-8. doi: 10.1093/nar/gkv601. Epub Jun. 16, 2015. |
| Aihara et al., A conformational switch controls the DNA cleavage activity of lambda integrase. Mol Cell. 2003 Ju1;12(1):187-98. |
| Ames et al., A eubacterial riboswich class that senses the coenzyme tetrahydrofolate. Chem Bio Jul. 30, 2010; 17(7);681-5. doi: 10.1016/j.chembio.2010.05.020. |
| Batey et al., Structure of a natural guanine-responsive riboswitch complexed with the metabolite hypoxanthine. Nature. Nov. 18, 2004;432(7015):411-5. |
| Bershtein et al., Advances in laboratory evolution of enzymes. Curr Opin Chem Biol. Apr. 2008;12(2):151-8. doi: 10.1016/j.cbpa.2008.01.027. Epub Mar. 7, 2008. Review. |
| Bogdanove et al., TAL effectors: customizable proteins for DNA targeting. Science. Sep. 30, 2011 ;333(6051):1843-6. doi: 10.1126/science.1204094. |
| Burstein et al.: New CRISPR-Cas systems from uncultivated microbes. Nature. vol. 542. no. 7640. Dec. 22, 2016 (Dec. 22, 2016). Pages 237-241. XP055480893.GB ISSN: 00280836. DOI: 10.1038jnature21059. |
| Buskirk et al., Directed evolution of ligand dependence: small-molecule-activated protein splicing. Proc Natl Acad Sci U.S.A. Jul. 20, 2004;101(29):10505-10. Epub Jul. 9, 2004 . |
| Chen et al., Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. Oct. 2013;65(10):1357-69. doi:10.1016/j.addr.2012.09.039. Epub Sep. 29, 2012. |
| Cobb et al., Directed evolution an enabling synthetic biology tool. Curr Opin chem Biol. Aug. 2012;16(3-4):285-91. doi:10.1016/j.cbpa.2012.05.186.Epub Jun. 4, 2012. Review. |
| Cobb et al., Directed evolution as a powerful synthetic biology tool. Methods. Mar. 15, 2013;60(1):81-90. doi: 10.1016/j.ymeth.2012.03.009. Epub Mar. 23, 2012. |
| Dixon et al., Reengineering orthogonally selective riboswitches. Proc Natl Acad Sci U.S.A. Feb. 16, 2010;107(7):2830-5. doi: 10.1073/pnas.0911209107. Epub Jan. 26, 2010. |
| Edwards et al., Crystal structures of the thi-box riboswitch bound to thiamine pyrophosphate analogs reveal adaptive RNA-small molecule recognition. Structure. Sep. 2006;14(9):1459-68. |
| Esvelt et al., A system for the continuous directed evolution of biomolecules. Nature. Apr. 28, 2011 ;472(7344):499-503. doi: 10.1038/nature09929. Epub Apr. 10, 2011. |
| Fischer et al., Cryptic epitopes induce high-titer humoral immune response in patients with cancer. J Immunol. Sep. 1, 2010 ;185(5):3095-102. doi: 10.4049/jimmuno1.0902166. Epub 2010. |
| Hida et al., Directed evolution for drug and nucleic acid delivery. Adv Drug Deliv Rev. Dec. 22, 2007;59(15):1562-78. Epub Aug. 28, 2007. Review. |
| Husimi, Selection and evolution of bacteriophages in cellstat. Adv Biophys. 1989;25:1-43. Review. |
| Kakiyama et al., A peptide release system using a photo-cleavable linker in a cell array format for cell-toxicity analysis. Polymer J. Feb. 27, 2013;45:535-9. |
| Kang et al., Structural Insights into riboswitch control of the biosynthesis of queuosine, a modified nucleotide found in the anticodon of tRNA. Mol Cell. Mar. 27, 2009;33(6):784-90. doi: 10.1016/j.molcel.2009.02.019. Epub Mar. 12, 2009. |
| Klein et al., Cocrystal structure of a class I preQi riboswitch reveals a pseudoknot recognizing an essential hypermodified nucleobase. Nat Struct Mol Biol. Mar. 2009;16(3):343-4. doi: 10.1038/nsmb.1563.Epub Feb. 22, 2009. |
| Kwon et al., Chemical basis of glycine riobswitch cooperativitiy. RNA. Jan. 2008; 14(1):25-34.Epub Nov. 27, 2007. |
| Lee et al., An allosteric self-splicing ribozyme triggered by a bacterial second messenger. Science. Aug. 13, 2010;329(5993):845-8. doi: 10.1126/science.1190713. |
| Liu et al., Fast Colorimetric Sensing of Adenosine and Cocaine Based on a General Sensor Design Involving Aptamers and Nanoparticles. Angew Chem. Dec. 16, 2006;45(1):90-4. DOI: 10.1002/anie.200502589. |
| Meyer et al., Confirmation of a second natuarl preQ1 aptamer class in Streptococcacae bacterial. RNA. 2008 Apri; 14(4):685-95. doi: 10.1261/rna.937308. Epub Feb. 27, 2008. |
| Montage et al., Structure of the S-adenosylemethionine riboswitch regulatory mRNA element. Nature. Jun. 29, 2006;441(7079):1172-5. |
| Mootz et al. Conditional proten splicing; a new tool to control protein structure and fuction in vitro and invivo. J. Am Chem Soc. Sep. 3, 2003:125(35):10560-9. |
| Mootz et al., Protein splicing triggered by a small molecule. J Am Chem Soc. Aug. 7, 2002;124(31):9044-5. |
| Nahvi et al., Coenzyme B12 riboswitchen are widespread genetic control elements in proaryotes. Nucleic Acids Res. Jan. 2, 2004;32(1):143-50. |
| Neel et al., Riboswitches: Classification, function and in silico approach, International Journal of Pharma Sciences and Research. 2010;1(9):409-420. |
| Nelson et al., Filamentous phage DNA cloning vectors: a noninfective mutant with a nonpolar deletion in gene III. Virology. 1981; 108(2): 338-50. |
| Ni et al., Nucleic acid aptamers: clinical applications and promising new horizons. Curr Med Chem. 2011;18(27):4206-14. Review. |
| Peck et al., Directed evolution of a small-molecule-triggered intein with improved splicing properties in mammalian cells. Chem Biol. May 27, 2011;18(5):619-30. doi: 10.1016/j.chembiol.2011.02.014. |
| Rakonjac et al., Roles of PIII in filamentous phage assembly. J Mol Biol. 1998; 282(1)25-41. |
| Riechmann et al.,. The C-terminal domain of TolA is the coreceptor for filamentous phage infection of E. coli. Cell. 1997; 90(2):351-60. PMID:9244308. |
| Saleh-Gohari et al., Conservative homologous recombination preferentially repairs DNA double-strand breaks in the S phase of the cell cycle in human cells. Nucleic Acids Res. Jul. 13, 2004;32(12):3683-8. Print 2004. |
| Serganov et al., Structural basis for discriminative regulation of gene expression by adenine and guanine-sensing mRNAs. Chem biol. Dec. 2004;11(12):1729-41. |
| Serganov et al., Coenzyme recognition and gene regulation by a flavin mononucleotide riboswitch. Nature. 2009 Mar. 12;458(7235):233-7. doi: 10.1038/nature07642. Epub Jan. 25, 2009. |
| Serganov et al., Structural basis for gene regulation by a thiamine pyrophosphate-sensing riboswitch. Nature. Jun. 29, 2006;441(7097):1167-71. Epub May 21, 2006. |
| Skretas et al., Regulation of protein activity with small-molecule-controlled inteins. Protein Sci. Feb. 2005;14(2):523-32. Epub Jan. 4, 2005. |
| Smith, Filamentous fusion phage: novel expression vectors that display cloned antigens on the virion surface. Science. Jun. 14, 1985;228(4705):1315-7. |
| Sudarsan et al., An mRNA structure in bacteria that controls gene expression by binding lysine. Genes Dev. Nov. 1, 2003;17(21):2688-97. |
| Sudarsan et al., Riboswitches in eubacteria sense the second messenger cyclic di-GMP. Science. Jul. 18, 2008 18;321(5887):411-3. doi: 10.1126/science.1159519. |
| Suess et al., A theophylline responsive riboswitch based on helix slipping controls gene expression in vivo. Nucleic Acids Res. Mar. 5, 2004;32(4):1610-4. |
| Trausch et al., the structure of a tetrahydrofolate-sensing riboswitch reveals two ligand binding sites in a single aptamer. Structure. Oct. 12, 2011;19(10):1413-23. doi: 10.1016/j.str.2011.06.019. Epub Sep. 8, 2011. |
| Weinberg et al., The aptamer core of SAM-IV riboswitchees mimics the ligand-binding site of SAM-I riboswitches. RNA. May 2008: 14(5):822-8. doi: 10.1261/rna.988608. Epub Mar. 27, 2008. |
| Winkler et al., an mRNA structure that controls gene expression by binding FMN. Proc Natl Acad Sci U.S.A. Dec. 10, 2002;99(25):15908-13. Epub Nov. 27, 2002. |
| Winkler et al., Control of gene expression by a natural metabolite-responsive ribozyme. Nature. Mar. 18, 2004;428(6980):281-6. |
| Winkler et al., Thiamine derivatives bind messenger RNAs directly to regulate bacterial gene expression. Nature. Oct. 31, 2002;419(6910):952-6. Epub Oct. 16, 2002. |
| Yuan et al., Laboratory-directed protein evolution. Microbiol Mol Biol Rev. 2005; 69(3):373-92. PMID: 16148303. |
| Zimmermann et al., Molecular interactions and metal binding in the theophylline-binding core of an RNA aptamer. RNA. May 2000;6(5):659-67. |
| Extended European Search Report for EP18199195.1, dated Feb. 12, 2019. |
| International Preliminary Report on Patentability for PCT/US2014/048390, dated Mar. 7, 2019. |
| International Preliminary Report on Patentability for PCT/US2017/046144, dated Feb. 21, 2019. |
| International Preliminary Report on Patentability for PCT/US2017/045381, dated Feb. 14, 2019. |
| International Preliminary Report on Patentability for PCT/US2017/056671, dated Apr. 25, 2019. |
| Requirement for Restriction/Election, dated Nov. 24, 2014, in connection with U.S. Appl. No. 14/325,815. |
| Office Action, dated Feb. 11, 2015, in connection with U.S. Appl. No. 14/325,815. |
| Office Action, dated Jun. 4, 2015, in connection with U.S. Appl. No. 14/325,815. |
| Advisory Action dated Sep. 16, 2015 in connection with U.S. Appl. No. 14/325,815. |
| Office Action, dated Jan. 5, 2016, in connection with U.S. Appl. No. 14/325,815. |
| Office Action, dated Jun. 7, 2016, in connection with U.S. Appl. No. 14/325,815. |
| Advisory Action dated Nov. 28, 2016 in connection with U.S. Appl. No. 14/325,815. |
| Office Action, dated Jan. 12, 2017, in connection with U.S. Appl. No. 14/325,815. |
| Applicant Initiated Interview Summary, dated May 2, 2017, in connection with U.S. Appl. No. 14/325,815. |
| Office Action, dated Sep. 27, 2017, in connection with U.S. Appl. No. 14/325,815. |
| Office Action, dated Jan. 17, 2018, in connection with U.S. Appl. No. 14/325,815. |
| Office Action, dated Sep. 6, 2018, in connection with U.S. Appl. No. 14/325,815. |
| Office Action and Applicant Initiated Interview Summary, dated May 6, 2019, in connection with U.S. Appl. No. 14/325,815. |
| Requirement for Restriction/Election, dated Nov. 13, 2014, in connection with U.S. Appl. No. 14/326,109. |
| Office Action, dated Apr. 24, 2015, in connection with U.S. Appl. No. 14/326,109. |
| Office Action, dated Nov. 13, 2015, in connection with U.S. Appl. No. 14/326,109. |
| Office Action, dated Jul. 11, 2016, in connection with U.S. Appl. No. 14/326,109. |
| Advisory Action, dated Nov. 26, 2016, in connection with U.S. Appl. No. 14/326,109. |
| Office Action, dated Feb. 16, 2017, in connection with U.S. Appl. No. 14/326,109. |
| Applicant Initiated Interview Summary, dated May 22, 2017, in connection with U.S. Appl. No. 14/326,109. |
| Examiner Initiated Interview Summary, dated Aug. 17, 2017 in connection with U.S. Appl. No. 14/326,109. |
| Notice of Allowance, dated Aug. 17, 2017 in connection with U.S. Appl. No. 14/326,109. |
| Requirement for Restriction/Election, dated Nov. 25, 2014, in connection with U.S. Appl. No. 14/326,140. |
| Office Action, dated Feb. 10, 2015, in connection with U.S. Appl. No. 14/326,140. |
| Office Action, dated Jun. 1, 2015, in connection with U.S. Appl. No. 14/326,140. |
| Advisory Action, dated Sep. 15, 2015, in connection with U.S. Appl. No. 14/326,140. |
| Requirement for Restriction/Election, dated Jan. 20, 2016, in connection with U.S. Appl. No. 14/326,140. |
| Office Action, dated May 5, 2016, in connection with U.S. Appl. No. 14/326,140. |
| Office Action, dated Sep. 7, 2016, in connection with U.S. Appl. No. 14/326,140. |
| Applicant Initiated Interview Summary, dated Dec. 5, 2016, in connection with U.S. Appl. No. 14/326,140. |
| Office Action, dated Nov. 21, 2014, in connection with U.S. Appl. No. 14/326,269. |
| Notice of Allowance, dated Apr. 3, 2015, in connection with U.S. Appl. No. 14/326,269 |
| Requirement for Restriction/Election, dated Nov. 26, 2014, in connection with U.S. Appl. No. 14/326,290. |
| Office Action, dated May 1, 2015, in connection with U.S. Appl. No. 14/326,290. |
| Office Action, dated Oct. 16, 2015, in connection with U.S. Appl. No. 14/326,290. |
| Advisory Action, dated Feb. 5, 2016, in connection with U.S. Appl. No. 14/326,290. |
| Office Action, dated Mar. 10, 2016, in connection with U.S. Appl. No. 14/326,290. |
| Office Action, dated Sep. 22, 2016, in connection with U.S. Appl. No. 14/326,290. |
| Applicant Initiated Interview Summary, dated Dec. 6, 2016, in connection with U.S. Appl. No. 14/326,290. |
| Office Action, dated Jun. 1, 2017, in connection with U.S. Appl. No. 14/326,290. |
| Office Action, dated Jan. 16, 2018, in connection with U.S. Appl. No. 14/326,290. |
| Advisory Action, dated Jul. 6, 2018, in connection with U.S. Appl. No. 14/326,290. |
| Requirement for Restriction/Election, dated Nov. 24, 2014, in connection with U.S. Appl. No. 14/326,318. |
| Office Action, dated Feb. 26, 2015, in connection with U.S. Appl. No. 14/326,318. |
| Office Action, dated Jun. 15, 2015, in connection with U.S. Appl. No. 14/326,318. |
| Advisory Action, dated Sep. 23, 2015, in connection with U.S. Appl. No. 14/326,318. |
| Requirement for Restriction/Election, dated Jan. 22, 2016, in connection with U.S. Appl. No. 14/326,318. |
| Office Action, dated Feb. 7, 2017, in connection with U.S. Appl. No. 14/326,318. |
| Advisory Action, dated Jun. 16, 2017, in connection with U.S. Appl. No. 14/326,318. |
| Office Action, dated Jun. 27, 2016, in connection with U.S. Appl. No. 14/326,318. |
| Office Action, dated Oct. 11, 2017, in connection with U.S. Appl. No. 14/326,318. |
| Office Action, dated Oct. 26, 2018, in connection with U.S. Appl. No. 14/326,318. |
| Requirement for Restriction/Election, dated Nov. 25, 2014, in connection with U.S. Appl. No. 14/326,303. |
| Office Action, dated Apr. 9, 2015, in connection with U.S. Appl. No. 14/326,303. |
| Office Action, dated Sep. 11, 2015, in connection with U.S. Appl. No. 14/326,303. |
| Advisory Action, dated Dec. 21, 2015, in connection with U.S. Appl. No. 14/326,303. |
| Office Action, dated Mar. 18, 2016, in connection with U.S. Appl. No. 14/326,303. |
| Office Action, dated Oct. 5, 2016, in connection with U.S. Appl. No. 14/326,303. |
| Interview Summary, dated Jan. 27, 2017, in connection with U.S. Appl. No. 14/326,303. |
| Number | Date | Country | |
|---|---|---|---|
| 20160304846 A1 | Oct 2016 | US |
| Number | Date | Country | |
|---|---|---|---|
| 61980333 | Apr 2014 | US | |
| 61915386 | Dec 2013 | US |
| Number | Date | Country | |
|---|---|---|---|
| Parent | 14325815 | Jul 2014 | US |
| Child | 15103608 | US | |
| Parent | 14326109 | Jul 2014 | US |
| Child | 14325815 | US | |
| Parent | 14326140 | Jul 2014 | US |
| Child | 14326109 | US | |
| Parent | 14326269 | Jul 2014 | US |
| Child | 14326140 | US | |
| Parent | 14326290 | Jul 2014 | US |
| Child | 14326269 | US | |
| Parent | 14326318 | Jul 2014 | US |
| Child | 14326290 | US | |
| Parent | 14326303 | Jul 2014 | US |
| Child | 14326318 | US |
